FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6162

FusionGeneSummary for CD2AP_SLC25A13

check button Fusion gene summary
Fusion gene informationFusion gene name: CD2AP_SLC25A13
Fusion gene ID: 6162
HgeneTgene
Gene symbol

CD2AP

SLC25A13

Gene ID

23607

10165

Gene nameCD2 associated proteinsolute carrier family 25 member 13
SynonymsCMSARALAR2|CITRIN|CTLN2
Cytomap

6p12.3

7q21.3

Type of geneprotein-codingprotein-coding
DescriptionCD2-associated proteinCas ligand with multiple Src homology 3 (SH3) domainsadapter protein CMScas ligand with multiple SH3 domainscalcium-binding mitochondrial carrier protein Aralar2mitochondrial aspartate glutamate carrier 2solute carrier family 25 (aspartate/glutamate carrier), member 13
Modification date2018052220180523
UniProtAcc

Q9Y5K6

Q9UJS0

Ensembl transtripts involved in fusion geneENST00000359314, ENST00000486693, 
ENST00000265631, ENST00000416240, 
ENST00000542654, ENST00000494085, 
Fusion gene scores* DoF score13 X 6 X 10=7807 X 6 X 5=210
# samples 137
** MAII scorelog2(13/780*10)=-2.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CD2AP [Title/Abstract] AND SLC25A13 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSLC25A13

GO:0006754

ATP biosynthetic process

12851387

TgeneSLC25A13

GO:0015810

aspartate transmembrane transport

11566871

TgeneSLC25A13

GO:0015813

L-glutamate transmembrane transport

11566871

TgeneSLC25A13

GO:0043490

malate-aspartate shuttle

11566871

TgeneSLC25A13

GO:0045333

cellular respiration

12851387

TgeneSLC25A13

GO:0051592

response to calcium ion

11566871


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVREADTCGA-EI-6510-01ACD2APchr6

47501491

+SLC25A13chr7

95800836

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000359314ENST00000265631CD2APchr6

47501491

+SLC25A13chr7

95800836

-
In-frameENST00000359314ENST00000416240CD2APchr6

47501491

+SLC25A13chr7

95800836

-
In-frameENST00000359314ENST00000542654CD2APchr6

47501491

+SLC25A13chr7

95800836

-
5CDS-intronENST00000359314ENST00000494085CD2APchr6

47501491

+SLC25A13chr7

95800836

-
intron-3CDSENST00000486693ENST00000265631CD2APchr6

47501491

+SLC25A13chr7

95800836

-
intron-3CDSENST00000486693ENST00000416240CD2APchr6

47501491

+SLC25A13chr7

95800836

-
intron-3CDSENST00000486693ENST00000542654CD2APchr6

47501491

+SLC25A13chr7

95800836

-
intron-intronENST00000486693ENST00000494085CD2APchr6

47501491

+SLC25A13chr7

95800836

-

Top

FusionProtFeatures for CD2AP_SLC25A13


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CD2AP

Q9Y5K6

SLC25A13

Q9UJS0

Seems to act as an adapter protein between membraneproteins and the actin cytoskeleton (PubMed:10339567). Incollaboration with CBLC, modulates the rate of RET turnover andmay act as regulatory checkpoint that limits the potency of GDNFon neuronal survival. Controls CBLC function, converting it froman inhibitor to a promoter of RET degradation (By similarity). Mayplay a role in receptor clustering and cytoskeletal polarity inthe junction between T-cell and antigen-presenting cell (Bysimilarity). May anchor the podocyte slit diaphragm to the actincytoskeleton in renal glomerolus. Also required for cytokinesis(PubMed:15800069). Plays a role in epithelial cell junctionsformation (PubMed:22891260). {ECO:0000250|UniProtKB:F1LRS8,ECO:0000250|UniProtKB:Q9JLQ0, ECO:0000269|PubMed:10339567,ECO:0000269|PubMed:15800069, ECO:0000269|PubMed:22891260}. Mitochondrial and calcium-binding carrier that catalyzesthe calcium-dependent exchange of cytoplasmic glutamate withmitochondrial aspartate across the mitochondrial inner membrane(PubMed:11566871, PubMed:25410934). May have a function in theurea cycle (PubMed:11566871). {ECO:0000269|PubMed:11566871,ECO:0000269|PubMed:25410934}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+3181_59106640DomainSH3 1%3B truncated
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018613_675392676RegionC-terminal domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018613_675393677RegionC-terminal domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018426_510392676RepeatSolcar 2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018518_606392676RepeatSolcar 3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018426_510393677RepeatSolcar 2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018518_606393677RepeatSolcar 3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018393_412392676TransmembraneHelical%3B Name%3D2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018436_449392676TransmembraneHelical%3B Name%3D3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018485_504392676TransmembraneHelical%3B Name%3D4
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018524_541392676TransmembraneHelical%3B Name%3D5
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018581_600392676TransmembraneHelical%3B Name%3D6
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018393_412393677TransmembraneHelical%3B Name%3D2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018436_449393677TransmembraneHelical%3B Name%3D3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018485_504393677TransmembraneHelical%3B Name%3D4
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018524_541393677TransmembraneHelical%3B Name%3D5
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018581_600393677TransmembraneHelical%3B Name%3D6

