FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5327

FusionGeneSummary for CALR_BRD2

check button Fusion gene summary
Fusion gene informationFusion gene name: CALR_BRD2
Fusion gene ID: 5327
HgeneTgene
Gene symbol

CALR

BRD2

Gene ID

811

6046

Gene namecalreticulinbromodomain containing 2
SynonymsCRT|HEL-S-99n|RO|SSA|cC1qRBRD2-IT1|D6S113E|FSH|FSRG1|NAT|O27.1.1|RING3|RNF3
Cytomap

19p13.13

6p21.32

Type of geneprotein-codingprotein-coding
DescriptioncalreticulinCRP55ERp60HACBPSicca syndrome antigen A (autoantigen Ro; calreticulin)calregulinendoplasmic reticulum resident protein 60epididymis secretory sperm binding protein Li 99ngrp60bromodomain-containing protein 2BRD2 intronic transcript 1female sterile homeotic-related gene 1really interesting new gene 3 protein
Modification date2018052720180519
UniProtAcc

P27797

P25440

Ensembl transtripts involved in fusion geneENST00000316448, ENST00000374825, 
ENST00000496118, ENST00000580234, 
ENST00000374831, ENST00000395289, 
ENST00000443797, ENST00000395287, 
ENST00000449085, ENST00000438194, 
ENST00000466744, ENST00000383108, 
ENST00000547895, ENST00000549843, 
ENST00000442863, ENST00000552513, 
ENST00000442219, ENST00000498329, 
ENST00000488549, ENST00000425201, 
ENST00000399529, ENST00000399528, 
ENST00000550142, ENST00000548837, 
ENST00000399527, ENST00000549236, 
ENST00000482105, ENST00000414731, 
ENST00000449118, ENST00000550598, 
ENST00000479973, ENST00000546777, 
ENST00000450320, ENST00000547286, 
ENST00000552587, ENST00000549126, 
ENST00000553146, ENST00000448067, 
ENST00000436979, ENST00000466208, 
Fusion gene scores* DoF score7 X 9 X 5=3157 X 9 X 2=126
# samples 1210
** MAII scorelog2(12/315*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/126*10)=-0.333423733725192
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CALR [Title/Abstract] AND BRD2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCALR

GO:0000122

negative regulation of transcription by RNA polymerase II

8107809

HgeneCALR

GO:0006611

protein export from nucleus

11149926

HgeneCALR

GO:0017148

negative regulation of translation

14726956

HgeneCALR

GO:0033144

negative regulation of intracellular steroid hormone receptor signaling pathway

8107809

HgeneCALR

GO:0034504

protein localization to nucleus

15998798

HgeneCALR

GO:0045665

negative regulation of neuron differentiation

8107809

HgeneCALR

GO:0045892

negative regulation of transcription, DNA-templated

8107809

HgeneCALR

GO:0048387

negative regulation of retinoic acid receptor signaling pathway

8107809

TgeneBRD2

GO:0006357

regulation of transcription by RNA polymerase II

18406326


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-KK-A6E5-01ACALRchr19

13055304

+BRD2chr6

32944339

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000316448ENST00000374825CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000496118CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000580234CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000374831CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000395289CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000443797CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000395287CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000449085CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000438194CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000466744CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000383108CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000547895CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000549843CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000442863CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000552513CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000442219CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000498329CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000488549CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000425201CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000399529CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000399528CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000550142CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000548837CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000399527CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000549236CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000482105CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000414731CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000449118CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000550598CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000479973CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000546777CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000450320CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000547286CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000552587CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000549126CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000553146CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000448067CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000436979CALRchr19

13055304

+BRD2chr6

32944339

+
5CDS-intronENST00000316448ENST00000466208CALRchr19

13055304

+BRD2chr6

32944339

+

Top

FusionProtFeatures for CALR_BRD2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CALR

