FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 624

FusionGeneSummary for ACTR2_TSGA10

check button Fusion gene summary
Fusion gene informationFusion gene name: ACTR2_TSGA10
Fusion gene ID: 624
HgeneTgene
Gene symbol

ACTR2

TSGA10

Gene ID

10097

80705

Gene nameARP2 actin related protein 2 homologtestis specific 10
SynonymsARP2CEP4L|CT79|SPGF26
Cytomap

2p14

2q11.2

Type of geneprotein-codingprotein-coding
Descriptionactin-related protein 2actin-like protein 2testis-specific gene 10 proteincancer/testis antigen 79testis development protein NYD-SP7testis-specific 10 protein
Modification date2018051920180519
UniProtAcc

P61160

Q9BZW7

Ensembl transtripts involved in fusion geneENST00000260641, ENST00000476840, 
ENST00000542850, ENST00000377982, 
ENST00000393483, ENST00000410001, 
ENST00000355053, ENST00000539964, 
ENST00000542655, ENST00000478090, 
Fusion gene scores* DoF score5 X 5 X 4=1004 X 4 X 3=48
# samples 54
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ACTR2 [Title/Abstract] AND TSGA10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneACTR2

GO:0034314

Arp2/3 complex-mediated actin nucleation

11741539


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-22-5492-01AACTR2chr2

65455091

+TSGA10chr2

99722160

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000260641ENST00000393483ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000260641ENST00000410001ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000260641ENST00000355053ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000260641ENST00000539964ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000260641ENST00000542655ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5CDS-5UTRENST00000260641ENST00000478090ACTR2chr2

65455091

+TSGA10chr2

99722160

-
3UTR-3CDSENST00000476840ENST00000393483ACTR2chr2

65455091

+TSGA10chr2

99722160

-
3UTR-3CDSENST00000476840ENST00000410001ACTR2chr2

65455091

+TSGA10chr2

99722160

-
3UTR-3CDSENST00000476840ENST00000355053ACTR2chr2

65455091

+TSGA10chr2

99722160

-
3UTR-3CDSENST00000476840ENST00000539964ACTR2chr2

65455091

+TSGA10chr2

99722160

-
3UTR-3CDSENST00000476840ENST00000542655ACTR2chr2

65455091

+TSGA10chr2

99722160

-
3UTR-5UTRENST00000476840ENST00000478090ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5UTR-3CDSENST00000542850ENST00000393483ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5UTR-3CDSENST00000542850ENST00000410001ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5UTR-3CDSENST00000542850ENST00000355053ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5UTR-3CDSENST00000542850ENST00000539964ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5UTR-3CDSENST00000542850ENST00000542655ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5UTR-5UTRENST00000542850ENST00000478090ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000377982ENST00000393483ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000377982ENST00000410001ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000377982ENST00000355053ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000377982ENST00000539964ACTR2chr2

65455091

+TSGA10chr2

99722160

-
In-frameENST00000377982ENST00000542655ACTR2chr2

65455091

+TSGA10chr2

99722160

-
5CDS-5UTRENST00000377982ENST00000478090ACTR2chr2

65455091

+TSGA10chr2

99722160

-

Top

FusionProtFeatures for ACTR2_TSGA10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACTR2

P61160

TSGA10

Q9BZW7

Functions as ATP-binding component of the Arp2/3 complexwhich is involved in regulation of actin polymerization andtogether with an activating nucleation-promoting factor (NPF)mediates the formation of branched actin networks. Seems tocontact the pointed end of the daughter actin filament.{ECO:0000269|PubMed:9000076}. May play a role in the sperm tail fibrous sheath, amajor sperm tail structure. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACTR2chr2:65455091chr2:99722160ENST00000260641+19160_16216395Nucleotide bindingATP
HgeneACTR2chr2:65455091chr2:99722160ENST00000260641+19214_21816395Nucleotide bindingATP
HgeneACTR2chr2:65455091chr2:99722160ENST00000260641+19305_31016395Nucleotide bindingATP
HgeneACTR2chr2:65455091chr2:99722160ENST00000377982+110160_16216400Nucleotide bindingATP
HgeneACTR2chr2:65455091chr2:99722160ENST00000377982+110214_21816400Nucleotide bindingATP
HgeneACTR2chr2:65455091chr2:99722160ENST00000377982+110305_31016400Nucleotide bindingATP


