FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6020

FusionGeneSummary for CCNI_SCARB2

check button Fusion gene summary
Fusion gene informationFusion gene name: CCNI_SCARB2
Fusion gene ID: 6020
HgeneTgene
Gene symbol

CCNI

SCARB2

Gene ID

10983

950

Gene namecyclin Iscavenger receptor class B member 2
SynonymsCCNI1|CYC1|CYIAMRF|CD36L2|EPM4|HLGP85|LGP85|LIMP-2|LIMPII|SR-BII
Cytomap

4q21.1

4q21.1

Type of geneprotein-codingprotein-coding
Descriptioncyclin-Icyclin ITIlysosome membrane protein 285 kDa lysosomal membrane sialoglycoprotein85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II
Modification date2018052320180519
UniProtAcc

Q14094

Q14108

Ensembl transtripts involved in fusion geneENST00000237654, ENST00000537948, 
ENST00000504697, 
ENST00000264896, 
ENST00000452464, 
Fusion gene scores* DoF score4 X 3 X 3=365 X 4 X 3=60
# samples 45
** MAII scorelog2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CCNI [Title/Abstract] AND SCARB2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-EW-A3E8-01BCCNIchr4

77996625

-SCARB2chr4

77117017

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000237654ENST00000264896CCNIchr4

77996625

-SCARB2chr4

77117017

-
5UTR-3CDSENST00000237654ENST00000452464CCNIchr4

77996625

-SCARB2chr4

77117017

-
In-frameENST00000537948ENST00000264896CCNIchr4

77996625

-SCARB2chr4

77117017

-
In-frameENST00000537948ENST00000452464CCNIchr4

77996625

-SCARB2chr4

77117017

-
intron-3CDSENST00000504697ENST00000264896CCNIchr4

77996625

-SCARB2chr4

77117017

-
intron-3CDSENST00000504697ENST00000452464CCNIchr4

77996625

-SCARB2chr4

77117017

-

Top

FusionProtFeatures for CCNI_SCARB2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CCNI

Q14094

SCARB2

Q14108

Acts as a lysosomal receptor for glucosylceramidase(GBA) targeting. {ECO:0000269|PubMed:18022370}. (Microbial infection) Acts as a receptor for enterovirus71. {ECO:0000269|PubMed:19543282}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CCNI_SCARB2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CCNI_ENST00000537948_chr4_77996625_-_SCARB2_ENST00000264896_chr4_77117017_-_464aa
MTPRHHCEAYSSAGEEEEEEEEEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDN
GTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDI
SPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYE
SVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGI
ILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMD

