FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5617

FusionGeneSummary for CASP8_VMP1

check button Fusion gene summary
Fusion gene informationFusion gene name: CASP8_VMP1
Fusion gene ID: 5617
HgeneTgene
Gene symbol

CASP8

VMP1

Gene ID

841

81671

Gene namecaspase 8vacuole membrane protein 1
SynonymsALPS2B|CAP4|Casp-8|FLICE|MACH|MCH5EPG3|TANGO5|TMEM49
Cytomap

2q33.1

17q23.1

Type of geneprotein-codingprotein-coding
Descriptioncaspase-8FADD-homologous ICE/CED-3-like proteaseFADD-like ICEICE-like apoptotic protease 5MACH-alpha-1/2/3 proteinMACH-beta-1/2/3/4 proteinMORT1-associated ced-3 homologapoptotic cysteine proteaseapoptotic protease Mch-5caspase 8, apoptosis-relatvacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homolog
Modification date2018052320180523
UniProtAcc

Q14790

Q96GC9

Ensembl transtripts involved in fusion geneENST00000392259, ENST00000392266, 
ENST00000264274, ENST00000432109, 
ENST00000264275, ENST00000392258, 
ENST00000490682, ENST00000358485, 
ENST00000323492, 
ENST00000262291, 
ENST00000537567, ENST00000539763, 
ENST00000536180, ENST00000545362, 
ENST00000588617, 
Fusion gene scores* DoF score8 X 4 X 10=32024 X 11 X 12=3168
# samples 1027
** MAII scorelog2(10/320*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/3168*10)=-3.55254102302878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CASP8 [Title/Abstract] AND VMP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCASP8

GO:0006508

proteolysis

12888622

HgeneCASP8

GO:0036462

TRAIL-activated apoptotic signaling pathway

21785459

HgeneCASP8

GO:0045862

positive regulation of proteolysis

18387192

HgeneCASP8

GO:0097191

extrinsic apoptotic signaling pathway

21785459

HgeneCASP8

GO:0097202

activation of cysteine-type endopeptidase activity

18387192


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-EO-A3KW-01ACASP8chr2

202150040

+VMP1chr17

57915656

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
3UTR-3CDSENST00000392259ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392259ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392259ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392259ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392259ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-intronENST00000392259ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392266ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392266ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392266ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392266ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-3CDSENST00000392266ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
3UTR-intronENST00000392266ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264274ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264274ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264274ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264274ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264274ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
5CDS-intronENST00000264274ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000432109ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000432109ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000432109ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000432109ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000432109ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
5CDS-intronENST00000432109ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264275ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264275ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264275ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264275ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000264275ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
5CDS-intronENST00000264275ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000392258ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000392258ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000392258ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000392258ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000392258ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-intronENST00000392258ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000490682ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000490682ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000490682ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000490682ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-3CDSENST00000490682ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
intron-intronENST00000490682ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000358485ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000358485ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000358485ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000358485ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000358485ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
5CDS-intronENST00000358485ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000323492ENST00000262291CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000323492ENST00000537567CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000323492ENST00000539763CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000323492ENST00000536180CASP8chr2

202150040

+VMP1chr17

57915656

+
In-frameENST00000323492ENST00000545362CASP8chr2

202150040

+VMP1chr17

57915656

+
5CDS-intronENST00000323492ENST00000588617CASP8chr2

202150040

+VMP1chr17

57915656

+

Top

FusionProtFeatures for CASP8_VMP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CASP8

Q14790

VMP1

Q96GC9

Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CASP8_VMP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_433aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKV
FFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSL

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_433aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKV
FFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSL

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_433aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKV
FFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSL

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_433aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKV
FFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSL

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_433aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKV
FFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSL

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_517aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGAL
TTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQE

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_517aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGAL
TTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQE

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_517aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGAL
TTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQE

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_517aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGAL
TTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQE

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_517aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGAL
TTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQE

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_534aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEK
RVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPK
LHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGL
KCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_534aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEK
RVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPK
LHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGL
KCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_534aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEK
RVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPK
LHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGL
KCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_534aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEK
RVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPK
LHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGL
KCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_534aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEK
RVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPK
LHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGL
KCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERC

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_576aa
MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADTILLPFKKMDFSRNLTDIGEQLDSEDLASLKFLSLDYIP
QRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLTQISEEVSRSELRSFK
FLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKERSSSLEGSPDEFSNGEELCGVMTISDS
PREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQL
MDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTR
TIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKL

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_576aa
MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADTILLPFKKMDFSRNLTDIGEQLDSEDLASLKFLSLDYIP
QRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLTQISEEVSRSELRSFK
FLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKERSSSLEGSPDEFSNGEELCGVMTISDS
PREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQL
MDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTR
TIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKL

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_576aa
MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADTILLPFKKMDFSRNLTDIGEQLDSEDLASLKFLSLDYIP
QRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLTQISEEVSRSELRSFK
FLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKERSSSLEGSPDEFSNGEELCGVMTISDS
PREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQL
MDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTR
TIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKL

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_576aa
MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADTILLPFKKMDFSRNLTDIGEQLDSEDLASLKFLSLDYIP
QRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLTQISEEVSRSELRSFK
FLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKERSSSLEGSPDEFSNGEELCGVMTISDS
PREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQL
MDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTR
TIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKL

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_576aa
MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADTILLPFKKMDFSRNLTDIGEQLDSEDLASLKFLSLDYIP
QRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLTQISEEVSRSELRSFK
FLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEEFSKERSSSLEGSPDEFSNGEELCGVMTISDS
PREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQITEILKIYQL
MDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPTLEMDLSSPQTR
TIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKL

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_502aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHD
DCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDS
EEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEM

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_502aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHD
DCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDS
EEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEM

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_502aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHD
DCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDS
EEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEM

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_502aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHD
DCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDS
EEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEM

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_502aa
MDFSRNLTDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMEREL
QTPGRAQISAYRVMLTQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDTEE
FSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHD
DCTVEQITEILKIYQLMDHSNMDCFICCILSHGDKGIITGTDGQEAPITELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDS
EEQPTLEMDLSSPQTRTIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRAVPGIGPSLQKPFQEYLEAQRQKLHHKSEM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_1299nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAG
ATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTAT
GGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTG
TTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGAT
TTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAAC
CCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTG
CAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTG
TCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGA

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_1299nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAG
ATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTAT
GGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTG
TTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGAT
TTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAAC
CCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTG
CAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTG
TCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGA

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1299nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAG
ATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTAT
GGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTG
TTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGAT
TTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAAC
CCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTG
CAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTG
TCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGA

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1299nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAG
ATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTAT
GGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTG
TTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGAT
TTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAAC
CCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTG
CAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTG
TCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGA

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1299nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAG
ATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTAT
GGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTG
TTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGAT
TTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAAC
CCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTG
CAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTG
TCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGA

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_1551nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGAC
TCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAAC
AATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTG
ACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAA
CTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAG
GCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGT
CAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACG
AGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGG
TACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAG
TACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAG
TTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAAC

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_1551nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGAC
TCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAAC
AATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTG
ACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAA
CTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAG
GCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGT
CAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACG
AGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGG
TACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAG
TACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAG
TTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAAC

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1551nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGAC
TCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAAC
AATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTG
ACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAA
CTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAG
GCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGT
CAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACG
AGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGG
TACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAG
TACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAG
TTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAAC

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1551nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGAC
TCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAAC
AATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTG
ACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAA
CTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAG
GCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGT
CAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACG
AGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGG
TACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAG
TACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAG
TTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAAC

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1551nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGAC
TCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAAC
AATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTG
ACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAA
CTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAG
GCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGT
CAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACG
AGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGG
TACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAG
TACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAG
TTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAAC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_1602nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTGCCAGACACAG
TCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGG
TCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAG
AGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTAT
GAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGAC
AAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAA
CTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCC
CACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGT
ATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTG
AAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACT
GATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATG
GCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGT
CCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGC
GAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_1602nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTGCCAGACACAG
TCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGG
TCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAG
AGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTAT
GAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGAC
AAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAA
CTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCC
CACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGT
ATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTG
AAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACT
GATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATG
GCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGT
CCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGC
GAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1602nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTGCCAGACACAG
TCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGG
TCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAG
AGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTAT
GAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGAC
AAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAA
CTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCC
CACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGT
ATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTG
AAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACT
GATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATG
GCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGT
CCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGC
GAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1602nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTGCCAGACACAG
TCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGG
TCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAG
AGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTAT
GAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGAC
AAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAA
CTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCC
CACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGT
ATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTG
AAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACT
GATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATG
GCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGT
CCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGC
GAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1602nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTGCCAGACACAG
TCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGG
TCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAG
AGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTAT
GAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGAC
AAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAA
CTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCC
CACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGT
ATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTG
AAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACT
GATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATG
GCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGT
CCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGC
GAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATC

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_1728nt
ATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCCCTTCCCTGCTGAGCAC
GTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCTGCCTTTTAAAAAGATG
GACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCG
CAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTC
CTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAG
ACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAG
TTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATC
CTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTC
AGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCT
CCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAAT
CACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACC
ACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTC
ATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCC
CCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAG
GGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGA
TATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTAC
ATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTAC
CTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTG
GTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCA

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_1728nt
ATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCCCTTCCCTGCTGAGCAC
GTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCTGCCTTTTAAAAAGATG
GACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCG
CAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTC
CTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAG
ACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAG
TTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATC
CTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTC
AGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCT
CCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAAT
CACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACC
ACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTC
ATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCC
CCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAG
GGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGA
TATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTAC
ATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTAC
CTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTG
GTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCA

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1728nt
ATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCCCTTCCCTGCTGAGCAC
GTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCTGCCTTTTAAAAAGATG
GACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCG
CAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTC
CTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAG
ACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAG
TTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATC
CTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTC
AGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCT
CCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAAT
CACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACC
ACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTC
ATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCC
CCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAG
GGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGA
TATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTAC
ATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTAC
CTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTG
GTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCA

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1728nt
ATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCCCTTCCCTGCTGAGCAC
GTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCTGCCTTTTAAAAAGATG
GACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCG
CAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTC
CTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAG
ACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAG
TTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATC
CTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTC
AGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCT
CCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAAT
CACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACC
ACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTC
ATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCC
CCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAG
GGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGA
TATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTAC
ATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTAC
CTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTG
GTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCA

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1728nt
ATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCCCTTCCCTGCTGAGCAC
GTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCTGCCTTTTAAAAAGATG
GACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCG
CAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTC
CTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAG
ACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAG
TTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATC
CTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTC
AGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCT
CCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAAT
CACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACC
ACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTC
ATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCC
CCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAG
GGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGA
TATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTAC
ATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTAC
CTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTG
GTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCA

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_1506nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTT
TACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCAC
AGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGAT
GACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTC
TCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGC
CCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCA
GAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACT
GTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGT
GCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATG
GGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAAC

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_1506nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTT
TACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCAC
AGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGAT
GACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTC
TCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGC
CCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCA
GAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACT
GTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGT
GCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATG
GGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAAC

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1506nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTT
TACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCAC
AGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGAT
GACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTC
TCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGC
CCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCA
GAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACT
GTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGT
GCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATG
GGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAAC

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1506nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTT
TACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCAC
AGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGAT
GACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTC
TCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGC
CCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCA
GAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACT
GTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGT
GCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATG
GGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAAC

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1506nt
ATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATT
CCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCC
TTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTT
CAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTT
AAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTC
ATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAA
TTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTT
TACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCAC
AGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGAT
GACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTC
TCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGC
CCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCA
GAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACT
GTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGT
GCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATG
GGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_2715nt
GTGCTCTGAGTTTTTGGTTTCTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACC
CCGCCAACAGCTTCAGAAGAAGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAG
TTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGA
ACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTT
GATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACT
GGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAG
GGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAA
ACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAG
AGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGA
GCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAA
CATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCT
GACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCA
GAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGA
GGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTG
CCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACG
GCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGT
GTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAA
ATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCC
TTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAA
GGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTT
CTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGC
TTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTT
TATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTC
TGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGT
ATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTA
CTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCC
ACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTG
GTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTC
TGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTA
AGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTTGCTTGGGAGGAAAATAAACAAT

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_1794nt
GTGCTCTGAGTTTTTGGTTTCTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACC
CCGCCAACAGCTTCAGAAGAAGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAG
TTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGA
ACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTT
GATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACT
GGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAG
GGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAA
ACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAG
AGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGA
GCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAA
CATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCT
GACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCA
GAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGA
GGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTG
CCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACG
GCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGT
GTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAA
ATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCC
TTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAA

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1754nt
GTGCTCTGAGTTTTTGGTTTCTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACC
CCGCCAACAGCTTCAGAAGAAGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAG
TTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGA
ACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTT
GATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACT
GGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAG
GGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAA
ACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAG
AGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGA
GCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAA
CATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCT
GACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCA
GAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGA
GGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTG
CCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACG
GCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGT
GTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAA
ATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCC
TTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAA

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1626nt
GTGCTCTGAGTTTTTGGTTTCTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACC
CCGCCAACAGCTTCAGAAGAAGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAG
TTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGA
ACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTT
GATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACT
GGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAG
GGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAA
ACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAG
AGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGA
GCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAA
CATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCT
GACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCA
GAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGA
GGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTG
CCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACG
GCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGT
GTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAA
ATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCC

>In-frame_CASP8_ENST00000264274_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1786nt
GTGCTCTGAGTTTTTGGTTTCTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACC
CCGCCAACAGCTTCAGAAGAAGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAG
TTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGA
ACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTT
GATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACT
GGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAG
GGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAA
ACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAG
AGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGCTTTGACCACGACCTTTGAAGA
GCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAA
CATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCT
GACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCA
GAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGA
GGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTG
CCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACG
GCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGT
GTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAA
ATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCC
TTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAA

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_2921nt
CTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGA
AGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGG
AATATTGAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTG
GACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGC
AATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAA
AGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTG
AGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAG
AAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGAC
TATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACA
ATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTG
ATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCA
GGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAA
ATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGAT
GGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATT
CAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCA
CCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAG
GGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC
TGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAG
CAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGT
TCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATC
TAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGC
CATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTG
AGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCC
GTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAG
CTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTG
GGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTA
CCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGT
TAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTG

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_2000nt
CTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGA
AGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGG
AATATTGAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTG
GACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGC
AATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAA
AGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTG
AGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAG
AAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGAC
TATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACA
ATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTG
ATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCA
GGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAA
ATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGAT
GGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATT
CAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCA
CCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAG
GGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC
TGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAG

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1960nt
CTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGA
AGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGG
AATATTGAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTG
GACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGC
AATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAA
AGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTG
AGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAG
AAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGAC
TATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACA
ATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTG
ATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCA
GGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAA
ATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGAT
GGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATT
CAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCA
CCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAG
GGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1832nt
CTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGA
AGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGG
AATATTGAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTG
GACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGC
AATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAA
AGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTG
AGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAG
AAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGAC
TATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACA
ATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTG
ATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCA
GGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAA
ATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGAT
GGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATT
CAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCA
CCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAG
GGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG

>In-frame_CASP8_ENST00000432109_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1992nt
CTGTTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGA
AGGAGCAGCCCCTGGGTGCGTCCACTTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGG
AATATTGAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTG
GACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGC
AATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAA
AGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTG
AGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAG
AAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGAC
TATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAATGACA
ATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTG
ATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCA
GGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAA
ATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGAT
GGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATT
CAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCA
CCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAG
GGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC
TGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAG

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_3063nt
TTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGAAGG
TGACTGGTGGCTGCCTGAGGAATACCAGTGGGCAAGAGAATTAGCATTTCTGGAGCATCTGCTGTCTGAGCAGCCCCTGGGTGCGTCCAC
TTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCC
TTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCT
GGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAG
CAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGA
AAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTG
CCAGACACAGTCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATC
AGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGA
GATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAAT
CAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACA
GACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAA
AGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGA
GATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTT
CATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTT
CACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACC
TGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCT
GCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAG
AGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCA
CCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCAT
CCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAA
AGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTG
TATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCC
ACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACT
TTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTG
TCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACA
ATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGA
TCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAA
GTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTAT
ACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCA
TGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAAC
AGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGT
GTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTC
TTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTTGCTTGGGAGGAAAATAAACAATTTTACTTTTTTC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_2142nt
TTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGAAGG
TGACTGGTGGCTGCCTGAGGAATACCAGTGGGCAAGAGAATTAGCATTTCTGGAGCATCTGCTGTCTGAGCAGCCCCTGGGTGCGTCCAC
TTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCC
TTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCT
GGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAG
CAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGA
AAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTG
CCAGACACAGTCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATC
AGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGA
GATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAAT
CAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACA
GACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAA
AGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGA
GATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTT
CATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTT
CACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACC
TGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCT
GCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAG
AGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCA
CCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCAT
CCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAA
AGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTG
TATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_2102nt
TTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGAAGG
TGACTGGTGGCTGCCTGAGGAATACCAGTGGGCAAGAGAATTAGCATTTCTGGAGCATCTGCTGTCTGAGCAGCCCCTGGGTGCGTCCAC
TTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCC
TTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCT
GGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAG
CAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGA
AAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTG
CCAGACACAGTCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATC
AGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGA
GATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAAT
CAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACA
GACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAA
AGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGA
GATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTT
CATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTT
CACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACC
TGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCT
GCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAG
AGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCA
CCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCAT
CCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAA
AGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTG
TATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCC

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1974nt
TTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGAAGG
TGACTGGTGGCTGCCTGAGGAATACCAGTGGGCAAGAGAATTAGCATTTCTGGAGCATCTGCTGTCTGAGCAGCCCCTGGGTGCGTCCAC
TTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCC
TTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCT
GGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAG
CAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGA
AAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTG
CCAGACACAGTCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATC
AGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGA
GATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAAT
CAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACA
GACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAA
AGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGA
GATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTT
CATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTT
CACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACC
TGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCT
GCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAG
AGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCA
CCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCAT
CCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAA

>In-frame_CASP8_ENST00000264275_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_2134nt
TTTCACCTTGTGTCTGAGCTGGTCTGAAGGCTGGTTGTTCAGACTGAGCTTCCTGCCTGCCTGTACCCCGCCAACAGCTTCAGAAGAAGG
TGACTGGTGGCTGCCTGAGGAATACCAGTGGGCAAGAGAATTAGCATTTCTGGAGCATCTGCTGTCTGAGCAGCCCCTGGGTGCGTCCAC
TTTCTGGGCACGTGAGGTTGGGCCTTGGCCGCCTGAGCCCTTGAGTTGGTCACTTGAACCTTGGGAATATTGAGATTATATTCTCCTGCC
TTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCT
GGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAG
CAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGA
AAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGTTCCACTTCTGCCGCATGAGCTGGGCTGAAGCAAACAGCCAGTG
CCAGACACAGTCTGTACCTTTCTGGCGGAGGGTCGATCATCTATTAATAAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATC
AGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGA
GATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAAT
CAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACA
GACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAA
AGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGA
GATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTT
CATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTT
CACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACC
TGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCT
GCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAG
AGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCA
CCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCAT
CCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAA
AGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTG
TATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCC

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_3105nt
AGTCATCTCTGTTCTGCTTTAGGAGTAAAGTTTACCCTGCAGTTCCTTCTGTGGTGAAGTTTTCTCTTTCTCTCGGAGACCAGATTCTGC
CTTTCTGCTGGAGGGAAGTGTTTTCACAGGTTCTCCTCCTTTTATCTTTTGTGTTTTTTTTCAAGCCCTGCTGAATTTGCTAGTCAACTC
AACAGGAAGTGAGGCCATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCC
CTTCCCTGCTGAGCACGTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCT
GCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAG
CCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGA
AAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGAT
GGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGA
ATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGAT
GGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAA
CGACTATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAAT
GACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTG
TCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGA
TGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTT
GAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCAC
TGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTT
TATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATC
ATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGC
AGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAA
GCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTG
GATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCA
GCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGG
GAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTT
GCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGT
TCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAA
AAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAAT
TATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAA
GGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACA
AGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGT
GTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCT
TAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACC
TCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAA
ATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTAT
ATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCAT

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_2184nt
AGTCATCTCTGTTCTGCTTTAGGAGTAAAGTTTACCCTGCAGTTCCTTCTGTGGTGAAGTTTTCTCTTTCTCTCGGAGACCAGATTCTGC
CTTTCTGCTGGAGGGAAGTGTTTTCACAGGTTCTCCTCCTTTTATCTTTTGTGTTTTTTTTCAAGCCCTGCTGAATTTGCTAGTCAACTC
AACAGGAAGTGAGGCCATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCC
CTTCCCTGCTGAGCACGTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCT
GCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAG
CCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGA
AAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGAT
GGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGA
ATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGAT
GGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAA
CGACTATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAAT
GACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTG
TCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGA
TGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTT
GAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCAC
TGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTT
TATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATC
ATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGC
AGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAA
GCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTG
GATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCA
GCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGG
GAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTT
GCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGT

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_2144nt
AGTCATCTCTGTTCTGCTTTAGGAGTAAAGTTTACCCTGCAGTTCCTTCTGTGGTGAAGTTTTCTCTTTCTCTCGGAGACCAGATTCTGC
CTTTCTGCTGGAGGGAAGTGTTTTCACAGGTTCTCCTCCTTTTATCTTTTGTGTTTTTTTTCAAGCCCTGCTGAATTTGCTAGTCAACTC
AACAGGAAGTGAGGCCATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCC
CTTCCCTGCTGAGCACGTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCT
GCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAG
CCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGA
AAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGAT
GGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGA
ATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGAT
GGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAA
CGACTATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAAT
GACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTG
TCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGA
TGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTT
GAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCAC
TGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTT
TATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATC
ATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGC
AGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAA
GCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTG
GATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCA
GCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGG
GAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTT

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_2016nt
AGTCATCTCTGTTCTGCTTTAGGAGTAAAGTTTACCCTGCAGTTCCTTCTGTGGTGAAGTTTTCTCTTTCTCTCGGAGACCAGATTCTGC
CTTTCTGCTGGAGGGAAGTGTTTTCACAGGTTCTCCTCCTTTTATCTTTTGTGTTTTTTTTCAAGCCCTGCTGAATTTGCTAGTCAACTC
AACAGGAAGTGAGGCCATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCC
CTTCCCTGCTGAGCACGTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCT
GCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAG
CCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGA
AAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGAT
GGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGA
ATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGAT
GGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAA
CGACTATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAAT
GACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTG
TCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGA
TGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTT
GAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCAC
TGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTT
TATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATC
ATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGC
AGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAA
GCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTG
GATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCA
GCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGG

>In-frame_CASP8_ENST00000358485_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_2176nt
AGTCATCTCTGTTCTGCTTTAGGAGTAAAGTTTACCCTGCAGTTCCTTCTGTGGTGAAGTTTTCTCTTTCTCTCGGAGACCAGATTCTGC
CTTTCTGCTGGAGGGAAGTGTTTTCACAGGTTCTCCTCCTTTTATCTTTTGTGTTTTTTTTCAAGCCCTGCTGAATTTGCTAGTCAACTC
AACAGGAAGTGAGGCCATGGAGGGAGGCAGAAGAGCCAGGGTGGTTATTGAAAGTAAAAGAAACTTCTTCCTGGGAGCCTTTCCCACCCC
CTTCCCTGCTGAGCACGTGGAGTTAGGCAGGTTAGGGGACTCGGAGACTGCGATGGTGCCAGGAAAGGGTGGAGCGGATTATATTCTCCT
GCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAACTGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAG
CCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGTTATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGA
AAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATTTGCTGATTACCTACCTAAACACTAGAAAGGAGGAGAT
GGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCATGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGA
ATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGGATGATGACATGAACCTGCTGGATATTTTCATAGAGAT
GGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCTGTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAA
CGACTATGAAGAATTCAGCAAAGAGAGAAGCAGCAGCCTTGAAGGAAGTCCTGATGAATTTTCAAATGGGGAGGAGTTGTGTGGGGTAAT
GACAATCTCGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTG
TCTGATCATCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGA
TGCAGGGGCTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTT
GAAAATCTACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCAC
TGATGGACAGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTT
TATTCAGGCTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATC
ATCACCTCAAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGC
AGAGGGAACCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAA
GCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTG
GATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCA
GCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGG
GAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTT
GCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGT

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000262291_chr17_57915656_+_2827nt
GTAGAGCTGGCTGGCTGTGCCCTTCCGTCCTTCATTAGACGTTTGCTCTTGTCTTAGATGCTCAGATGGTAGTGGATAGGCCTGTGACGA
AGGTGCTACCATCGTGAGAGTAAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAAC
TGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGT
TATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATT
TGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCA
TGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGG
ATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCT
GTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCT
CGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCA
TCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGG
CTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCT
ACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGAC
AGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGG
CTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTC
AAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAA
CCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTC
AGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTG
AAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGT
TGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTC
CAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGAC
ATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGC
AAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCT
AAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGA
TTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATT
TTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCT
GACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTT
TCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTT
CTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGAT
TGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCA
TTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAAC
CCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTT

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000537567_chr17_57915656_+_1906nt
GTAGAGCTGGCTGGCTGTGCCCTTCCGTCCTTCATTAGACGTTTGCTCTTGTCTTAGATGCTCAGATGGTAGTGGATAGGCCTGTGACGA
AGGTGCTACCATCGTGAGAGTAAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAAC
TGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGT
TATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATT
TGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCA
TGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGG
ATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCT
GTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCT
CGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCA
TCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGG
CTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCT
ACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGAC
AGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGG
CTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTC
AAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAA
CCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTC
AGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTG
AAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGT
TGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTC
CAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGAC
ATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGC

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000539763_chr17_57915656_+_1866nt
GTAGAGCTGGCTGGCTGTGCCCTTCCGTCCTTCATTAGACGTTTGCTCTTGTCTTAGATGCTCAGATGGTAGTGGATAGGCCTGTGACGA
AGGTGCTACCATCGTGAGAGTAAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAAC
TGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGT
TATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATT
TGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCA
TGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGG
ATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCT
GTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCT
CGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCA
TCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGG
CTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCT
ACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGAC
AGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGG
CTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTC
AAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAA
CCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTC
AGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTG
AAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGT
TGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTC
CAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGAC

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000536180_chr17_57915656_+_1738nt
GTAGAGCTGGCTGGCTGTGCCCTTCCGTCCTTCATTAGACGTTTGCTCTTGTCTTAGATGCTCAGATGGTAGTGGATAGGCCTGTGACGA
AGGTGCTACCATCGTGAGAGTAAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAAC
TGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGT
TATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATT
TGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCA
TGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGG
ATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCT
GTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCT
CGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCA
TCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGG
CTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCT
ACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGAC
AGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGG
CTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTC
AAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAA
CCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTC
AGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTG
AAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGT
TGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTC

>In-frame_CASP8_ENST00000323492_chr2_202150040_+_VMP1_ENST00000545362_chr17_57915656_+_1898nt
GTAGAGCTGGCTGGCTGTGCCCTTCCGTCCTTCATTAGACGTTTGCTCTTGTCTTAGATGCTCAGATGGTAGTGGATAGGCCTGTGACGA
AGGTGCTACCATCGTGAGAGTAAGATTATATTCTCCTGCCTTTTAAAAAGATGGACTTCAGCAGAAATCTTTATGATATTGGGGAACAAC
TGGACAGTGAAGATCTGGCCTCCCTCAAGTTCCTGAGCCTGGACTACATTCCGCAAAGGAAGCAAGAACCCATCAAGGATGCCTTGATGT
TATTCCAGAGACTCCAGGAAAAGAGAATGTTGGAGGAAAGCAATCTGTCCTTCCTGAAGGAGCTGCTCTTCCGAATTAATAGACTGGATT
TGCTGATTACCTACCTAAACACTAGAAAGGAGGAGATGGAAAGGGAACTTCAGACACCAGGCAGGGCTCAAATTTCTGCCTACAGGGTCA
TGCTCTATCAGATTTCAGAAGAAGTGAGCAGATCAGAATTGAGGTCTTTTAAGTTTCTTTTGCAAGAGGAAATCTCCAAATGCAAACTGG
ATGATGACATGAACCTGCTGGATATTTTCATAGAGATGGAGAAGAGGGTCATCCTGGGAGAAGGAAAGTTGGACATCCTGAAAAGAGTCT
GTGCCCAAATCAACAAGAGCCTGCTGAAGATAATCAACGACTATGAAGAATTCAGCAAAGGGGAGGAGTTGTGTGGGGTAATGACAATCT
CGGACTCTCCAAGAGAACAGGATAGTGAATCACAGACTTTGGACAAAGTTTACCAAATGAAAAGCAAACCTCGGGGATACTGTCTGATCA
TCAACAATCACAATTTTGCAAAAGCACGGGAGAAAGTGCCCAAACTTCACAGCATTAGGGACAGGAATGGAACACACTTGGATGCAGGGG
CTTTGACCACGACCTTTGAAGAGCTTCATTTTGAGATCAAGCCCCACGATGACTGCACAGTAGAGCAAATCTATGAGATTTTGAAAATCT
ACCAACTCATGGACCACAGTAACATGGACTGCTTCATCTGCTGTATCCTCTCCCATGGAGACAAGGGCATCATCTATGGCACTGATGGAC
AGGAGGCCCCCATCTATGAGCTGACATCTCAGTTCACTGGTTTGAAGTGCCCTTCCCTTGCTGGAAAACCCAAAGTGTTTTTTATTCAGG
CTTGTCAGGGGGATAACTACCAGAAAGGTATACCTGTTGAGACTGATTCAGAGGAGCAACCCTATTTAGAAATGGATTTATCATCACCTC
AAACGAGATATATCCCGGATGAGGCTGACTTTCTGCTGGGGATGGCCACTGTGAATAACTGTGTTTCCTACCGAAACCCTGCAGAGGGAA
CCTGGTACATCCAGTCACTTTGCCAGAGCCTGAGAGAGCGATGTCCTCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTC
AGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTG
AAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGT
TGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTC
CAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGAC
ATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGC


Top

FusionGenePPI for CASP8_VMP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CASP8TNFRSF10B, FADD, FASLG, BID, EZR, FAS, MAPK8, MSN, CASP10, RHOA, ARHGDIA, TNFRSF1A, RALBP1, TRADD, TRAF1, TRAF2, BIRC2, CFLAR, CASP8, CHD3, TFCP2, VIM, BCAP31, TNFRSF10A, APAF1, NR1H4, NOD1, PEA15, BCL2, HIP1, IFT57, CASP6, CASP3, CASP7, CASP9, CASP2, BCL2L1, XIAP, RIPK1, MAP3K14, CHUK, IKBKB, NOL3, DEDD2, DEDD, CASP4, CASP1, CASP8AP2, CASP14, TNFAIP3, HDAC7, FAF1, RALGDS, NLRC4, PTEN, KHDRBS1, MAP1LC3B, USP2, TSC22D3, MAP1LC3A, SQSTM1, TNFSF10, SORBS1, CEBPB, TRAF6, COPS6, CLIP3, BIRC6, BFAR, RNF34, MAPK1, TOPORS, TP53, LRRK2, FIS1, UBC, CUL3, CARD11, PARK7, RIPK3, RB1, PLA2G4B, PRKCI, SNRPD3, PDIA6, PLIN4, GZMB, HECTD3, CRYAB, TNF, PRDX6, BAX, ERLIN2, TICAM1, BIRC3, ATG4D, PARP1, AGR3, ANGPTL4, ATAD2, BAP1, BEX1, BLID, CASC3, CDH13, EPSTI1, ERRFI1, GLCE, GREB1, IL13RA2, IL24, KLK5, KLK9, LYPD3, PRDM14, PSMC3IP, S100A14, SCGB2A2, SERPINB5, ST14, PRSS50, VPS45, WHSC1L1, ATP1A3, BCL2L10, CNBP, HBP1, QDPR, SOX2, UMPS, YBX1, BLM, GMNN, MLKL, TLR3, OPTN, RYBP, CHEK1, CDK9, MTOR, VHL, CDKN1B, SERPINB9, MAPK14VMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CASP8_VMP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CASP8_VMP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCASP8C1458155Mammary Neoplasms3CTD_human
HgeneCASP8C0014859Esophageal Neoplasms2CTD_human
HgeneCASP8C0025202melanoma2CTD_human
HgeneCASP8C0001418Adenocarcinoma1CTD_human
HgeneCASP8C0005586Bipolar Disorder1PSYGENET
HgeneCASP8C0007131Non-Small Cell Lung Carcinoma1CTD_human
HgeneCASP8C0007873Uterine Cervical Neoplasm1CTD_human
HgeneCASP8C0009404Colorectal Neoplasms1CTD_human
HgeneCASP8C0011616Contact Dermatitis1CTD_human
HgeneCASP8C0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
HgeneCASP8C0013604Edema1CTD_human
HgeneCASP8C0024121Lung Neoplasms1CTD_human
HgeneCASP8C0027055Myocardial Reperfusion Injury1CTD_human
HgeneCASP8C0035126Reperfusion Injury1CTD_human
HgeneCASP8C0037286Skin Neoplasms1CTD_human
HgeneCASP8C0038220Status Epilepticus1CTD_human
HgeneCASP8C0038356Stomach Neoplasms1CTD_human
HgeneCASP8C0162820Dermatitis, Allergic Contact1CTD_human
HgeneCASP8C0950124Papillomavirus Infections1CTD_human
HgeneCASP8C1168401Squamous cell carcinoma of the head and neck1CTD_human
HgeneCASP8C1846545Autoimmune Lymphoproliferative Syndrome Type 2B1ORPHANET;UNIPROT
HgeneCASP8C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human
HgeneCASP8C2937358Cerebral Hemorrhage1CTD_human