P27797

BRD2

P25440

Calcium-binding chaperone that promotes folding,oligomeric assembly and quality control in the endoplasmicreticulum (ER) via the calreticulin/calnexin cycle. This lectininteracts transiently with almost all of the monoglucosylatedglycoproteins that are synthesized in the ER. Interacts with theDNA-binding domain of NR3C1 and mediates its nuclear export.Involved in maternal gene expression regulation. May participatein oocyte maturation via the regulation of calcium homeostasis (Bysimilarity). {ECO:0000250, ECO:0000269|PubMed:11149926,ECO:0000269|PubMed:7876246}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99351_408610418Compositional biasNote=Asp/Glu/Lys-rich
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99414_417610418MotifNote=Prevents secretion from ER
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+9918_197610418RegionNote=N-domain
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99191_255610418RegionNote=4 X approximate repeats
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99198_308610418RegionNote=P-domain
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99259_297610418RegionNote=3 X approximate repeats
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99309_417610418RegionNote=C-domain
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99191_202610418RepeatNote=1-1
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99210_221610418RepeatNote=1-2
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99227_238610418RepeatNote=1-3
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99244_255610418RepeatNote=1-4
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99259_269610418RepeatNote=2-1
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99273_283610418RepeatNote=2-2
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99287_297610418RepeatNote=2-3
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513476_515275802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513492_506275802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513544_566275802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513551_559275802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513634_638275802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513775_793275802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513775_801275802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513476_515275802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513492_506275802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513544_566275802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513551_559275802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513634_638275802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513775_793275802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513775_801275802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013476_515-538802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013492_506-538802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013544_566-538802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013551_559-538802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+01361_64-538802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013634_638-538802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013775_793-538802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013775_801-538802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413476_515275837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413492_506275837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413544_566275837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413551_559275837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413634_638275837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413775_793275837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413775_801275837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514476_515275837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514492_506275837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514544_566275837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514551_559275837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514634_638275837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514775_793275837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514775_801275837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013476_515-57837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013492_506-57837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013544_566-57837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013551_559-57837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+01361_64-57837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013634_638-57837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013775_793-57837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013775_801-57837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013476_515-538802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013492_506-538802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013544_566-538802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013551_559-538802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+01361_64-538802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013634_638-538802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013775_793-538802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013775_801-538802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013476_515-567802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013492_506-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013544_566-567802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013551_559-567802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+01361_64-567802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013634_638-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013775_793-567802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013775_801-567802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013476_515-567802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013492_506-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013544_566-567802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013551_559-567802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+01361_64-567802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013634_638-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013775_793-567802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013775_801-567802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012476_515-53755Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012492_506-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012544_566-53755Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012551_559-53755Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+01261_64-53755Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012634_638-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012775_793-53755Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012775_801-53755Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013476_515-567802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013492_506-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013544_566-567802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013551_559-567802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+01361_64-567802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013634_638-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013775_793-567802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013775_801-567802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013476_515-57837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013492_506-57837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013544_566-57837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013551_559-57837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+01361_64-57837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013634_638-57837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013775_793-57837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013775_801-57837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013476_515-57837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013492_506-57837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013544_566-57837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013551_559-57837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+01361_64-57837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013634_638-57837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013775_793-57837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013775_801-57837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412476_515228755Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412492_506228755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412544_566228755Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412551_559228755Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412634_638228755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412775_793228755Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412775_801228755Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013476_515-538802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013492_506-538802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013544_566-538802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013551_559-538802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+01361_64-538802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013634_638-538802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013775_793-538802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013775_801-538802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012476_515-53755Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012492_506-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012544_566-53755Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012551_559-53755Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+01261_64-53755Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012634_638-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012775_793-53755Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012775_801