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+318577_638106640Coiled coilOntology_term=ECO:0000255
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+318336_422106640Compositional biasNote=Pro-rich
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+318108_167106640DomainSH3 2
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+318269_330106640DomainSH3 3
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+318336_352106640MotifSH3-binding
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+318378_397106640MotifSH3-binding
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+318410_422106640MotifSH3-binding
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018100_111392676Calcium bindingNote=2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018171_182392676Calcium bindingNote=3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-101866_77392676Calcium binding1
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018100_111393677Calcium bindingNote=2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018171_182393677Calcium bindingNote=3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-101866_77393677Calcium binding1
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018125_157392676DomainEF-hand 3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018158_193392676DomainEF-hand 4
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-101851_86392676DomainEF-hand 1
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-101887_122392676DomainEF-hand 2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018125_157393677DomainEF-hand 3
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018158_193393677DomainEF-hand 4
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-101851_86393677DomainEF-hand 1
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-101887_122393677DomainEF-hand 2
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018296_311392676RegionLinker loop domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-10182_295392676RegionN-terminal domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018321_612392676RegionCarrier domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018296_311393677RegionLinker loop domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-10182_295393677RegionN-terminal domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018321_612393677RegionCarrier domain
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018326_418392676RepeatSolcar 1
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018326_418393677RepeatSolcar 1
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000265631-1018332_349392676TransmembraneHelical%3B Name%3D1
TgeneSLC25A13chr6:47501491chr7:95800836ENST00000416240-1018332_349393677TransmembraneHelical%3B Name%3D1


Top

FusionGeneSequence for CD2AP_SLC25A13


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000265631_chr7_95800836_-_390aa
MVDTIVETDTDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTTGL
PAGGIQPHPQTKNIKKSLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGP
RVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCTAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQ
TTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVAT

>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000416240_chr7_95800836_-_390aa
MVDTIVETDTDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTTGL
PAGGIQPHPQTKNIKKSLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGP
RVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCTAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQ
TTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVAT

>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000542654_chr7_95800836_-_390aa
MVDTIVETDTDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTTGL
PAGGIQPHPQTKNIKKSLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGP
RVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCTAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQ
TTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVAT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000265631_chr7_95800836_-_1170nt
ATGGTTGACTATATTGTGGAGTATGACTATGATGCTGTACATGATGATGAATTAACTATTCGAGTTGGAGAAATCATCAGGAATGTGAAA
AAGCTACAGGAGGAAGGGTGGCTGGAAGGAGAACTAAATGGGAGAAGAGGAATGTTCCCTGACAATTTCGTTAAGGAAATTAAAAGAGAG
ACGGAATTCAAGGATGACAGTTTGCCCATCAAACGGGAAAGGCATGGGAATGTAGCAAGTCTTGTACAACGAATAAGCACCTATGGACTT
CCAGCTGGAGGAATTCAGCCACATCCACAAACCAAAAACATTAAGAAGAGTCTGTTGCCACAGTTATTGGGAGTTGCCCCAGAGAAGGCC
ATAAAACTTACAGTGAACGATTTTGTGAGGGATAAATTTATGCACAAAGATGGTTCGGTCCCACTTGCAGCAGAAATTCTTGCTGGAGGC
TGCGCTGGAGGCTCCCAGGTGATTTTCACAAATCCTTTAGAAATCGTCAAGATCCGTTTGCAAGTGGCAGGAGAAATCACCACTGGTCCT
CGAGTCAGTGCTCTGTCTGTCGTGCGGGACCTGGGGTTTTTTGGGATCTACAAGGGTGCCAAAGCATGCTTTCTGCGGGACATTCCTTTC
TCGGCCATCTACTTTCCGTGCTATGCTCATGTGAAGGCTTCCTTTGCAAATGAAGATGGGCAGGTTAGCCCAGGAAGCCTGCTCTTAGCT
GGTGCCATAGCTGGTATGCCTGCAGCATCTTTAGTGACCCCTGCTGATGTTATCAAGACGAGATTACAGGTGGCTGCCCGGGCTGGCCAA
ACCACTTACAGCGGAGTGATAGACTGCTTTAGAAAGATACTGCGTGAAGAAGGACCAAAAGCTCTGTGGAAGGGAGCTGGTGCTCGTGTA
TTTCGATCCTCACCCCAGTTTGGTGTAACTTTGCTGACTTACGAATTGCTACAGCGATGGTTCTACATTGATTTTGGAGGAGTAAAACCC
ATGGGATCAGAGCCAGTTCCTAAATCCAGGATCAACCTGCCTGCCCCGAATCCTGATCACGTTGGGGGCTACAAACTGGCAGTTGCTACA
TTTGCAGGGATTGAAAACAAATTTGGACTTTACCTACCTCTCTTCAAGCCATCAGTATCTACCTCAAAGGCTATTGGTGGAGGCCCATAG

>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000416240_chr7_95800836_-_1170nt
ATGGTTGACTATATTGTGGAGTATGACTATGATGCTGTACATGATGATGAATTAACTATTCGAGTTGGAGAAATCATCAGGAATGTGAAA
AAGCTACAGGAGGAAGGGTGGCTGGAAGGAGAACTAAATGGGAGAAGAGGAATGTTCCCTGACAATTTCGTTAAGGAAATTAAAAGAGAG
ACGGAATTCAAGGATGACAGTTTGCCCATCAAACGGGAAAGGCATGGGAATGTAGCAAGTCTTGTACAACGAATAAGCACCTATGGACTT
CCAGCTGGAGGAATTCAGCCACATCCACAAACCAAAAACATTAAGAAGAGTCTGTTGCCACAGTTATTGGGAGTTGCCCCAGAGAAGGCC
ATAAAACTTACAGTGAACGATTTTGTGAGGGATAAATTTATGCACAAAGATGGTTCGGTCCCACTTGCAGCAGAAATTCTTGCTGGAGGC
TGCGCTGGAGGCTCCCAGGTGATTTTCACAAATCCTTTAGAAATCGTCAAGATCCGTTTGCAAGTGGCAGGAGAAATCACCACTGGTCCT
CGAGTCAGTGCTCTGTCTGTCGTGCGGGACCTGGGGTTTTTTGGGATCTACAAGGGTGCCAAAGCATGCTTTCTGCGGGACATTCCTTTC
TCGGCCATCTACTTTCCGTGCTATGCTCATGTGAAGGCTTCCTTTGCAAATGAAGATGGGCAGGTTAGCCCAGGAAGCCTGCTCTTAGCT
GGTGCCATAGCTGGTATGCCTGCAGCATCTTTAGTGACCCCTGCTGATGTTATCAAGACGAGATTACAGGTGGCTGCCCGGGCTGGCCAA
ACCACTTACAGCGGAGTGATAGACTGCTTTAGAAAGATACTGCGTGAAGAAGGACCAAAAGCTCTGTGGAAGGGAGCTGGTGCTCGTGTA
TTTCGATCCTCACCCCAGTTTGGTGTAACTTTGCTGACTTACGAATTGCTACAGCGATGGTTCTACATTGATTTTGGAGGAGTAAAACCC
ATGGGATCAGAGCCAGTTCCTAAATCCAGGATCAACCTGCCTGCCCCGAATCCTGATCACGTTGGGGGCTACAAACTGGCAGTTGCTACA
TTTGCAGGGATTGAAAACAAATTTGGACTTTACCTACCTCTCTTCAAGCCATCAGTATCTACCTCAAAGGCTATTGGTGGAGGCCCATAG