Top

FusionGeneSequence for ACTR2_TSGA10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000393483_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000410001_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000355053_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000539964_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000542655_chr2_99722160_-_244aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000393483_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000410001_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000355053_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000539964_chr2_99722160_-_645aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK
IMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQ
DVSRMRRQLDETNDELAQIARERDILAHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMM
EQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKMEEELQKVQFEKVSA
LADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANERISMQNLEALLVANRDKETQSQIALQEKESEIQL
LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNTSSNATHMSSTMKPNTKCHSPERAHHRSPDRG

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000542655_chr2_99722160_-_244aa
MDSQGRKVVVCDNGTGAQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHLEQRI
EELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLTENTEKDLSDTQRHLAKKKTELQLTQEK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000393483_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000410001_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000355053_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000539964_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000542655_chr2_99722160_-_732nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000393483_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000410001_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000355053_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000539964_chr2_99722160_-_1935nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA
GAAAAGACCATTTCAGGCATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAA
GACGTTTCCAGAATGCGTCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAAT
GACAATCTCCAGGAACAGTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGAC
ATAAAACAGAAGGTTCAAGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATG
GAACAACTTCGAAAAGCCAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAA
CTTATCACTGCTGAGGCAGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGG
TCTTACAAGTCCCAGATTTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCT
CTTGCAGATTTGTCTTCTACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAA
GAAATAGAAATGAGGGAGAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATG
CAGAATCTAGAAGCTTTGCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTT
CTTAAAGAACACCTTTGTTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAA
GCTGATTTAGACATTACCAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCA
AGTAATGCTTATCATATGAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGC

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000542655_chr2_99722160_-_732nt
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAA
AGCTGTAAGAGTCCTAAATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGA
ATGACCACAGAACGAGATAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATA
GAGGAGCTGGAGTGTACAGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACT
GTGGAAAAAGAAATGAAATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGA
CTTTTGTATGAAAACACAGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAA
ATTATGTGCTTGGATGAAAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAAT
GATCTGGCTAAAGAAAAGGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000393483_chr2_99722160_-_3028nt
AGCTAAATGACGGGCGGAGCCCGGCGGCGGCTTCCGGTCGGGGGAAAAAAGTTGGGCCGAAGGAGGGGCCGGGAAGACGCAAGAGGAAGA
AGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAGGAAGGT
GGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAAATCAAC
AACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGATAGTCT
AAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTACAGTTCA
TAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAAATCACT
AGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACACAGAAAA
AGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGAAAAAAT
TGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAAGGAATG
CCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGGCATGAA
GAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCGTCGGCA
ATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACAGTTTGC
TAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCAAGATAC
TAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGCCAATGA
AGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGCAGAGGG
TAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGATTTCTAC
CTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTCTACTAG
GGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGAGAATGA
GTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTTGCTGGT
GGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTGTTTGGC
AGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTACCAAAAG
ACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATATGAGTTC
TACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGAAGAGAA
TCTTTGCTACAGAGATTTCTGACACCTGAAATGATTCTTCACATCCCTGAGAAAGGTCAAAGTTACAAACTGATTTTTTTTTTTTTGCTA
CATGAGTGCATTTATCTTTTAAATGCTTGGCAATGTTAAATGTATTTATTAACTTTGTGTCTCTGAATCTCTGTTCTAATGTGCCATGTT
GCAGTGATCTGAGATGACTTATAAAAACAAAAATGTATATGGCTCTTTCTATCCATGCAGTGATAGTGAGTGTAAAATCTGCTTACTTCA
CTATTGAACACTATTCTGTTCACTATCTGGAGTAAATAAAGAAGCTTATTAAAACAGGGAAAAGTGTTTTTACAAAACTGCTTTCCTTTC
CTTTCTTGGTATCTCAAATAATTGGTTGGTTAATTTTTTTTCTTTGTGATTTGTGTTTTCATGGCTGGAAAATCTGTGCCAAAATGGGTA
CAACTTACTGATACTGGTCTGGGATCTGATATTCCATTTTGGAACCAACCTTACATGAATTCCATGCCATAATCTGATATTGAAGCAGCA
GAAAGTAGGAGTGTTGTCAGGGTTTTAAAACCTATAGTATTGTACCACTCAAAGACTAAGTAACATACATATTCTACAATTGTGTTTACT
ACTACTGCTTTTAGAAAGGTAGGTGATGGTATATCTGTCAAGAATGTAAGATTTTATTAAAAATCTTTATTTTTAATAAGTTTTCTTTCA
AGTACTGCAATCAACTTAATTGCGATTTTATTTTATTGTCTGTGGCAGCTGTCTGTAATCTGGAGTAATAAGATAAGTGATGTTTCCTTC
CTCCCCCAATTTCCTAAATCTCTTACCTTATCTATCCATAGGCTTTGATGTAATGTTCATATTAGAGCCTGAATGCTACTGTATTTTACT