-53755Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014476_515-534837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014492_506-534837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014544_566-534837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014551_559-534837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+01461_64-534837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014634_638-534837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014775_793-534837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014775_801-534837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015476_515-534837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015492_506-534837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015544_566-534837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015551_559-534837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+01561_64-534837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015634_638-534837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015775_793-534837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015775_801-534837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012476_515-53755Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012492_506-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012544_566-53755Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012551_559-53755Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+01261_64-53755Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012634_638-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012775_793-53755Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012775_801-53755Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014476_515-534837Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014492_506-534837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014544_566-534837Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014551_559-534837Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+01461_64-534837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014634_638-534837Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014775_793-534837Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014775_801-534837Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012476_515-53755Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012492_506-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012544_566-53755Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012551_559-53755Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+01261_64-53755Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012634_638-53755Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012775_793-53755Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012775_801-53755Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014476_515-567802Compositional biasNote=Glu/Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014492_506-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014544_566-567802Compositional biasNote=Arg/Lys-rich (highly basic)
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014551_559-567802Compositional biasNote=Poly-Lys
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+01461_64-567802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014634_638-567802Compositional biasNote=Poly-Glu
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014775_793-567802Compositional biasNote=Poly-Ser
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014775_801-567802Compositional biasNote=Ser-rich
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513364_436275802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513632_714275802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513364_436275802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513632_714275802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013364_436-538802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013632_714-538802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+01391_163-538802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413364_436275837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413632_714275837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514364_436275837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514632_714275837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013364_436-57837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013632_714-57837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+01391_163-57837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013364_436-538802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013632_714-538802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+01391_163-538802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013364_436-567802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013632_714-567802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+01391_163-567802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013364_436-567802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013632_714-567802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+01391_163-567802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012364_436-53755DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012632_714-53755DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+01291_163-53755DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013364_436-567802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013632_714-567802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+01391_163-567802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013364_436-57837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013632_714-57837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+01391_163-57837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013364_436-57837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013632_714-57837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+01391_163-57837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412364_436228755DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412632_714228755DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013364_436-538802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013632_714-538802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+01391_163-538802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012364_436-53755DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012632_714-53755DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+01291_163-53755DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014364_436-534837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014632_714-534837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+01491_163-534837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015364_436-534837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015632_714-534837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+01591_163-534837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012364_436-53755DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012632_714-53755DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+01291_163-53755DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014364_436-534837DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014632_714-534837DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+01491_163-534837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012364_436-53755DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012632_714-53755DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+01291_163-53755DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014364_436-567802DomainBromo 2
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014632_714-567802DomainNET
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+01491_163-567802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+513555_559275802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+513555_559275802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000383108+013555_559-538802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+413555_559275837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+514555_559275837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000399527+013555_559-57837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000399528+013555_559-538802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000399529+013555_559-567802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000414731+013555_559-567802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000436979+012555_559-53755MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000438194+013555_559-567802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000442863+013555_559-57837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000448067+013555_559-57837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+412555_559228755MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000449118+013555_559-538802MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000547286+012555_559-53755MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000547895+014555_559-534837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000549126+015555_559-534837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000549236+012555_559-53755MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000550142+014555_559-534837MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000552513+012555_559-53755MotifNuclear localization signal
TgeneBRD2chr19:13055304chr6:32944339ENST00000552587+014555_559-567802MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+51361_64275802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+51361_64275802Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+41361_64275837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+51461_64275837Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+41261_64228755Compositional biasNote=Poly-Pro
TgeneBRD2chr19:13055304chr6:32944339ENST00000374825+51391_163275802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000374831+51391_163275802DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000395287+41391_163275837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000395289+51491_163275837DomainBromo 1
TgeneBRD2chr19:13055304chr6:32944339ENST00000449085+41291_163228755DomainBromo 1