>In-frame_CCNI_ENST00000537948_chr4_77996625_-_SCARB2_ENST00000452464_chr4_77117017_-_321aa
MTPRHHCEAYSSAGEEEEEEEEEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRSLDWWITDKCNMI
NGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMS
FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CCNI_ENST00000537948_chr4_77996625_-_SCARB2_ENST00000264896_chr4_77117017_-_1392nt
ATGACCCCGCGTCACCACTGTGAGGCCTACAGCTCTGCCGGGGAGGAGGAGGAGGAGGAAGAGGAGGAGAAGAAAATTGTGTTAAGGAAT
GGTACTGAGGCATTTGACTCCTGGGAGAAGCCCCCTCTGCCTGTGTATACTCAGTTCTATTTCTTCAATGTCACCAATCCAGAGGAGATC
CTCAGAGGGGAGACCCCTCGGGTGGAAGAAGTGGGGCCATACACCTACAGGGAACTCAGAAACAAAGCAAATATTCAATTTGGAGATAAT
GGAACAACAATATCTGCTGTTAGCAACAAGGCCTATGTTTTTGAACGAGACCAATCTGTTGGAGACCCTAAAATTGACTTAATTAGAACA
TTAAATATTCCTGTATTGACTGTCATAGAGTGGTCCCAGGTGCACTTCCTCAGGGAGATCATCGAGGCCATGTTGAAAGCCTATCAGCAG
AAGCTCTTTGTGACTCACACAGTTGACGAATTGCTCTGGGGCTACAAAGATGAAATCTTGTCCCTTATCCATGTTTTCAGGCCCGATATC
TCTCCCTATTTTGGCCTATTCTATGAGAAAAATGGGACTAATGATGGAGACTATGTTTTTCTAACTGGAGAAGACAGTTACCTTAACTTT
ACAAAAATTGTGGAATGGAATGGGAAAACGTCACTTGACTGGTGGATAACAGACAAGTGCAATATGATTAATGGAACAGATGGAGATTCT
TTTCACCCACTAATAACCAAAGATGAGGTCCTTTATGTCTTCCCATCTGACTTTTGCAGGTCAGTGTATATTACTTTCAGTGACTATGAG
AGTGTACAGGGACTGCCTGCCTTTCGGTATAAAGTTCCTGCAGAAATATTAGCCAATACGTCAGACAATGCCGGCTTCTGTATACCTGAG
GGAAACTGCCTGGGCTCAGGAGTTCTGAATGTCAGCATCTGCAAGAATGGTGCACCCATCATTATGTCTTTCCCACACTTTTACCAAGCA
GATGAGAGGTTTGTTTCTGCCATAGAAGGCATGCACCCAAATCAGGAAGACCATGAGACATTTGTGGACATTAATCCTTTGACTGGAATA
ATCCTAAAAGCAGCCAAGAGGTTCCAAATCAACATTTATGTCAAAAAATTAGATGACTTTGTTGAAACGGGAGACATTAGAACCATGGTT
TTCCCAGTGATGTACCTCAATGAGAGTGTTCACATTGATAAAGAGACGGCGAGTCGACTGAAGTCTATGATTAACACTACTTTGATCATC
ACCAACATACCCTACATCATCATGGCGCTGGGTGTGTTCTTTGGTTTGGTTTTTACCTGGCTTGCATGCAAAGGACAGGGATCCATGGAT