>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000542654_chr7_95800836_-_1170nt
ATGGTTGACTATATTGTGGAGTATGACTATGATGCTGTACATGATGATGAATTAACTATTCGAGTTGGAGAAATCATCAGGAATGTGAAA
AAGCTACAGGAGGAAGGGTGGCTGGAAGGAGAACTAAATGGGAGAAGAGGAATGTTCCCTGACAATTTCGTTAAGGAAATTAAAAGAGAG
ACGGAATTCAAGGATGACAGTTTGCCCATCAAACGGGAAAGGCATGGGAATGTAGCAAGTCTTGTACAACGAATAAGCACCTATGGACTT
CCAGCTGGAGGAATTCAGCCACATCCACAAACCAAAAACATTAAGAAGAGTCTGTTGCCACAGTTATTGGGAGTTGCCCCAGAGAAGGCC
ATAAAACTTACAGTGAACGATTTTGTGAGGGATAAATTTATGCACAAAGATGGTTCGGTCCCACTTGCAGCAGAAATTCTTGCTGGAGGC
TGCGCTGGAGGCTCCCAGGTGATTTTCACAAATCCTTTAGAAATCGTCAAGATCCGTTTGCAAGTGGCAGGAGAAATCACCACTGGTCCT
CGAGTCAGTGCTCTGTCTGTCGTGCGGGACCTGGGGTTTTTTGGGATCTACAAGGGTGCCAAAGCATGCTTTCTGCGGGACATTCCTTTC
TCGGCCATCTACTTTCCGTGCTATGCTCATGTGAAGGCTTCCTTTGCAAATGAAGATGGGCAGGTTAGCCCAGGAAGCCTGCTCTTAGCT
GGTGCCATAGCTGGTATGCCTGCAGCATCTTTAGTGACCCCTGCTGATGTTATCAAGACGAGATTACAGGTGGCTGCCCGGGCTGGCCAA
ACCACTTACAGCGGAGTGATAGACTGCTTTAGAAAGATACTGCGTGAAGAAGGACCAAAAGCTCTGTGGAAGGGAGCTGGTGCTCGTGTA
TTTCGATCCTCACCCCAGTTTGGTGTAACTTTGCTGACTTACGAATTGCTACAGCGATGGTTCTACATTGATTTTGGAGGAGTAAAACCC
ATGGGATCAGAGCCAGTTCCTAAATCCAGGATCAACCTGCCTGCCCCGAATCCTGATCACGTTGGGGGCTACAAACTGGCAGTTGCTACA
TTTGCAGGGATTGAAAACAAATTTGGACTTTACCTACCTCTCTTCAAGCCATCAGTATCTACCTCAAAGGCTATTGGTGGAGGCCCATAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000265631_chr7_95800836_-_2597nt
CTCTGTCTGGGTCCCCACCTTAGTCTACGGTGTCGCCTTTTCTAACTGCGAGTGCTAAGGAAGAGGCGAGGGGCGGGCTCCGAGGCTAGG
CGGGCGCTCGGGGTTGGAGCCGAGGGTCTGGGCAAACCGGTGGGTCCCTCCCCACTGCGGGAGCGGCCAGGGTGGGAAAACCGCGGTCGG
GCGGGCGGGGTAGGGCCCTCCCGCCGCCGTGGCTCCTGGGGAGGCCAGGGGTGAGGAGCTGTCGCCGCCTTTGCCTCTGCCTCGAGGGCC
GCGCTGAAGAGACTGGTAGGAGAGCGCCGCGGGCGGATGGAGGCGACTCTTCGCCCCGCCTGAGCTCAGGAGGGGCTAGCGCGGAGCGCG
GGTCCCGCCTCCAGCCGCGGGAGCGGCCGCGCGAGCCACCACTGGAGGAGGAGGAGGAGGAGCGGACGTCGGCTTCTCCCCGCGGGAGCC
CCCAGCATGGTTGACTATATTGTGGAGTATGACTATGATGCTGTACATGATGATGAATTAACTATTCGAGTTGGAGAAATCATCAGGAAT
GTGAAAAAGCTACAGGAGGAAGGGTGGCTGGAAGGAGAACTAAATGGGAGAAGAGGAATGTTCCCTGACAATTTCGTTAAGGAAATTAAA