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000410001_chr2_99722160_-_2403nt
AGCTAAATGACGGGCGGAGCCCGGCGGCGGCTTCCGGTCGGGGGAAAAAAGTTGGGCCGAAGGAGGGGCCGGGAAGACGCAAGAGGAAGA
AGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAGGAAGGT
GGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAAATCAAC
AACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGATAGTCT
AAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTACAGTTCA
TAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAAATCACT
AGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACACAGAAAA
AGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGAAAAAAT
TGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAAGGAATG
CCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGGCATGAA
GAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCGTCGGCA
ATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACAGTTTGC
TAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCAAGATAC
TAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGCCAATGA
AGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGCAGAGGG
TAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGATTTCTAC
CTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTCTACTAG
GGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGAGAATGA
GTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTTGCTGGT
GGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTGTTTGGC
AGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTACCAAAAG
ACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATATGAGTTC
TACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGAAGAGAA
TCTTTGCTACAGAGATTTCTGACACCTGAAATGATTCTTCACATCCCTGAGAAAGGTCAAAGTTACAAACTGATTTTTTTTTTTTTGCTA
CATGAGTGCATTTATCTTTTAAATGCTTGGCAATGTTAAATGTATTTATTAACTTTGTGTCTCTGAATCTCTGTTCTAATGTGCCATGTT
GCAGTGATCTGAGATGACTTATAAAAACAAAAATGTATATGGCTCTTTCTATCCATGCAGTGATAGTGAGTGTAAAATCTGCTTACTTCA

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000355053_chr2_99722160_-_2403nt
AGCTAAATGACGGGCGGAGCCCGGCGGCGGCTTCCGGTCGGGGGAAAAAAGTTGGGCCGAAGGAGGGGCCGGGAAGACGCAAGAGGAAGA
AGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAGGAAGGT
GGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAAATCAAC
AACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGATAGTCT
AAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTACAGTTCA
TAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAAATCACT
AGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACACAGAAAA
AGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGAAAAAAT
TGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAAGGAATG
CCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGGCATGAA
GAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCGTCGGCA
ATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACAGTTTGC
TAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCAAGATAC
TAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGCCAATGA
AGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGCAGAGGG
TAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGATTTCTAC
CTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTCTACTAG
GGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGAGAATGA
GTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTTGCTGGT
GGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTGTTTGGC
AGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTACCAAAAG
ACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATATGAGTTC
TACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGAAGAGAA
TCTTTGCTACAGAGATTTCTGACACCTGAAATGATTCTTCACATCCCTGAGAAAGGTCAAAGTTACAAACTGATTTTTTTTTTTTTGCTA
CATGAGTGCATTTATCTTTTAAATGCTTGGCAATGTTAAATGTATTTATTAACTTTGTGTCTCTGAATCTCTGTTCTAATGTGCCATGTT
GCAGTGATCTGAGATGACTTATAAAAACAAAAATGTATATGGCTCTTTCTATCCATGCAGTGATAGTGAGTGTAAAATCTGCTTACTTCA

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000539964_chr2_99722160_-_2092nt
AGCTAAATGACGGGCGGAGCCCGGCGGCGGCTTCCGGTCGGGGGAAAAAAGTTGGGCCGAAGGAGGGGCCGGGAAGACGCAAGAGGAAGA
AGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAGGAAGGT
GGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAAATCAAC
AACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGATAGTCT
AAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTACAGTTCA
TAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAAATCACT
AGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACACAGAAAA
AGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGAAAAAAT
TGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAAGGAATG
CCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGGCATGAA
GAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCGTCGGCA
ATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACAGTTTGC
TAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCAAGATAC
TAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGCCAATGA
AGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGCAGAGGG
TAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGATTTCTAC
CTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTCTACTAG
GGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGAGAATGA
GTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTTGCTGGT
GGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTGTTTGGC
AGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTACCAAAAG
ACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATATGAGTTC
TACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGAAGAGAA

>In-frame_ACTR2_ENST00000260641_chr2_65455091_+_TSGA10_ENST00000542655_chr2_99722160_-_946nt
AGCTAAATGACGGGCGGAGCCCGGCGGCGGCTTCCGGTCGGGGGAAAAAAGTTGGGCCGAAGGAGGGGCCGGGAAGACGCAAGAGGAAGA
AGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAGGAAGGT
GGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAAATCAAC
AACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGATAGTCT
AAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTACAGTTCA
TAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAAATCACT
AGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACACAGAAAA
AGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGAAAAAAT
TGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAAGGAATG
CCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAACAGTGTACTGAGGCCCTAATTG

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000393483_chr2_99722160_-_2944nt
GGAAGAAGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAG
GAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAA
ATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGA
TAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTAC
AGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAA
ATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACAC
AGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGA
AAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAA
GGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGG
CATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCG
TCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACA
GTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCA
AGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGC
CAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGC
AGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGAT
TTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTC
TACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGA
GAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTT
GCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTG
TTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTAC
CAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATAT
GAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGA
AGAGAATCTTTGCTACAGAGATTTCTGACACCTGAAATGATTCTTCACATCCCTGAGAAAGGTCAAAGTTACAAACTGATTTTTTTTTTT
TTGCTACATGAGTGCATTTATCTTTTAAATGCTTGGCAATGTTAAATGTATTTATTAACTTTGTGTCTCTGAATCTCTGTTCTAATGTGC
CATGTTGCAGTGATCTGAGATGACTTATAAAAACAAAAATGTATATGGCTCTTTCTATCCATGCAGTGATAGTGAGTGTAAAATCTGCTT
ACTTCACTATTGAACACTATTCTGTTCACTATCTGGAGTAAATAAAGAAGCTTATTAAAACAGGGAAAAGTGTTTTTACAAAACTGCTTT
CCTTTCCTTTCTTGGTATCTCAAATAATTGGTTGGTTAATTTTTTTTCTTTGTGATTTGTGTTTTCATGGCTGGAAAATCTGTGCCAAAA
TGGGTACAACTTACTGATACTGGTCTGGGATCTGATATTCCATTTTGGAACCAACCTTACATGAATTCCATGCCATAATCTGATATTGAA
GCAGCAGAAAGTAGGAGTGTTGTCAGGGTTTTAAAACCTATAGTATTGTACCACTCAAAGACTAAGTAACATACATATTCTACAATTGTG
TTTACTACTACTGCTTTTAGAAAGGTAGGTGATGGTATATCTGTCAAGAATGTAAGATTTTATTAAAAATCTTTATTTTTAATAAGTTTT
CTTTCAAGTACTGCAATCAACTTAATTGCGATTTTATTTTATTGTCTGTGGCAGCTGTCTGTAATCTGGAGTAATAAGATAAGTGATGTT
TCCTTCCTCCCCCAATTTCCTAAATCTCTTACCTTATCTATCCATAGGCTTTGATGTAATGTTCATATTAGAGCCTGAATGCTACTGTAT

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000410001_chr2_99722160_-_2319nt
GGAAGAAGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAG
GAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAA
ATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGA
TAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTAC
AGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAA
ATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACAC
AGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGA
AAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAA
GGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGG
CATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCG
TCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACA
GTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCA
AGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGC
CAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGC
AGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGAT
TTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTC
TACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGA
GAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTT
GCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTG
TTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTAC
CAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATAT
GAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGA
AGAGAATCTTTGCTACAGAGATTTCTGACACCTGAAATGATTCTTCACATCCCTGAGAAAGGTCAAAGTTACAAACTGATTTTTTTTTTT
TTGCTACATGAGTGCATTTATCTTTTAAATGCTTGGCAATGTTAAATGTATTTATTAACTTTGTGTCTCTGAATCTCTGTTCTAATGTGC
CATGTTGCAGTGATCTGAGATGACTTATAAAAACAAAAATGTATATGGCTCTTTCTATCCATGCAGTGATAGTGAGTGTAAAATCTGCTT