>In-frame_CCNI_ENST00000537948_chr4_77996625_-_SCARB2_ENST00000452464_chr4_77117017_-_963nt
ATGACCCCGCGTCACCACTGTGAGGCCTACAGCTCTGCCGGGGAGGAGGAGGAGGAGGAAGAGGAGGAGAAGAAAATTGTGTTAAGGAAT
GGTACTGAGGCATTTGACTCCTGGGAGAAGCCCCCTCTGCCTGTGTATACTCAGTTCTATTTCTTCAATGTCACCAATCCAGAGGAGATC
CTCAGAGGGGAGACCCCTCGGGTGGAAGAAGTGGGGCCATACACCTACAGGTCACTTGACTGGTGGATAACAGACAAGTGCAATATGATT
AATGGAACAGATGGAGATTCTTTTCACCCACTAATAACCAAAGATGAGGTCCTTTATGTCTTCCCATCTGACTTTTGCAGGTCAGTGTAT
ATTACTTTCAGTGACTATGAGAGTGTACAGGGACTGCCTGCCTTTCGGTATAAAGTTCCTGCAGAAATATTAGCCAATACGTCAGACAAT
GCCGGCTTCTGTATACCTGAGGGAAACTGCCTGGGCTCAGGAGTTCTGAATGTCAGCATCTGCAAGAATGGTGCACCCATCATTATGTCT
TTCCCACACTTTTACCAAGCAGATGAGAGGTTTGTTTCTGCCATAGAAGGCATGCACCCAAATCAGGAAGACCATGAGACATTTGTGGAC
ATTAATCCTTTGACTGGAATAATCCTAAAAGCAGCCAAGAGGTTCCAAATCAACATTTATGTCAAAAAATTAGATGACTTTGTTGAAACG
GGAGACATTAGAACCATGGTTTTCCCAGTGATGTACCTCAATGAGAGTGTTCACATTGATAAAGAGACGGCGAGTCGACTGAAGTCTATG
ATTAACACTACTTTGATCATCACCAACATACCCTACATCATCATGGCGCTGGGTGTGTTCTTTGGTTTGGTTTTTACCTGGCTTGCATGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CCNI_ENST00000537948_chr4_77996625_-_SCARB2_ENST00000264896_chr4_77117017_-_4814nt
CTCCCTCCCCAGCCTTCCCCGCGAGCGGACGCGGCAGCGCCTCTGTCTCGCTTTTTCTTATTTTTCCCCCCTTTCCCCTTTCTTTTTTTT
TTTTTCTTTTCTTTTCTCCCCTCCCCCCCTTTCACCATTTCCCCTCGGAGGCGCTTTCCCCGGGCAGGGGCAGAGCCGGTCTCACCCCCC
GCCTCTCCCCGGCCCCCGCCGCCCTATGGCGAGAGGGAGCCCCCTCCCAACCCGGGCTCGAGCGGCGGCGGCCTCAGGCCGGGGGTCATC
ATGGAACTAATTCGCTGACCGACCCAGCGGCCGCAGCCGTGCGTCCCGCTCGAGCGCCAGCGCCCGCGCCCGCGCCCCCCGATCCGCTTC
CCCTTTCTCCCTCCTCAGTTGGCCGAGTCGTCCCGCGCGCACCGCCTCCGCGCGCCTATGAGAATGAGGTGGTAACGGGCCCCCGGATGA
CCCCGCGTCACCACTGTGAGGCCTACAGCTCTGCCGGGGAGGAGGAGGAGGAGGAAGAGGAGGAGAAGAAAATTGTGTTAAGGAATGGTA
CTGAGGCATTTGACTCCTGGGAGAAGCCCCCTCTGCCTGTGTATACTCAGTTCTATTTCTTCAATGTCACCAATCCAGAGGAGATCCTCA
GAGGGGAGACCCCTCGGGTGGAAGAAGTGGGGCCATACACCTACAGGGAACTCAGAAACAAAGCAAATATTCAATTTGGAGATAATGGAA
CAACAATATCTGCTGTTAGCAACAAGGCCTATGTTTTTGAACGAGACCAATCTGTTGGAGACCCTAAAATTGACTTAATTAGAACATTAA
