FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5337

FusionGeneSummary for CALU_LAP3

check button Fusion gene summary
Fusion gene informationFusion gene name: CALU_LAP3
Fusion gene ID: 5337
HgeneTgene
Gene symbol

CALU

LAP3

Gene ID

813

51056

Gene namecalumeninleucine aminopeptidase 3
Synonyms-HEL-S-106|LAP|LAPEP|PEPS
Cytomap

7q32.1

4p15.32

Type of geneprotein-codingprotein-coding
DescriptioncalumeninIEF SSP 9302crocalbin-like proteinmultiple EF-hand proteincytosol aminopeptidaseLAP-3epididymis secretory protein Li 106leucyl aminopeptidasepeptidase Sproline aminopeptidaseprolyl aminopeptidase
Modification date2018052320180519
UniProtAcc

O43852

P28838

Ensembl transtripts involved in fusion geneENST00000538546, ENST00000535623, 
ENST00000535011, ENST00000542996, 
ENST00000249364, ENST00000449187, 
ENST00000479257, 
ENST00000226299, 
ENST00000606142, ENST00000503467, 
Fusion gene scores* DoF score5 X 9 X 2=905 X 4 X 5=100
# samples 125
** MAII scorelog2(12/90*10)=0.415037499278844
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CALU [Title/Abstract] AND LAP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDKIRPTCGA-PJ-A5Z8-01ACALUchr7

128407709

+LAP3chr4

17600079

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000538546ENST00000226299CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000538546ENST00000606142CALUchr7

128407709

+LAP3chr4

17600079

+
5CDS-3UTRENST00000538546ENST00000503467CALUchr7

128407709

+LAP3chr4

17600079

+
3UTR-3CDSENST00000535623ENST00000226299CALUchr7

128407709

+LAP3chr4

17600079

+
3UTR-3CDSENST00000535623ENST00000606142CALUchr7

128407709

+LAP3chr4

17600079

+
3UTR-3UTRENST00000535623ENST00000503467CALUchr7

128407709

+LAP3chr4

17600079

+
intron-3CDSENST00000535011ENST00000226299CALUchr7

128407709

+LAP3chr4

17600079

+
intron-3CDSENST00000535011ENST00000606142CALUchr7

128407709

+LAP3chr4

17600079

+
intron-3UTRENST00000535011ENST00000503467CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000542996ENST00000226299CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000542996ENST00000606142CALUchr7

128407709

+LAP3chr4

17600079

+
5CDS-3UTRENST00000542996ENST00000503467CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000249364ENST00000226299CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000249364ENST00000606142CALUchr7

128407709

+LAP3chr4

17600079

+
5CDS-3UTRENST00000249364ENST00000503467CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000449187ENST00000226299CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000449187ENST00000606142CALUchr7

128407709

+LAP3chr4

17600079

+
5CDS-3UTRENST00000449187ENST00000503467CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000479257ENST00000226299CALUchr7

128407709

+LAP3chr4

17600079

+
In-frameENST00000479257ENST00000606142CALUchr7

128407709

+LAP3chr4

17600079

+
5CDS-3UTRENST00000479257ENST00000503467CALUchr7

128407709

+LAP3chr4

17600079

+

Top

FusionProtFeatures for CALU_LAP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CALU