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000355053_chr2_99722160_-_2319nt
GGAAGAAGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAG
GAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAA
ATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGA
TAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTAC
AGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAA
ATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACAC
AGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGA
AAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAA
GGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGG
CATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCG
TCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACA
GTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCA
AGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGC
CAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGC
AGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGAT
TTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTC
TACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGA
GAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTT
GCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTG
TTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTAC
CAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATAT
GAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGA
AGAGAATCTTTGCTACAGAGATTTCTGACACCTGAAATGATTCTTCACATCCCTGAGAAAGGTCAAAGTTACAAACTGATTTTTTTTTTT
TTGCTACATGAGTGCATTTATCTTTTAAATGCTTGGCAATGTTAAATGTATTTATTAACTTTGTGTCTCTGAATCTCTGTTCTAATGTGC
CATGTTGCAGTGATCTGAGATGACTTATAAAAACAAAAATGTATATGGCTCTTTCTATCCATGCAGTGATAGTGAGTGTAAAATCTGCTT

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000539964_chr2_99722160_-_2008nt
GGAAGAAGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAG
GAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAA
ATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGA
TAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTAC
AGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAA
ATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACAC
AGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGA
AAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAA
GGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAGAAAAGACCATTTCAGG
CATGAAGAATATCATTGCTGAGATGGAACAGGCATCAAGACAGTGTACTGAGGCCCTAATTGTGTGTGAACAAGACGTTTCCAGAATGCG
TCGGCAATTGGATGAGACAAATGATGAGCTGGCCCAGATCGCCAGGGAAAGAGATATCTTGGCTCATGACAATGACAATCTCCAGGAACA
GTTTGCTAAAGCTAAACAAGAAAACCAGGCACTGTCCAAAAAATTGAATGACACTCATAATGAACTTAATGACATAAAACAGAAGGTTCA
AGATACTAATTTGGAGGTTAACAAGCTGAAGAATATATTAAAGTCTGAAGAATCTGAGAACCGGCAAATGATGGAACAACTTCGAAAAGC
CAATGAAGATGCTGAAAACTGGGAAAATAAAGCCCGTCAATCAGAGGCAGATAACAATACCCTCAAACTGGAACTTATCACTGCTGAGGC
AGAGGGTAACAGATTAAAAGAAAAAGTAGATTCCCTCAACAGAGAGGTTGAGCAACACTTAAATGCAGAAAGGTCTTACAAGTCCCAGAT
TTCTACCTTACATAAATCTGTTGTAAAAATGGAAGAGGAGCTTCAGAAGGTTCAGTTTGAAAAAGTGTCCGCTCTTGCAGATTTGTCTTC
TACTAGGGAACTCTGTATTAAACTTGACTCAAGCAAAGAACTTCTTAATCGACAGCTGGTTGCTAAAGATCAAGAAATAGAAATGAGGGA
GAATGAGTTAGATTCTGCTCATTCTGAAATTGAACTCCTGAGGAGTCAGATGGCAAATGAGAGAATCTCCATGCAGAATCTAGAAGCTTT
GCTGGTGGCCAATCGAGACAAAGAATATCAGTCTCAGATAGCACTTCAAGAAAAAGAATCTGAAATTCAGCTTCTTAAAGAACACCTTTG
TTTGGCAGAAAATAAAATGGCCATCCAGAGTAGAGATGTGGCCCAGTTCAGAAATGTTGTCACACAATTGGAAGCTGATTTAGACATTAC
CAAAAGACAACTAGGAACAGAGCGCTTTGAAAGGGAGAGGGCCGTACAAGAACTTCGCCGCCAAAATTATTCAAGTAATGCTTATCATAT
GAGTTCTACAATGAAGCCAAATACAAAATGTCATTCACCAGAACGTGCTCACCATCGATCTCCTGACCGAGGCCTAGATCGATCATTAGA