Top

FusionGeneSequence for CALR_BRD2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CALR_ENST00000316448_chr19_13055304_+_BRD2_ENST00000374825_chr6_32944339_+_1137aa
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFTALSASFEPFSNKGQT
LVVQFTVKHEQNIDCGGGTVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TTEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPE
YKGEWKPRQIDNPDYKGTWIHPEIDNPETSPDPSITATDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL_RGLPPGLD_GLSAPAAELAAPNNVSVRLENFH
FFPGWFGFGVDFGFVPLLHSPPPPPRPFFFFFLNWTFIFDSPSALTPGSHLS_STSFLASVPFSHLLAPLQPGGQWCGEATGLRFHLLSF
LEPRGGQQKGVVSPTPQH_GRTGLFSFHPSLSPLPPGLGHFWVGQWVPDWLTLRM_ELQTKFLLN_ILCLKKGVKRKADTTTPTPTAILA
PGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAATAWPFTKPVDASALGLHD
YHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCTKYNPPDHDVVAMARKLQDVFEFRTAKMPDEPLEPGPLPVSTAMPPGLAK
SSSESSSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKAEKHRG
RAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLPKKATKTAPPALPTGTDSEEEEESRPMSYDEKRQLSLDIN
KLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERTVLSCLRKKPRKPYTIKKPVGKTKEELALEKKRELEKRLQDVSG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CALR_ENST00000316448_chr19_13055304_+_BRD2_ENST00000374825_chr6_32944339_+_3411nt
ATGCTGCTATCCGTGCCGCTGCTGCTCGGCCTCCTCGGCCTGGCCGTCGCCGAGCCTGCCGTCTACTTCAAGGAGCAGTTTCTGGACGGA
GACGGGTGGACTTCCCGCTGGATCGAATCCAAACACAAGTCAGATTTTGGCAAATTCGTTCTCAGTTCCGGCAAGTTCTACGGTGACGAG
GAGAAAGATAAAGGTTTGCAGACAAGCCAGGATGCACGCTTTTATGCTCTGTCGGCCAGTTTCGAGCCTTTCAGCAACAAAGGCCAGACG
CTGGTGGTGCAGTTCACGGTGAAACATGAGCAGAACATCGACTGTGGGGGCGGCTATGTGAAGCTGTTTCCTAATAGTTTGGACCAGACA
GACATGCACGGAGACTCAGAATACAACATCATGTTTGGTCCCGACATCTGTGGCCCTGGCACCAAGAAGGTTCATGTCATCTTCAACTAC
AAGGGCAAGAACGTGCTGATCAACAAGGACATCCGTTGCAAGGATGATGAGTTTACACACCTGTACACACTGATTGTGCGGCCAGACAAC
ACCTATGAGGTGAAGATTGACAACAGCCAGGTGGAGTCCGGCTCCTTGGAAGACGATTGGGACTTCCTGCCACCCAAGAAGATAAAGGAT
CCTGATGCTTCAAAACCGGAAGACTGGGATGAGCGGGCCAAGATCGATGATCCCACAGACTCCAAGCCTGAGGACTGGGACAAGCCCGAG
CATATCCCTGACCCTGATGCTAAGAAGCCCGAGGACTGGGATGAAGAGATGGACGGAGAGTGGGAACCCCCAGTGATTCAGAACCCTGAG
TACAAGGGTGAGTGGAAGCCCCGGCAGATCGACAACCCAGATTACAAGGGCACTTGGATCCACCCAGAAATTGACAACCCCGAGTATTCT
CCCGATCCCAGTATCTATGCCTATGATAACTTTGGCGTGCTGGGCCTGGACCTCTGGCAGGTCAAGTCTGGCACCATCTTTGACAACTTC
CTCATCACCAACGATGAGGCATACGCTGAGGAGTTTGGCAACGAGACGTGGGGCGTAACAAAGGCAGCAGAGAAACAAATGAAGGACAAA
CAGGACGAGGAGCAGAGGCTTAAGGAGGAGGAAGAAGACAAGAAACGCAAAGAGGAGGAGGAGGCAGAGGACAAGGAGGATGATGAGGAC