ATATTCCTGTATTGACTGTCATAGAGTGGTCCCAGGTGCACTTCCTCAGGGAGATCATCGAGGCCATGTTGAAAGCCTATCAGCAGAAGC
TCTTTGTGACTCACACAGTTGACGAATTGCTCTGGGGCTACAAAGATGAAATCTTGTCCCTTATCCATGTTTTCAGGCCCGATATCTCTC
CCTATTTTGGCCTATTCTATGAGAAAAATGGGACTAATGATGGAGACTATGTTTTTCTAACTGGAGAAGACAGTTACCTTAACTTTACAA
AAATTGTGGAATGGAATGGGAAAACGTCACTTGACTGGTGGATAACAGACAAGTGCAATATGATTAATGGAACAGATGGAGATTCTTTTC
ACCCACTAATAACCAAAGATGAGGTCCTTTATGTCTTCCCATCTGACTTTTGCAGGTCAGTGTATATTACTTTCAGTGACTATGAGAGTG
TACAGGGACTGCCTGCCTTTCGGTATAAAGTTCCTGCAGAAATATTAGCCAATACGTCAGACAATGCCGGCTTCTGTATACCTGAGGGAA
ACTGCCTGGGCTCAGGAGTTCTGAATGTCAGCATCTGCAAGAATGGTGCACCCATCATTATGTCTTTCCCACACTTTTACCAAGCAGATG
AGAGGTTTGTTTCTGCCATAGAAGGCATGCACCCAAATCAGGAAGACCATGAGACATTTGTGGACATTAATCCTTTGACTGGAATAATCC
TAAAAGCAGCCAAGAGGTTCCAAATCAACATTTATGTCAAAAAATTAGATGACTTTGTTGAAACGGGAGACATTAGAACCATGGTTTTCC
CAGTGATGTACCTCAATGAGAGTGTTCACATTGATAAAGAGACGGCGAGTCGACTGAAGTCTATGATTAACACTACTTTGATCATCACCA
ACATACCCTACATCATCATGGCGCTGGGTGTGTTCTTTGGTTTGGTTTTTACCTGGCTTGCATGCAAAGGACAGGGATCCATGGATGAGG
GAACAGCGGATGAAAGAGCACCCCTCATTCGAACCTAAACATTGCCTTTGCTTGGTGAAGAAACTGTGTGAGCTGTCCTGACCTGGACGA
TGACGTGGGGAAACCCTCCACCTCCTTGCAGGCTTGTTGCCTGTTGAAAGAAGGAAAAAGACACGGCGCTGGCAAGTGATAGGAACATTC
TGGCCAGAGGTTAAAGAGCAGGCTGACATGGCTGGCCATTAAGCTTTATAAAATCATGTGGGCTCTGAAATTGTTCTTTTATGTGTCTAG
CAAGTATTTAATAAACCCTTGTATAGTAATTTTGTTGTTGTTGGGTGCTGGTAGCTCCAGAATTTTGTGACCACTATTGTGGGTAAAATG
TCTCTGCATCACTTGTTAATGCTACTGGTCTAACTTCATTCAGTATGCTTCATTCACCGAACTTTGTGCTCAAAATGCGTATATACCATT
TTATGTTGTATTCCTCCATTTCACTTGCAAAACAGAAGTAAATAAGAGTTCGGGACCCAGGGTAAAATGGTAGCTTCATCCAATATATCA
TTCAAATGCATCTGATTTCTAAAACATATTACATTTTATGCTGATCTTCAGTTCATAATTCTTCCAGGAAAACTCAGTCTTCCAACTGCA
ATAAAATACTGGGTAGAATCAAATGGGAAAGGGGTTGGGTGGGGCAATACCCATGAGTTGATAGTGATAAGCTCCTAAGGATTTTTAACT
TGTACTTTTGTGAACGAAGAGAATGCATAAATAATGTTGGTGAGGATAAAGTACAGATATTTCATGTAGAATTAATTGCTAGTTATGATG
CTTGTGGATAGTTAACTGTTTTTTTTTTAGTCAAAATGATCATGCTACGAAAAGATGCTTCTGAGAGAATGTAATGAGTAACTGATTTTT
CTTCCTGAGTCGCCCTTGCCAAATATGTTACTGTATTAATTAATCTAATATTGAGTGATTATTTGTAAAATTATGAATATGGGAAATCCA