>In-frame_ACTR2_ENST00000377982_chr2_65455091_+_TSGA10_ENST00000542655_chr2_99722160_-_862nt
GGAAGAAGAGAAAACGGCCGGGCGGCGGTGGCTGTAGGTTGTGCGGCTGCAGCGGCTCTTCCCTGGGCGGACGATGGACAGCCAGGGCAG
GAAGGTGGTGGTGTGCGACAACGGCACCGGGGCACAGGAAGAAATTACCCGACTTCGACGAGAAATGATGAAAAGCTGTAAGAGTCCTAA
ATCAACAACGGCACATGCTATTCTCCGGCGAGTGGAGACTGAAAGAGATGTAGCCTTTACTGATTTACGAAGAATGACCACAGAACGAGA
TAGTCTAAGGGAGAGGCTAAAGATTGCTCAAGAGACAGCATTTAATGAGAAGGCTCACCTGGAACAAAGGATAGAGGAGCTGGAGTGTAC
AGTTCATAATCTTGATGATGAACGTATGGAGCAAATGTCAAATATGACTTTGATGAAGGAAACCATAAGCACTGTGGAAAAAGAAATGAA
ATCACTAGCAAGAAAGGCAATGGATACCGAAAGTGAACTTGGCAGACAAAAAGCAGAGAATAATTCTTTGAGACTTTTGTATGAAAACAC
AGAAAAAGATCTTTCTGATACTCAGCGACACCTTGCTAAGAAAAAATATGAGCTACAGCTTACTCAGGAGAAAATTATGTGCTTGGATGA
AAAAATTGATAACTTTACAAGGCAAAATATTGCACAGCGAGAAGAAATCAGCATTCTTGGTGGAACCCTCAATGATCTGGCTAAAGAAAA
GGAATGCCTGCAAGCATGTTTGGATAAAAAATCTGAGAATATTGCATCCCTTGGAGAGAGTTTGGCAATGAAAACAGTGTACTGAGGCCC


Top

FusionGenePPI for ACTR2_TSGA10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACTR2ACTR3B, BAK1, ACTR3, BMP2, CTTN, ESR1, ACTB, UBC, ELAVL1, SIRT7, CUL3, LRRK2, ARPC1B, ARPC4, ARPC5, ARPC2, ARPC3, ARPC1A, ARPC5L, CORO1C, UBE2N, FN1, VCAM1, WASL, ELF5, ANP32B, BAG1, CALR, DHPS, EEF2K, EFTUD1, P3H1, OSGEP, TTLL12, ALAD, CALU, CRTAP, FUBP1, GRPEL1, HIST1H2AB, HSPBP1, KIAA1279, METTL1, NIF3L1, NSUN2, OGT, PANK4, PPME1, PRKACB, RANGAP1, RPA1, RPRD1A, RPRD1B, SH3GL1, SH3GLB1, SRP9, SURF2, TOM1L1, TP53RK, TPD52L2, TPRKB, UFM1, WDR4, ZPR1, CUL7, OBSL1, EGFR, UNK, CAPZA1, CCT5, CORO1A, EFHD2, PSMD7, STXBP1, ARPC4-TTLL3, CAPZA2, CORO1B, FAM98B, NTRK1, KRAS, PCM1, CEP170, CEP128, NIN, SCLT1, EVC2, STIL, XPO1, CCT6A, CFL1, CLTA, CLTB, DAB2, DBN1, DSG2, GSN, ITPR3, MYO6, PPP1R12A, SVIL, TCP1, CCT3, LUZP1, GPRC5A, FLNA, MYH9, PPP1CB, IQGAP1, ATP6AP2, SYNPO, ANLN, MYO5C, MYO19, MYO18A, BASP1, CCT7, CCT4, CCT2, CCT8, COBL, LIMA1, RBM27, METTL3, INF2, PDCL3, CYBRD1, CHURC1, SPECC1, MISP, FBXW7, SNW1, CDC5L, HSD17B10TSGA10TRIM29, VIM, MYH9, ACTG1, OBSL1, TUBB, TUBA3C, MYL6, PLEC, FLNA, AES, BIRC2, CDK18, TCEA2, ZNF2, ZNF124, SCEL, CREB5, ZBTB24, MID2, PRPF31, ZNF544, PPHLN1, CCHCR1, RCOR3, CBX8, ZNF490, ZNF410, ZNF426, CDC73, CCDC33, TSGA10, CEP44, FAM161A, ZNF587, FBF1, ZNF670, ZNF417, ZNF599, SYT6, PPP1R18, SPERT, ZBTB38, BCL6B, RTP5, CEP57L1, FLJ38668, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneTSGA10chr2:65455091chr2:99722160ENST00000355053-520556_68970699HIF1A
TgeneTSGA10chr2:65455091chr2:99722160ENST00000393483-621556_68970699HIF1A
TgeneTSGA10chr2:65455091chr2:99722160ENST00000410001-419556_68970699HIF1A
TgeneTSGA10chr2:65455091chr2:99722160ENST00000539964-419556_68970699HIF1A


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACTR2_TSGA10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ACTR2_TSGA10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACTR2C0036341Schizophrenia1PSYGENET