AAAGATGAGGATGAGGAGGATGAGGAGGACAAGGAGGAAGATGAGGAGGAAGATGTCCCCGGCCAGGCCAAGGACGAGCTGTAGAGAGGC
CTGCCTCCAGGGCTGGACTGAGGCCTGAGCGCTCCTGCCGCAGAGCTGGCCGCGCCAAATAATGTCTCTGTGAGACTCGAGAACTTTCAT
TTTTTTCCAGGCTGGTTCGGATTTGGGGTGGATTTTGGTTTTGTTCCCCTCCTCCACTCTCCCCCACCCCCTCCCCGCCCTTTTTTTTTT
TTTTTTTTAAACTGGTATTTTATCTTTGATTCTCCTTCAGCCCTCACCCCTGGTTCTCATCTTTCTTGATCAACATCTTTTCTTGCCTCT
GTCCCCTTCTCTCATCTCTTAGCTCCCCTCCAACCTGGGGGGCAGTGGTGTGGAGAAGCCACAGGCCTGAGATTTCATCTGCTCTCCTTC
CTGGAGCCCAGAGGAGGGCAGCAGAAGGGGGTGGTGTCTCCAACCCCCCAGCACTGAGGAAGAACGGGGCTCTTCTCATTTCACCCCTCC
CTTTCTCCCCTGCCCCCAGGACTGGGCCACTTCTGGGTGGGGCAGTGGGTCCCAGATTGGCTCACACTGAGAATGTAAGAACTACAAACA
AAATTTCTATTAAATTAAATTTTGTGTCTCAAAAAAGGCGTAAAGCGGAAAGCAGATACTACCACCCCTACACCTACAGCCATCTTGGCT
CCTGGTTCTCCAGCTAGCCCTCCTGGGAGTCTTGAGCCTAAGGCAGCACGGCTTCCCCCTATGCGTAGAGAGAGTGGTCGCCCCATCAAG
CCCCCACGCAAAGACTTGCCTGACTCTCAGCAACAACACCAGAGCTCTAAGAAAGGAAAGCTTTCAGAACAGTTAAAACATTGCAATGGC
ATTTTGAAGGAGTTACTCTCTAAGAAGCATGCTGCCTATGCTTGGCCTTTCTATAAACCAGTGGATGCTTCTGCACTTGGCCTGCATGAC
TACCATGACATCATTAAGCACCCCATGGACCTCAGCACTGTCAAGCGGAAGATGGAGAACCGTGATTACCGGGATGCACAGGAGTTTGCT
GCTGATGTACGGCTTATGTTCTCCAACTGCTATAAGTACAATCCCCCAGATCACGATGTTGTGGCAATGGCACGAAAGCTACAGGATGTA
TTTGAGTTCCGTTATGCCAAGATGCCAGATGAACCACTAGAACCAGGGCCTTTACCAGTCTCTACTGCCATGCCCCCTGGCTTGGCCAAA
TCGTCTTCAGAGTCCTCCAGTGAGGAAAGTAGCAGTGAGAGCTCCTCTGAGGAAGAGGAGGAGGAAGATGAGGAGGACGAGGAGGAAGAA
GAGAGTGAAAGCTCAGACTCAGAGGAAGAAAGGGCTCATCGCTTAGCAGAACTACAGGAACAGCTTCGGGCAGTACATGAACAACTGGCT
GCTCTGTCCCAGGGTCCAATATCCAAGCCCAAGAGGAAAAGAGAGAAAAAAGAGAAAAAGAAGAAACGGAAGGCAGAGAAGCATCGAGGC
CGAGCTGGGGCCGATGAAGATGACAAGGGGCCTAGGGCACCCCGCCCACCTCAACCTAAGAAGTCCAAGAAAGCAAGTGGCAGTGGGGGT
GGCAGTGCTGCTTTAGGCCCTTCTGGCTTTGGACCTTCTGGAGGAAGTGGCACCAAGCTCCCCAAAAAGGCCACAAAGACAGCCCCACCT
GCCCTGCCTACAGGTTATGATTCAGAGGAGGAGGAAGAGAGCAGGCCCATGAGTTACGATGAGAAGCGGCAGCTGAGCCTGGACATCAAC
AAATTACCTGGGGAGAAGCTGGGCCGAGTTGTGCATATAATCCAAGCCAGGGAGCCCTCTTTACGTGATTCAAACCCAGAAGAGATTGAG
ATTGATTTTGAAACACTCAAGCCATCCACACTTAGAGAGCTTGAGCGCTATGTCCTTTCCTGCCTACGTAAGAAACCCCGGAAGCCCTAC
ACCATTAAGAAGCCTGTGGGAAAGACAAAGGAGGAACTGGCTTTGGAGAAAAAGCGGGAATTAGAAAAGCGGTTACAAGATGTCAGCGGA
CAGCTCAATTCTACTAAAAAGCCCCCCAAGAAAGCGAATGAGAAAACAGAGTCATCCTCTGCACAGCAAGTAGCAGTGTCACGCCTTAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CALR_ENST00000316448_chr19_13055304_+_BRD2_ENST00000374825_chr6_32944339_+_4271nt
CCGTCCGTACTGCAGAGCCGCTGCCGGAGGGTCGTTTTAAAGGGCCCGCGCGTTGCCGCCCCCTCGGCCCGCCATGCTGCTATCCGTGCC