AGAGAGACGGAATTCAAGGATGACAGTTTGCCCATCAAACGGGAAAGGCATGGGAATGTAGCAAGTCTTGTACAACGAATAAGCACCTAT
GGACTTCCAGCTGGAGGAATTCAGCCACATCCACAAACCAAAAACATTAAGAAGAGTCTGTTGCCACAGTTATTGGGAGTTGCCCCAGAG
AAGGCCATAAAACTTACAGTGAACGATTTTGTGAGGGATAAATTTATGCACAAAGATGGTTCGGTCCCACTTGCAGCAGAAATTCTTGCT
GGAGGCTGCGCTGGAGGCTCCCAGGTGATTTTCACAAATCCTTTAGAAATCGTCAAGATCCGTTTGCAAGTGGCAGGAGAAATCACCACT
GGTCCTCGAGTCAGTGCTCTGTCTGTCGTGCGGGACCTGGGGTTTTTTGGGATCTACAAGGGTGCCAAAGCATGCTTTCTGCGGGACATT
CCTTTCTCGGCCATCTACTTTCCGTGCTATGCTCATGTGAAGGCTTCCTTTGCAAATGAAGATGGGCAGGTTAGCCCAGGAAGCCTGCTC
TTAGCTGGTGCCATAGCTGGTATGCCTGCAGCATCTTTAGTGACCCCTGCTGATGTTATCAAGACGAGATTACAGGTGGCTGCCCGGGCT
GGCCAAACCACTTACAGCGGAGTGATAGACTGCTTTAGAAAGATACTGCGTGAAGAAGGACCAAAAGCTCTGTGGAAGGGAGCTGGTGCT
CGTGTATTTCGATCCTCACCCCAGTTTGGTGTAACTTTGCTGACTTACGAATTGCTACAGCGATGGTTCTACATTGATTTTGGAGGAGTA
AAACCCATGGGATCAGAGCCAGTTCCTAAATCCAGGATCAACCTGCCTGCCCCGAATCCTGATCACGTTGGGGGCTACAAACTGGCAGTT
GCTACATTTGCAGGGATTGAAAACAAATTTGGACTTTACCTACCTCTCTTCAAGCCATCAGTATCTACCTCAAAGGCTATTGGTGGAGGC
CCATAGGAAGATCAGCCCTGGGATAGTGCTGTCTTTTTGTGGGTACTGCAGTAAAGAACATCCCTCCTGGGAATGAAGCAATGCTTCATC
CCTTTTACGTCCATCTCTTGTTTAAATTCAAGTCCAGGCTTTTTTATCATGTGAAATCATTCATTTTCTGGGTGTTTTCTTAACCAGATC
ATTGTGAAATTATTCATAATTATTATTTGGCCCTCTGCCCAGAAACCTTTGTTTGCATCTGAAAATTGATGGGATTTGGTCAACACTAAC
ATGATTTGGGGAAAGGAGCAAGTCAGAATAGAAATTAGTACTCCCCTCCTTGAACTAGGATTGTAGTCCCAAAGAGGCTACTGTAAGGCA
ATCATGGTGCTCAGAGCAGTGTTTCGTGTGTGTTTTAAACTGGTAGGAAACTAGGTGCATATTTATAAAAATAAAAAACACTGGGAGAAA
TGAAAAAATATATATCAAATATATTCAGCCTGGCTTCAAATTGTAAGCATGCACAAATTCTGTCTCTGGATTATATTATGAAGCTTTTAT
GTGAAACATGTTTCTTTGTAATGAAAACCACATTGGAGATGTTTAGTAATCATATTGTTACTGGTACCAAGACTACTAGGGAAATGCCTT
TGTACTTTAGGGAAGTACTTTTGGCATTTTACTGTACAGACAGAAAAAACTGAGATGTAGCCCCTCTCCTGGAAGTGCTAATTTTGAAAA
ACTGCTCATATGATGTACATGTACTGATTACTGCCTATTTTAATAAACACTCTTGAAAAATGCATGTTGCCCTGTTGCTGCCTGCCCTAT
TCTCCTCATCTCCCCATCATTGGTACCCACTTGCTTTTAAAATCCACTTTATCTTGAATAATGTAAGACAAATATGTTCTGACATAAGTA