TCTATCTACAGCCTAAGTTACACATAAGTTTCAGAAAGTCTGATTAGACTAAAGAGATATTTCTTCTGGGACAGCCGCCTTCTTGGTAAT
TTTGAAGTTCTTTTTACAAGTTCCTTCCTCAGTTTCAGTTCTTTCCAGTGTTTTGTAGCTCACTGTCACTCACTGAATAGAGAAACGTGT
GCCCTATACTTCCTGTGACAATCATTTTGCTGACAGAATGATGGATGTTTAAAATATTGCACAAAGTACTTTAAAGAAAGGTCTGTTAGG
ACCAGAAGCAGAGACACCACTTTTCAAAGGACTTCTTGGTTTCAGCATAACCTAAGACAGGGAATTGGGAGCCATCATATGTCACAGTGT
TCAGAATTCAAGCATATTTAAGGGCATTTTCTTTGATTCTCAAAGTTCAGCATTCATTTTGAATTGAGAAGCCTATACATTTAGCTGACA
AAGTGCTTATAGAATTTCTTAACAACTGAACCATTCAAAAGGATTTTTTTTGTTTAAAACTGGATTTCAATGTAAGCAAATGAAGAAAAA
AATATAGATTTCATTTCCATAGCTTCTTATCCCTGTATTGAGGTAATAAATTGTTTTACTGACAATTTTTCCTTTTTCTACACTAAAACA
ATATGTGATATATTTCCCCTCTTGAAGAGGCAATTCATTAAACTCTCAAATTTTCTATAGAATCAAGATAGAACCTTTAGATACTCCAAC
TCACCAAAATGTAAAAAAACTAACAAAAATATTTGGTCTTCAATAATGCTAAATATCTACATTTTTAGAATTTATCAACATTTAACTAGA
TAATTGGGCATGTCTTAATTATGCATGTACTTATCCATACTAATAAAATTGACAATGCTAGTGCATACTTATTGGTTTAGTCCTATTATC
AGGATATAATCATCTGTGAGGAGGATATTTTAAATACTGTAAATGATAACAGTTAATGATATACACATTTAGACTGAGTTGCACACTGGC
AGGGAGACCAAAAACATTACTTCCATACTTGTGTCATGATTCTTTTTTTTTTGAGAGAGTCTCACTCTGTCGCCAGGCTGGAGTACAGTG
GCATGATCTCGGCTCACTGCAACCTCTGCCTCCCGGGTTCAAGCAATTCTCCTGCCTCAGCCACCCAAGTAGCTGGGACTACAGGTGCGT
GCCACCACGCCCAGCTAAATTTTGTATTTTTAGTGGAGACGGGGTTTCACCATGTTGGCCAGGATGGTCTCAATCTCCTGACCCTGCGAT
CTGCCCACCTCAGCCTCCCAAAGTGCTGGGATTACAGGCGTAAGCCACCGGGCCTGGCCTGTTTTATGATTCTTAATAGTTACTTGGTTT
AAATCACATTTGATACTATCCTTCTGAAAAGTCTGAGACAGATCTACAAACTACAGTCAAAATTATAGATTAAGAGGAATGAATGCACCT
ATTTGGCTTTAAGTTGAAGATGAATTATTTCTCATGCTCATTTTCTTGCGGCAGTTATCTTAGAAAGACCCCCAAAGGCTTTGTGATTGT
AAGCACTGTCATGATCACAGAATGCAAGCTTCTGGTACCATGATCCTCAACTTAGAGAGGAAGAAACCAAGACAGAGAGCTTAACTCACT
TCTCTCAGGGAAAATTAGGAGTTGAGCACAGGACAGGAAATGGGCTTTGCCACTTTTAGCTCCAGGCTTTTCTAACCAGACTTGATTTCC
TCATGTTCTAGAAAGATCACTAATGGTCAAGTGGAACAAGCACTACACGACTAACCCCTATTGGGGTTTTTAACTTAAGGGAGGCTAATT
TTTAATTTAAACTGCTCGAGATATGAGTTCTGCAAAAGGTGGTCCGCATCCTTGGCCCTCTGGACATTATCACTAAATTGCTTGTGCCTG
TTAACAAGAATACTGACCAGAATGCTCTTCATGTAGCTTATACAGTTGGTTCACTTCATGCGGTTCTTGACATGTTTATTTCTACCCTTA