O43852

LAP3

P28838

Presumably involved in the processing and regularturnover of intracellular proteins. Catalyzes the removal ofunsubstituted N-terminal amino acids from various peptides.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67117_128281316Calcium binding2
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67164_175281316Calcium binding3%3B possibly ancestral
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67201_212281316Calcium binding4
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67242_253281316Calcium binding5
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+6781_92281316Calcium binding1
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67117_128281316Calcium binding2
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67164_175281316Calcium binding3%3B possibly ancestral
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67201_212281316Calcium binding4
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67242_253281316Calcium binding5
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+6781_92281316Calcium binding1
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78117_128289324Calcium binding2
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78164_175289324Calcium binding3%3B possibly ancestral
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78201_212289324Calcium binding4
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78242_253289324Calcium binding5
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78278_289289324Calcium binding6
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+7881_92289324Calcium binding1
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89117_128353634Calcium binding2
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89164_175353634Calcium binding3%3B possibly ancestral
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89201_212353634Calcium binding4
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89242_253353634Calcium binding5
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89278_289353634Calcium binding6
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+8981_92353634Calcium binding1
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45117_128130165Calcium binding2
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+4581_92130165Calcium binding1
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78117_128289324Calcium binding2
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78164_175289324Calcium binding3%3B possibly ancestral
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78201_212289324Calcium binding4
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78242_253289324Calcium binding5
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78278_289289324Calcium binding6
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+7881_92289324Calcium binding1
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67104_139281316DomainEF-hand 2
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67151_186281316DomainEF-hand 3
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67188_223281316DomainEF-hand 4
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67229_264281316DomainEF-hand 5
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+6768_103281316DomainEF-hand 1
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67104_139281316DomainEF-hand 2
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67151_186281316DomainEF-hand 3
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67188_223281316DomainEF-hand 4
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67229_264281316DomainEF-hand 5
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+6768_103281316DomainEF-hand 1
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78104_139289324DomainEF-hand 2
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78151_186289324DomainEF-hand 3
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78188_223289324DomainEF-hand 4
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78229_264289324DomainEF-hand 5
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+7868_103289324DomainEF-hand 1
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89104_139353634DomainEF-hand 2
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89151_186353634DomainEF-hand 3
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89188_223353634DomainEF-hand 4
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89229_264353634DomainEF-hand 5
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89265_300353634DomainEF-hand 6
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+8968_103353634DomainEF-hand 1
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+4568_103130165DomainEF-hand 1
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78104_139289324DomainEF-hand 2
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78151_186289324DomainEF-hand 3
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78188_223289324DomainEF-hand 4
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78229_264289324DomainEF-hand 5
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+7868_103289324DomainEF-hand 1
HgeneCALUchr7:128407709chr4:17600079ENST00000535623+89312_315353634MotifPrevents secretion from ER

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67278_289281316Calcium binding6
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67278_289281316Calcium binding6
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16117_128-51225Calcium binding2
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16164_175-51225Calcium binding3%3B possibly ancestral
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16201_212-51225Calcium binding4
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16242_253-51225Calcium binding5
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16278_289-51225Calcium binding6
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+1681_92-51225Calcium binding1
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45164_175130165Calcium binding3%3B possibly ancestral
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45201_212130165Calcium binding4
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45242_253130165Calcium binding5
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45278_289130165Calcium binding6
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67265_300281316DomainEF-hand 6
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67265_300281316DomainEF-hand 6
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78265_300289324DomainEF-hand 6
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16104_139-51225DomainEF-hand 2
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16151_186-51225DomainEF-hand 3
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16188_223-51225DomainEF-hand 4
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16229_264-51225DomainEF-hand 5
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16265_300-51225DomainEF-hand 6
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+1668_103-51225DomainEF-hand 1
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45104_139130165DomainEF-hand 2
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45151_186130165DomainEF-hand 3
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45188_223130165DomainEF-hand 4
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45229_264130165DomainEF-hand 5
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45265_300130165DomainEF-hand 6
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78265_300289324DomainEF-hand 6
HgeneCALUchr7:128407709chr4:17600079ENST00000249364+67312_315281316MotifPrevents secretion from ER
HgeneCALUchr7:128407709chr4:17600079ENST00000449187+67312_315281316MotifPrevents secretion from ER
HgeneCALUchr7:128407709chr4:17600079ENST00000479257+78312_315289324MotifPrevents secretion from ER
HgeneCALUchr7:128407709chr4:17600079ENST00000535011+16312_315-51225MotifPrevents secretion from ER
HgeneCALUchr7:128407709chr4:17600079ENST00000538546+45312_315130165MotifPrevents secretion from ER
HgeneCALUchr7:128407709chr4:17600079ENST00000542996+78312_315289324MotifPrevents secretion from ER


Top

FusionGeneSequence for CALU_LAP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CALU_ENST00000538546_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_291aa
MMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFR
DKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFT
NSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGM

>In-frame_CALU_ENST00000538546_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_291aa
MMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFR
DKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFT
NSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGM

>In-frame_CALU_ENST00000542996_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_450aa
MKETDLIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDA
DKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIAT
KEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSD
YDHAEAEARHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVW
RMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNAX

>In-frame_CALU_ENST00000542996_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_450aa
MKETDLIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDA
DKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIAT
KEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSD
YDHAEAEARHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVW
RMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNAX

>In-frame_CALU_ENST00000249364_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_442aa
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTV
DELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEA
RHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHY

>In-frame_CALU_ENST00000249364_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_442aa
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTV
DELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEA
RHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHY

>In-frame_CALU_ENST00000449187_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_442aa
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTE
GELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEA
RHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHY

>In-frame_CALU_ENST00000449187_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_442aa
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTE
GELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEA
RHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHY

>In-frame_CALU_ENST00000479257_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_450aa
MKETDLIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDG
DKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIAT
KEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSD
YDHAEAEARHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVW
RMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNAX

>In-frame_CALU_ENST00000479257_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_450aa
MKETDLIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDG
DKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIAT
KEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSD
YDHAEAEARHLVYESDQNKVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVW
RMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNAX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CALU_ENST00000538546_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_873nt
ATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCAC
CCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAA
GAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGG
GATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGG
CACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACAC
ACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACC
AATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACA
AGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAA
GAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATG

>In-frame_CALU_ENST00000538546_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_873nt
ATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCAC
CCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAA
GAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGG
GATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGG
CACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACAC
ACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACC
AATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACA
AGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAA
GAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATG

>In-frame_CALU_ENST00000542996_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_1350nt
ATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACA
GAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTC
TTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCG
GATAAAGATGGGTTTGTGACGGAGGGGGAGCTGAAATCCTGGATTAAGCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAA
TGGCAGGAGTTTGATATGAATCAAGACGGCTTAATCTCCTGGGATGAGTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGAT
CCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACC
AAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAG
AATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACA
GAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGAC
TATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATA
CTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTG
GGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGG
AGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGA
GCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGAT
GAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAG

>In-frame_CALU_ENST00000542996_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_1350nt
ATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACA
GAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTC
TTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCG
GATAAAGATGGGTTTGTGACGGAGGGGGAGCTGAAATCCTGGATTAAGCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAA
TGGCAGGAGTTTGATATGAATCAAGACGGCTTAATCTCCTGGGATGAGTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGAT
CCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACC
AAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAG
AATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACA
GAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGAC
TATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATA
CTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTG
GGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGG
AGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGA
GCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGAT
GAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAG

>In-frame_CALU_ENST00000249364_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_1326nt
ATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCAT
GAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACC
TTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAGATTGTAAGTAAAATAGATGGCGACAAGGACGGGTTTGTCACTGTG
GATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAGTGGAAGGGGCATGACCTCAATGAG
GACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGATCCAGATCCTGATGATGGATTTAACTATAAA
CAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTG
CACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTA
GAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTT
CGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCC
AGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCA
CACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTT
ACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTAT
ACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTG
AAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGC

>In-frame_CALU_ENST00000249364_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_1326nt
ATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCAT
GAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACC
TTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAGATTGTAAGTAAAATAGATGGCGACAAGGACGGGTTTGTCACTGTG
GATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAGTGGAAGGGGCATGACCTCAATGAG
GACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGATCCAGATCCTGATGATGGATTTAACTATAAA
CAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTG
CACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTA
GAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTT
CGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCC
AGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCA
CACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTT
ACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTAT
ACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTG
AAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGC

>In-frame_CALU_ENST00000449187_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_1326nt
ATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCAT
GAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACC
TTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCGGATAAAGATGGGTTTGTGACGGAG
GGGGAGCTGAAATCCTGGATTAAGCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAATGGCAGGAGTTTGATATGAATCAA
GACGGCTTAATCTCCTGGGATGAGTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGATCCTGATGATGGATTTAACTATAAA
CAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTG
CACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTA
GAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTT
CGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCC
AGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCA
CACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTT
ACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTAT
ACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTG
AAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGC

>In-frame_CALU_ENST00000449187_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_1326nt
ATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCAT
GAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACC
TTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCGGATAAAGATGGGTTTGTGACGGAG
GGGGAGCTGAAATCCTGGATTAAGCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAATGGCAGGAGTTTGATATGAATCAA
GACGGCTTAATCTCCTGGGATGAGTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGATCCTGATGATGGATTTAACTATAAA
CAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTG
CACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTA
GAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTT
CGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCC
AGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCA
CACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTT
ACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTAT
ACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTG
AAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGC

>In-frame_CALU_ENST00000479257_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_1350nt
ATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACA
GAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTC
TTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAGATTGTAAGTAAAATAGATGGC
GACAAGGACGGGTTTGTCACTGTGGATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAG
TGGAAGGGGCATGACCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGATCCAGAT
CCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACC
AAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAG
AATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACA
GAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGAC
TATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATA
CTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTG
GGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGG
AGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGA
GCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGAT
GAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAG

>In-frame_CALU_ENST00000479257_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_1350nt
ATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACA
GAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTC
TTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAGATTGTAAGTAAAATAGATGGC
GACAAGGACGGGTTTGTCACTGTGGATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAG
TGGAAGGGGCATGACCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGATCCAGAT
CCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACC
AAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAG
AATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACA
GAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGAC
TATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATA
CTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTG
GGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGG
AGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGA
GCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGAT
GAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CALU_ENST00000538546_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_1431nt
GATTGGTCGGGAGGCCGCCGGCGAGGCGGATGAGGGCGGGGTGCGGACCCGCTTCCGGTTGGGCGGTGCTTGCGCGCGTGAGCTGAGCCG
GTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAAGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGA
TGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACC
CTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAG
AGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGG
ATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGC
ACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACA
CGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCA
ATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAA
GACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAG
AATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGA
CTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCT
GTCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTA
GAACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATT
TTTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAAC

>In-frame_CALU_ENST00000538546_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_1397nt
GATTGGTCGGGAGGCCGCCGGCGAGGCGGATGAGGGCGGGGTGCGGACCCGCTTCCGGTTGGGCGGTGCTTGCGCGCGTGAGCTGAGCCG
GTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAAGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGA
TGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACC
CTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAG
AGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGG
ATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGC
ACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACA
CGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCA
ATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAA
GACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAG
AATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGA
CTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCT
GTCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTA
GAACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATT
TTTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAAC

>In-frame_CALU_ENST00000542996_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_2672nt
GATTGGTCGGGAGGCCGCCGGCGAGGCGGATGAGGGCGGGGTGCGGACCCGCTTCCGGTTGGGCGGTGCTTGCGCGCGTGAGCTGAGCCG
GTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAAGGACCTCCCACCCTCCCCCACTGAGCTGCCTTCCCAGTGA
TGAAAGAAAAAATGTAAAAGCCTGAAAACCCTTCTTCTTGATTTTTAATTTTTTTTTTTCCCTCTAAGACCTTAACCACTCTGGATAGTA
TCACGGGGTATCAGTAGAGTGTGCTAAACAGATGTGTACTCTGCAGCTTCTTTGCAGGTTTTTTGTCACATTTTTCAGTCAAGTGTTCCA
GCTTTGTGCTTGTTCATTAGAGTCACCTGTGACTACAGAGATTCTGAAAGTTTGAATCAGGGCCTGGGAATCTGTACTTTGAACAGTACT
ACAGGTGGTATTTATGCCTAGGCAAGTATGGGAAACAACTGTGCAGAAGGATAAAGACGTTCTTATCTATGACTAGACCATCTGAATGAT
TTGGCCTTTGAAGGTGACTCAAGGTTGAGCCTGGATGTTGGAGACTTGGTGCTATAGACCAAGGAAGCTGCCAAGTATTTCGCTGGTTCC
TAATCTCATGAACATCAGAATCACCTGAAAAACATTTAAAGCTACGAATGTCTGAATTCAGCTTCAGAGACTCTAAATCAATAGGAGAAA
CTTAAAGCTTCCTAGATGATTCTAATAACCAGCCATGTTTGAAGACCAGACCACCAATGCGTACAAGAAGTAAAGGATTTGGAGTCAACA
TTTAAACCTTGGTTCTTTCACTTTTAATTCTTATGAACTTGGGCAAAAGGATTAAAATTCTACTTTGGTATCTTTTGAAAGAAAACAGAA
AGTGGACATTTTAACTATAAGTTTCTTATCAGCCTACAATCAGATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTAT
GTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGT
TCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGA
GAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCGGATAAAGATGGGTTTGTGACGGAGGGGGAGCTGAAATCCTGGATTAA
GCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAATGGCAGGAGTTTGATATGAATCAAGACGGCTTAATCTCCTGGGATGA
GTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCG
GAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACAT
GAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTA
CAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAA
GATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGA
CCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCAT
CCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAA
CAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCA
GCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAA
GTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGAC
TCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTG
AACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTA
TGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAAT
GATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGG

>In-frame_CALU_ENST00000542996_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_2638nt
GATTGGTCGGGAGGCCGCCGGCGAGGCGGATGAGGGCGGGGTGCGGACCCGCTTCCGGTTGGGCGGTGCTTGCGCGCGTGAGCTGAGCCG
GTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAAGGACCTCCCACCCTCCCCCACTGAGCTGCCTTCCCAGTGA
TGAAAGAAAAAATGTAAAAGCCTGAAAACCCTTCTTCTTGATTTTTAATTTTTTTTTTTCCCTCTAAGACCTTAACCACTCTGGATAGTA
TCACGGGGTATCAGTAGAGTGTGCTAAACAGATGTGTACTCTGCAGCTTCTTTGCAGGTTTTTTGTCACATTTTTCAGTCAAGTGTTCCA
GCTTTGTGCTTGTTCATTAGAGTCACCTGTGACTACAGAGATTCTGAAAGTTTGAATCAGGGCCTGGGAATCTGTACTTTGAACAGTACT
ACAGGTGGTATTTATGCCTAGGCAAGTATGGGAAACAACTGTGCAGAAGGATAAAGACGTTCTTATCTATGACTAGACCATCTGAATGAT
TTGGCCTTTGAAGGTGACTCAAGGTTGAGCCTGGATGTTGGAGACTTGGTGCTATAGACCAAGGAAGCTGCCAAGTATTTCGCTGGTTCC
TAATCTCATGAACATCAGAATCACCTGAAAAACATTTAAAGCTACGAATGTCTGAATTCAGCTTCAGAGACTCTAAATCAATAGGAGAAA
CTTAAAGCTTCCTAGATGATTCTAATAACCAGCCATGTTTGAAGACCAGACCACCAATGCGTACAAGAAGTAAAGGATTTGGAGTCAACA
TTTAAACCTTGGTTCTTTCACTTTTAATTCTTATGAACTTGGGCAAAAGGATTAAAATTCTACTTTGGTATCTTTTGAAAGAAAACAGAA
AGTGGACATTTTAACTATAAGTTTCTTATCAGCCTACAATCAGATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTAT
GTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGT
TCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGA
GAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCGGATAAAGATGGGTTTGTGACGGAGGGGGAGCTGAAATCCTGGATTAA
GCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAATGGCAGGAGTTTGATATGAATCAAGACGGCTTAATCTCCTGGGATGA
GTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCG
GAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACAT
GAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTA
CAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAA
GATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGA
CCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCAT
CCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAA
CAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCA
GCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAA
GTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGAC
TCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTG
AACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTA
TGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAAT
GATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGG

>In-frame_CALU_ENST00000249364_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_1807nt
GCTTCCGGTTGGGCGGTGCTTGCGCGCGTGAGCTGAGCCGGTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAA
GATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGAC
CGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAA
GAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAGATTGTAAGTAAAATAGATGGCGACAAGGACGGG
TTTGTCACTGTGGATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAGTGGAAGGGGCAT
GACCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGATCCAGATCCTGATGATGGA
TTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTC
ACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGT
TTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAG
TTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCA
GAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCG
CTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCC
ACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTC
TTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCT
GCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTAT
CTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCA
AAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGAT
GGTATTTAAAAATGTAGAACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATC
TTACTTGATAAGGATTTTTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGA
GAAGCAAAATTGTAACTCAGATTTGTGATGCTAGGAACATGAGCAAACTGAAAATTACTATGCACTTGTCAGAAACAATAAATGCAACTT

>In-frame_CALU_ENST00000249364_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_1773nt
GCTTCCGGTTGGGCGGTGCTTGCGCGCGTGAGCTGAGCCGGTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAA
GATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGAC
CGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAA
GAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAGATTGTAAGTAAAATAGATGGCGACAAGGACGGG
TTTGTCACTGTGGATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAGTGGAAGGGGCAT
GACCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGATCCAGATCCTGATGATGGA
TTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTC
ACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGT
TTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAG
TTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCA
GAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCG
CTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCC
ACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTC
TTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCT
GCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTAT
CTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCA
AAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGAT
GGTATTTAAAAATGTAGAACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATC
TTACTTGATAAGGATTTTTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGA

>In-frame_CALU_ENST00000449187_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_1786nt
GCGCGCGTGAGCTGAGCCGGTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAAGATCTAATTATCATGGACCTG
CGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAG
CTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACCTTTGATCAG
CTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCGGATAAAGATGGGTTTGTGACGGAGGGGGAGCTG
AAATCCTGGATTAAGCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAATGGCAGGAGTTTGATATGAATCAAGACGGCTTA
ATCTCCTGGGATGAGTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGATGATG
GTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACCCTGAG
GAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTAT
ATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAG
AACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTG
GTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTT
AACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCA
TCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAG
GTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTC
GTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGG
AGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTT
AAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACA
CAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAA
GATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGA

>In-frame_CALU_ENST00000449187_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_1752nt
GCGCGCGTGAGCTGAGCCGGTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAGGAAAGATCTAATTATCATGGACCTG
CGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAG
CTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACCTTTGATCAG
CTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAATGATTGTAGATAAAATAGACGCGGATAAAGATGGGTTTGTGACGGAGGGGGAGCTG
AAATCCTGGATTAAGCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAATGGCAGGAGTTTGATATGAATCAAGACGGCTTA
ATCTCCTGGGATGAGTACAGAAACGTGACTTATGGCACTTACCTGGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGATGATG
GTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACCCTGAG
GAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTAT
ATTGGTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAG
AACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTG
GTCTATGAATCAGACCAAAACAAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTT
AACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCA
TCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAG
GTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTC
GTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGG
AGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTT
AAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACA
CAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAA
GATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGA

>In-frame_CALU_ENST00000479257_chr7_128407709_+_LAP3_ENST00000226299_chr4_17600079_+_2560nt
ATCCTGTGCTGTGGGGGCTACGAGGAAAGGACCTCCCACCCTCCCCCACTGAGCTGCCTTCCCAGTGATGAAAGAAAAAATGTAAAAGCC
TGAAAACCCTTCTTCTTGATTTTTAATTTTTTTTTTTCCCTCTAAGACCTTAACCACTCTGGATAGTATCACGGGGTATCAGTAGAGTGT
GCTAAACAGATGTGTACTCTGCAGCTTCTTTGCAGGTTTTTTGTCACATTTTTCAGTCAAGTGTTCCAGCTTTGTGCTTGTTCATTAGAG
TCACCTGTGACTACAGAGATTCTGAAAGTTTGAATCAGGGCCTGGGAATCTGTACTTTGAACAGTACTACAGGTGGTATTTATGCCTAGG
CAAGTATGGGAAACAACTGTGCAGAAGGATAAAGACGTTCTTATCTATGACTAGACCATCTGAATGATTTGGCCTTTGAAGGTGACTCAA
GGTTGAGCCTGGATGTTGGAGACTTGGTGCTATAGACCAAGGAAGCTGCCAAGTATTTCGCTGGTTCCTAATCTCATGAACATCAGAATC
ACCTGAAAAACATTTAAAGCTACGAATGTCTGAATTCAGCTTCAGAGACTCTAAATCAATAGGAGAAACTTAAAGCTTCCTAGATGATTC
TAATAACCAGCCATGTTTGAAGACCAGACCACCAATGCGTACAAGAAGTAAAGGATTTGGAGTCAACATTTAAACCTTGGTTCTTTCACT
TTTAATTCTTATGAACTTGGGCAAAAGGATTAAAATTCTACTTTGGTATCTTTTGAAAGAAAACAGAAAGTGGACATTTTAACTATAAGT
TTCTTATCAGCCTACAATCAGATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCC
TTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTT
GATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAG
ATTGTAAGTAAAATAGATGGCGACAAGGACGGGTTTGTCACTGTGGATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATT
TACGAGGATGTAGAGCGACAGTGGAAGGGGCATGACCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGC
TACGTTTTAGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAG
GATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAA
ACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGAT
GAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAA
GACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACT
GATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACA
GGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATT
GAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATT
GGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCA
GGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGT
TTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAA
ATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTT
CACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCC
TAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGGAACATGAGCAAACTGAAAATTA

>In-frame_CALU_ENST00000479257_chr7_128407709_+_LAP3_ENST00000606142_chr4_17600079_+_2526nt
ATCCTGTGCTGTGGGGGCTACGAGGAAAGGACCTCCCACCCTCCCCCACTGAGCTGCCTTCCCAGTGATGAAAGAAAAAATGTAAAAGCC
TGAAAACCCTTCTTCTTGATTTTTAATTTTTTTTTTTCCCTCTAAGACCTTAACCACTCTGGATAGTATCACGGGGTATCAGTAGAGTGT
GCTAAACAGATGTGTACTCTGCAGCTTCTTTGCAGGTTTTTTGTCACATTTTTCAGTCAAGTGTTCCAGCTTTGTGCTTGTTCATTAGAG
TCACCTGTGACTACAGAGATTCTGAAAGTTTGAATCAGGGCCTGGGAATCTGTACTTTGAACAGTACTACAGGTGGTATTTATGCCTAGG
CAAGTATGGGAAACAACTGTGCAGAAGGATAAAGACGTTCTTATCTATGACTAGACCATCTGAATGATTTGGCCTTTGAAGGTGACTCAA
GGTTGAGCCTGGATGTTGGAGACTTGGTGCTATAGACCAAGGAAGCTGCCAAGTATTTCGCTGGTTCCTAATCTCATGAACATCAGAATC
ACCTGAAAAACATTTAAAGCTACGAATGTCTGAATTCAGCTTCAGAGACTCTAAATCAATAGGAGAAACTTAAAGCTTCCTAGATGATTC
TAATAACCAGCCATGTTTGAAGACCAGACCACCAATGCGTACAAGAAGTAAAGGATTTGGAGTCAACATTTAAACCTTGGTTCTTTCACT
TTTAATTCTTATGAACTTGGGCAAAAGGATTAAAATTCTACTTTGGTATCTTTTGAAAGAAAACAGAAAGTGGACATTTTAACTATAAGT
TTCTTATCAGCCTACAATCAGATGAAGGAAACTGATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCC
TTTGCCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAATGATGCTCAGAGTTTT
GATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAG
ATTGTAAGTAAAATAGATGGCGACAAGGACGGGTTTGTCACTGTGGATGAGCTCAAAGACTGGATTAAATTTGCACAAAAGCGCTGGATT
TACGAGGATGTAGAGCGACAGTGGAAGGGGCATGACCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGC
TACGTTTTAGATGATCCAGATCCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTTAAAATGGCAGACAAG
GATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAA
ACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCATGATGGGAATACTGAT
GAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAA
GACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAACAAGGTTGATAACACT
GATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACA
GGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATT
GAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATT
GGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCA
GGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGT
TTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAA
ATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTT
CACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCC
TAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGGAACATGAGCAAACTGAAAATTA


Top

FusionGenePPI for CALU_LAP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CALUAPCS, AURKA, GAA, SARS2, TMEM256, FAF2, PTBP3, DBN1, EMC1, ICT1, TMEM165, RPL32, PRPH, PPT2, EGFR, RPL21, IARS2, PRKCDBP, CSNK2A1, ATF2, IQCB1, NOS2, CFTR, CLN3, CLN5, NPM1, HDAC11, CTNNAL1, UMPS, ZPBP, FBXO6, PARK2, PRMT5, AARS, AARSD1, ARPC1B, ARPC2, ARPC3, ARPC4, ARPC5L, ACTR2, ACTR3, ARPC1A, DUS3L, HARS, OSGEP, P4HB, PCNA, PDLIM5, PLIN3, UBA2, UBQLN2, WARS, DPP8, EEF2K, HSF1, IPO11, KIAA1279, MTR, NIF3L1, NSUN2, PRKACA, PRKAR1B, RANGAP1, TRMT10A, RPA2, RPRD1B, SAE1, SH3GL1, SH3GLB1, SH3GLB2, THG1L, TP53RK, TPD52L2, TPRKB, HSPA5, IRS4, CEP250, CEP76, UBQLN1, UBE2I, ARAF, ILK, IRAK1, LIMK2, MAST3, RAF1, OBSL1, CALR, CLGN, EIF2D, HSD17B10, MSN, NUCB2, PTGES3, RDX, TPD52, VCP, HSP90B1, HSPA4L, NACA2, TKT, NTRK1, TCTN3, TCTN1, XRCC3, GOLT1B, GTSE1, CNTROB, ASPM, BAG6, SUCO, MCM2, PTPN2, PTPRN, CDC25B, MTM1, MRPS7, HIC2, PTPN22, SSH3, TESLAP3DDA1, UBA5, TAB1, ISG15, APP, LIG4, AARSD1, AGFG1, ALAD, ARPC2, NIF3L1, OGT, SH3GL1, SH3GLB1, TPRKB, RAPGEF2, RNF2, FUBP1, MIF, PRDX1, PRDX2, TKT, VARS, NTRK1, TP53, NDUFS5, RAB7A, RBM39, ZCCHC17, U2AF2, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CALU_LAP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CALU_LAP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCALUC0027626Neoplasm Invasiveness1CTD_human