>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000416240_chr7_95800836_-_2596nt
CTCTGTCTGGGTCCCCACCTTAGTCTACGGTGTCGCCTTTTCTAACTGCGAGTGCTAAGGAAGAGGCGAGGGGCGGGCTCCGAGGCTAGG
CGGGCGCTCGGGGTTGGAGCCGAGGGTCTGGGCAAACCGGTGGGTCCCTCCCCACTGCGGGAGCGGCCAGGGTGGGAAAACCGCGGTCGG
GCGGGCGGGGTAGGGCCCTCCCGCCGCCGTGGCTCCTGGGGAGGCCAGGGGTGAGGAGCTGTCGCCGCCTTTGCCTCTGCCTCGAGGGCC
GCGCTGAAGAGACTGGTAGGAGAGCGCCGCGGGCGGATGGAGGCGACTCTTCGCCCCGCCTGAGCTCAGGAGGGGCTAGCGCGGAGCGCG
GGTCCCGCCTCCAGCCGCGGGAGCGGCCGCGCGAGCCACCACTGGAGGAGGAGGAGGAGGAGCGGACGTCGGCTTCTCCCCGCGGGAGCC
CCCAGCATGGTTGACTATATTGTGGAGTATGACTATGATGCTGTACATGATGATGAATTAACTATTCGAGTTGGAGAAATCATCAGGAAT
GTGAAAAAGCTACAGGAGGAAGGGTGGCTGGAAGGAGAACTAAATGGGAGAAGAGGAATGTTCCCTGACAATTTCGTTAAGGAAATTAAA
AGAGAGACGGAATTCAAGGATGACAGTTTGCCCATCAAACGGGAAAGGCATGGGAATGTAGCAAGTCTTGTACAACGAATAAGCACCTAT
GGACTTCCAGCTGGAGGAATTCAGCCACATCCACAAACCAAAAACATTAAGAAGAGTCTGTTGCCACAGTTATTGGGAGTTGCCCCAGAG
AAGGCCATAAAACTTACAGTGAACGATTTTGTGAGGGATAAATTTATGCACAAAGATGGTTCGGTCCCACTTGCAGCAGAAATTCTTGCT
GGAGGCTGCGCTGGAGGCTCCCAGGTGATTTTCACAAATCCTTTAGAAATCGTCAAGATCCGTTTGCAAGTGGCAGGAGAAATCACCACT
GGTCCTCGAGTCAGTGCTCTGTCTGTCGTGCGGGACCTGGGGTTTTTTGGGATCTACAAGGGTGCCAAAGCATGCTTTCTGCGGGACATT
CCTTTCTCGGCCATCTACTTTCCGTGCTATGCTCATGTGAAGGCTTCCTTTGCAAATGAAGATGGGCAGGTTAGCCCAGGAAGCCTGCTC
TTAGCTGGTGCCATAGCTGGTATGCCTGCAGCATCTTTAGTGACCCCTGCTGATGTTATCAAGACGAGATTACAGGTGGCTGCCCGGGCT
GGCCAAACCACTTACAGCGGAGTGATAGACTGCTTTAGAAAGATACTGCGTGAAGAAGGACCAAAAGCTCTGTGGAAGGGAGCTGGTGCT
CGTGTATTTCGATCCTCACCCCAGTTTGGTGTAACTTTGCTGACTTACGAATTGCTACAGCGATGGTTCTACATTGATTTTGGAGGAGTA
AAACCCATGGGATCAGAGCCAGTTCCTAAATCCAGGATCAACCTGCCTGCCCCGAATCCTGATCACGTTGGGGGCTACAAACTGGCAGTT
GCTACATTTGCAGGGATTGAAAACAAATTTGGACTTTACCTACCTCTCTTCAAGCCATCAGTATCTACCTCAAAGGCTATTGGTGGAGGC
CCATAGGAAGATCAGCCCTGGGATAGTGCTGTCTTTTTGTGGGTACTGCAGTAAAGAACATCCCTCCTGGGAATGAAGCAATGCTTCATC
CCTTTTACGTCCATCTCTTGTTTAAATTCAAGTCCAGGCTTTTTTATCATGTGAAATCATTCATTTTCTGGGTGTTTTCTTAACCAGATC
ATTGTGAAATTATTCATAATTATTATTTGGCCCTCTGCCCAGAAACCTTTGTTTGCATCTGAAAATTGATGGGATTTGGTCAACACTAAC
ATGATTTGGGGAAAGGAGCAAGTCAGAATAGAAATTAGTACTCCCCTCCTTGAACTAGGATTGTAGTCCCAAAGAGGCTACTGTAAGGCA
ATCATGGTGCTCAGAGCAGTGTTTCGTGTGTGTTTTAAACTGGTAGGAAACTAGGTGCATATTTATAAAAATAAAAAACACTGGGAGAAA
TGAAAAAATATATATCAAATATATTCAGCCTGGCTTCAAATTGTAAGCATGCACAAATTCTGTCTCTGGATTATATTATGAAGCTTTTAT
GTGAAACATGTTTCTTTGTAATGAAAACCACATTGGAGATGTTTAGTAATCATATTGTTACTGGTACCAAGACTACTAGGGAAATGCCTT
TGTACTTTAGGGAAGTACTTTTGGCATTTTACTGTACAGACAGAAAAAACTGAGATGTAGCCCCTCTCCTGGAAGTGCTAATTTTGAAAA
ACTGCTCATATGATGTACATGTACTGATTACTGCCTATTTTAATAAACACTCTTGAAAAATGCATGTTGCCCTGTTGCTGCCTGCCCTAT
TCTCCTCATCTCCCCATCATTGGTACCCACTTGCTTTTAAAATCCACTTTATCTTGAATAATGTAAGACAAATATGTTCTGACATAAGTA