>In-frame_CCNI_ENST00000537948_chr4_77996625_-_SCARB2_ENST00000452464_chr4_77117017_-_1836nt
CTCCCTCCCCAGCCTTCCCCGCGAGCGGACGCGGCAGCGCCTCTGTCTCGCTTTTTCTTATTTTTCCCCCCTTTCCCCTTTCTTTTTTTT
TTTTTCTTTTCTTTTCTCCCCTCCCCCCCTTTCACCATTTCCCCTCGGAGGCGCTTTCCCCGGGCAGGGGCAGAGCCGGTCTCACCCCCC
GCCTCTCCCCGGCCCCCGCCGCCCTATGGCGAGAGGGAGCCCCCTCCCAACCCGGGCTCGAGCGGCGGCGGCCTCAGGCCGGGGGTCATC
ATGGAACTAATTCGCTGACCGACCCAGCGGCCGCAGCCGTGCGTCCCGCTCGAGCGCCAGCGCCCGCGCCCGCGCCCCCCGATCCGCTTC
CCCTTTCTCCCTCCTCAGTTGGCCGAGTCGTCCCGCGCGCACCGCCTCCGCGCGCCTATGAGAATGAGGTGGTAACGGGCCCCCGGATGA
CCCCGCGTCACCACTGTGAGGCCTACAGCTCTGCCGGGGAGGAGGAGGAGGAGGAAGAGGAGGAGAAGAAAATTGTGTTAAGGAATGGTA
CTGAGGCATTTGACTCCTGGGAGAAGCCCCCTCTGCCTGTGTATACTCAGTTCTATTTCTTCAATGTCACCAATCCAGAGGAGATCCTCA
GAGGGGAGACCCCTCGGGTGGAAGAAGTGGGGCCATACACCTACAGGTCACTTGACTGGTGGATAACAGACAAGTGCAATATGATTAATG
GAACAGATGGAGATTCTTTTCACCCACTAATAACCAAAGATGAGGTCCTTTATGTCTTCCCATCTGACTTTTGCAGGTCAGTGTATATTA
CTTTCAGTGACTATGAGAGTGTACAGGGACTGCCTGCCTTTCGGTATAAAGTTCCTGCAGAAATATTAGCCAATACGTCAGACAATGCCG
GCTTCTGTATACCTGAGGGAAACTGCCTGGGCTCAGGAGTTCTGAATGTCAGCATCTGCAAGAATGGTGCACCCATCATTATGTCTTTCC
CACACTTTTACCAAGCAGATGAGAGGTTTGTTTCTGCCATAGAAGGCATGCACCCAAATCAGGAAGACCATGAGACATTTGTGGACATTA
ATCCTTTGACTGGAATAATCCTAAAAGCAGCCAAGAGGTTCCAAATCAACATTTATGTCAAAAAATTAGATGACTTTGTTGAAACGGGAG
ACATTAGAACCATGGTTTTCCCAGTGATGTACCTCAATGAGAGTGTTCACATTGATAAAGAGACGGCGAGTCGACTGAAGTCTATGATTA
ACACTACTTTGATCATCACCAACATACCCTACATCATCATGGCGCTGGGTGTGTTCTTTGGTTTGGTTTTTACCTGGCTTGCATGCAAAG
GACAGGGATCCATGGATGAGGGAACAGCGGATGAAAGAGCACCCCTCATTCGAACCTAAACATTGCCTTTGCTTGGTGAAGAAACTGTGT
GAGCTGTCCTGACCTGGACGATGACGTGGGGAAACCCTCCACCTCCTTGCAGGCTTGTTGCCTGTTGAAAGAAGGAAAAAGACACGGCGC
TGGCAAGTGATAGGAACATTCTGGCCAGAGGTTAAAGAGCAGGCTGACATGGCTGGCCATTAAGCTTTATAAAATCATGTGGGCTCTGAA
ATTGTTCTTTTATGTGTCTAGCAAGTATTTAATAAACCCTTGTATAGTAATTTTGTTGTTGTTGGGTGCTGGTAGCTCCAGAATTTTGTG
ACCACTATTGTGGGTAAAATGTCTCTGCATCACTTGTTAATGCTACTGGTCTAACTTCATTCAGTATGCTTCATTCACCGAACTTTGTGC


Top

FusionGenePPI for CCNI_SCARB2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CCNICEP63, ELAVL1, KRT18, CDC25A, IL1RAP, NXF1, CDK5, AKT1SCARB2THBS1, ATP6V1B1, NONO, DDX1, HSPD1, TAF15, ATP4A, GEM, LGALS8, NAALADL2, PTPRK, WISP3, NTRK1, SMC6, EIF2AK2, PRPF8, PNKD, MYOF, RHCG, VAMP3, SPAG9, GLMN, RAB27B, SCGB1D1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CCNI_SCARB2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CCNI_SCARB2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSCARB2C0751779Action Myoclonus-Renal Failure Syndrome1CTD_human;ORPHANET;UNIPROT