>In-frame_CD2AP_ENST00000359314_chr6_47501491_+_SLC25A13_ENST00000542654_chr7_95800836_-_1917nt
CTCTGTCTGGGTCCCCACCTTAGTCTACGGTGTCGCCTTTTCTAACTGCGAGTGCTAAGGAAGAGGCGAGGGGCGGGCTCCGAGGCTAGG
CGGGCGCTCGGGGTTGGAGCCGAGGGTCTGGGCAAACCGGTGGGTCCCTCCCCACTGCGGGAGCGGCCAGGGTGGGAAAACCGCGGTCGG
GCGGGCGGGGTAGGGCCCTCCCGCCGCCGTGGCTCCTGGGGAGGCCAGGGGTGAGGAGCTGTCGCCGCCTTTGCCTCTGCCTCGAGGGCC
GCGCTGAAGAGACTGGTAGGAGAGCGCCGCGGGCGGATGGAGGCGACTCTTCGCCCCGCCTGAGCTCAGGAGGGGCTAGCGCGGAGCGCG
GGTCCCGCCTCCAGCCGCGGGAGCGGCCGCGCGAGCCACCACTGGAGGAGGAGGAGGAGGAGCGGACGTCGGCTTCTCCCCGCGGGAGCC
CCCAGCATGGTTGACTATATTGTGGAGTATGACTATGATGCTGTACATGATGATGAATTAACTATTCGAGTTGGAGAAATCATCAGGAAT
GTGAAAAAGCTACAGGAGGAAGGGTGGCTGGAAGGAGAACTAAATGGGAGAAGAGGAATGTTCCCTGACAATTTCGTTAAGGAAATTAAA
AGAGAGACGGAATTCAAGGATGACAGTTTGCCCATCAAACGGGAAAGGCATGGGAATGTAGCAAGTCTTGTACAACGAATAAGCACCTAT
GGACTTCCAGCTGGAGGAATTCAGCCACATCCACAAACCAAAAACATTAAGAAGAGTCTGTTGCCACAGTTATTGGGAGTTGCCCCAGAG
AAGGCCATAAAACTTACAGTGAACGATTTTGTGAGGGATAAATTTATGCACAAAGATGGTTCGGTCCCACTTGCAGCAGAAATTCTTGCT
GGAGGCTGCGCTGGAGGCTCCCAGGTGATTTTCACAAATCCTTTAGAAATCGTCAAGATCCGTTTGCAAGTGGCAGGAGAAATCACCACT
GGTCCTCGAGTCAGTGCTCTGTCTGTCGTGCGGGACCTGGGGTTTTTTGGGATCTACAAGGGTGCCAAAGCATGCTTTCTGCGGGACATT
CCTTTCTCGGCCATCTACTTTCCGTGCTATGCTCATGTGAAGGCTTCCTTTGCAAATGAAGATGGGCAGGTTAGCCCAGGAAGCCTGCTC
TTAGCTGGTGCCATAGCTGGTATGCCTGCAGCATCTTTAGTGACCCCTGCTGATGTTATCAAGACGAGATTACAGGTGGCTGCCCGGGCT
GGCCAAACCACTTACAGCGGAGTGATAGACTGCTTTAGAAAGATACTGCGTGAAGAAGGACCAAAAGCTCTGTGGAAGGGAGCTGGTGCT
CGTGTATTTCGATCCTCACCCCAGTTTGGTGTAACTTTGCTGACTTACGAATTGCTACAGCGATGGTTCTACATTGATTTTGGAGGAGTA
AAACCCATGGGATCAGAGCCAGTTCCTAAATCCAGGATCAACCTGCCTGCCCCGAATCCTGATCACGTTGGGGGCTACAAACTGGCAGTT
GCTACATTTGCAGGGATTGAAAACAAATTTGGACTTTACCTACCTCTCTTCAAGCCATCAGTATCTACCTCAAAGGCTATTGGTGGAGGC
CCATAGGAAGATCAGCCCTGGGATAGTGCTGTCTTTTTGTGGGTACTGCAGTAAAGAACATCCCTCCTGGGAATGAAGCAATGCTTCATC
CCTTTTACGTCCATCTCTTGTTTAAATTCAAGTCCAGGCTTTTTTATCATGTGAAATCATTCATTTTCTGGGTGTTTTCTTAACCAGATC
ATTGTGAAATTATTCATAATTATTATTTGGCCCTCTGCCCAGAAACCTTTGTTTGCATCTGAAAATTGATGGGATTTGGTCAACACTAAC


Top

FusionGenePPI for CD2AP_SLC25A13


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CD2APRAB4A, CBL, CD2, CAPZA1, CD2AP, NPHS2, BCAR1, MVB12A, SH3KBP1, NPHS1, NR4A1, NR2C2, HBP1, HOXC11, KHDRBS1, BLNK, TRA, PDCD6IP, ACTC1, CBLB, CTTN, EGFR, SH3GL2, DNM2, TSG101, INPP5D, CAPZB, CBLC, ARHGAP17, CAPZA2, MORF4L1P2, SH3BP1, GRB2, NRAS, VCAM1, ITGA4, LMNA, PTGES3, UBC, GZMB, LOX, ARHGEF10, BRCC3, CCDC6, ELP2, SPAG9, HNRNPR, HUWE1, MTA2, NR3C1, IKBKAP, KIAA0196, KIAA1033, LARP7, NOLC1, NRBP1, RABEP2, TSC22D1, USP34, WDHD1, FRS3, UBE2I, SLC25A41, STAP1, TAS2R7, ASNS, CSTF2, DPH5, GALE, IMPDH2, MSN, NPLOC4, PFDN2, PPA2, PRDX6, SCPEP1, SEC24C, SEC24D, TTC27, UFD1L, ZYX, NIT1, MED4, RPGRIP1L, KIF23, ATP6AP2, RACGAP1, KIF15, NF2, CDH1, TCP10L, ARHGAP44, MRPL12, DACH2, SETX, UBE2ASLC25A13USP50, BRE, BABAM1, SLX1B, UBC, MYC, ICT1, AGO4, SIRT7, MRPL46, ALB, ATF2, GRB2, CLN3, CLN5, ADRB2, FBXO6, PARK2, ASB8, CCDC8, EGFR, AATK, ARAF, IKBKB, ILK, IRAK1, LIMK2, SIK2, PPT1, NTRK1, ELAVL1, IMMT, CRK, XRCC3, NEIL3, SKI, MCM2, NF2, OTUB1, ZNF746, SLC25A12, CYLD, DLST, PDHA1, SOAT1, VDAC1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCD2APchr6:47501491chr7:95800836ENST00000359314+3181_175106640ANLN and localization to the midbody


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CD2AP_SLC25A13


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CD2AP_SLC25A13


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCD2APC0002395Alzheimer's Disease2CTD_human
TgeneSLC25A13C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneSLC25A13C1853942CITRULLINEMIA, TYPE II, NEONATAL-ONSET1CTD_human;ORPHANET;UNIPROT
TgeneSLC25A13C1863844Adult-onset citrullinemia type 21CTD_human;ORPHANET