GCTGCTGCTCGGCCTCCTCGGCCTGGCCGTCGCCGAGCCTGCCGTCTACTTCAAGGAGCAGTTTCTGGACGGAGACGGGTGGACTTCCCG
CTGGATCGAATCCAAACACAAGTCAGATTTTGGCAAATTCGTTCTCAGTTCCGGCAAGTTCTACGGTGACGAGGAGAAAGATAAAGGTTT
GCAGACAAGCCAGGATGCACGCTTTTATGCTCTGTCGGCCAGTTTCGAGCCTTTCAGCAACAAAGGCCAGACGCTGGTGGTGCAGTTCAC
GGTGAAACATGAGCAGAACATCGACTGTGGGGGCGGCTATGTGAAGCTGTTTCCTAATAGTTTGGACCAGACAGACATGCACGGAGACTC
AGAATACAACATCATGTTTGGTCCCGACATCTGTGGCCCTGGCACCAAGAAGGTTCATGTCATCTTCAACTACAAGGGCAAGAACGTGCT
GATCAACAAGGACATCCGTTGCAAGGATGATGAGTTTACACACCTGTACACACTGATTGTGCGGCCAGACAACACCTATGAGGTGAAGAT
TGACAACAGCCAGGTGGAGTCCGGCTCCTTGGAAGACGATTGGGACTTCCTGCCACCCAAGAAGATAAAGGATCCTGATGCTTCAAAACC
GGAAGACTGGGATGAGCGGGCCAAGATCGATGATCCCACAGACTCCAAGCCTGAGGACTGGGACAAGCCCGAGCATATCCCTGACCCTGA
TGCTAAGAAGCCCGAGGACTGGGATGAAGAGATGGACGGAGAGTGGGAACCCCCAGTGATTCAGAACCCTGAGTACAAGGGTGAGTGGAA
GCCCCGGCAGATCGACAACCCAGATTACAAGGGCACTTGGATCCACCCAGAAATTGACAACCCCGAGTATTCTCCCGATCCCAGTATCTA
TGCCTATGATAACTTTGGCGTGCTGGGCCTGGACCTCTGGCAGGTCAAGTCTGGCACCATCTTTGACAACTTCCTCATCACCAACGATGA
GGCATACGCTGAGGAGTTTGGCAACGAGACGTGGGGCGTAACAAAGGCAGCAGAGAAACAAATGAAGGACAAACAGGACGAGGAGCAGAG
GCTTAAGGAGGAGGAAGAAGACAAGAAACGCAAAGAGGAGGAGGAGGCAGAGGACAAGGAGGATGATGAGGACAAAGATGAGGATGAGGA
GGATGAGGAGGACAAGGAGGAAGATGAGGAGGAAGATGTCCCCGGCCAGGCCAAGGACGAGCTGTAGAGAGGCCTGCCTCCAGGGCTGGA
CTGAGGCCTGAGCGCTCCTGCCGCAGAGCTGGCCGCGCCAAATAATGTCTCTGTGAGACTCGAGAACTTTCATTTTTTTCCAGGCTGGTT
CGGATTTGGGGTGGATTTTGGTTTTGTTCCCCTCCTCCACTCTCCCCCACCCCCTCCCCGCCCTTTTTTTTTTTTTTTTTTAAACTGGTA
TTTTATCTTTGATTCTCCTTCAGCCCTCACCCCTGGTTCTCATCTTTCTTGATCAACATCTTTTCTTGCCTCTGTCCCCTTCTCTCATCT
CTTAGCTCCCCTCCAACCTGGGGGGCAGTGGTGTGGAGAAGCCACAGGCCTGAGATTTCATCTGCTCTCCTTCCTGGAGCCCAGAGGAGG
GCAGCAGAAGGGGGTGGTGTCTCCAACCCCCCAGCACTGAGGAAGAACGGGGCTCTTCTCATTTCACCCCTCCCTTTCTCCCCTGCCCCC
AGGACTGGGCCACTTCTGGGTGGGGCAGTGGGTCCCAGATTGGCTCACACTGAGAATGTAAGAACTACAAACAAAATTTCTATTAAATTA
AATTTTGTGTCTCAAAAAAGGCGTAAAGCGGAAAGCAGATACTACCACCCCTACACCTACAGCCATCTTGGCTCCTGGTTCTCCAGCTAG
CCCTCCTGGGAGTCTTGAGCCTAAGGCAGCACGGCTTCCCCCTATGCGTAGAGAGAGTGGTCGCCCCATCAAGCCCCCACGCAAAGACTT
GCCTGACTCTCAGCAACAACACCAGAGCTCTAAGAAAGGAAAGCTTTCAGAACAGTTAAAACATTGCAATGGCATTTTGAAGGAGTTACT
CTCTAAGAAGCATGCTGCCTATGCTTGGCCTTTCTATAAACCAGTGGATGCTTCTGCACTTGGCCTGCATGACTACCATGACATCATTAA
GCACCCCATGGACCTCAGCACTGTCAAGCGGAAGATGGAGAACCGTGATTACCGGGATGCACAGGAGTTTGCTGCTGATGTACGGCTTAT
GTTCTCCAACTGCTATAAGTACAATCCCCCAGATCACGATGTTGTGGCAATGGCACGAAAGCTACAGGATGTATTTGAGTTCCGTTATGC
CAAGATGCCAGATGAACCACTAGAACCAGGGCCTTTACCAGTCTCTACTGCCATGCCCCCTGGCTTGGCCAAATCGTCTTCAGAGTCCTC
CAGTGAGGAAAGTAGCAGTGAGAGCTCCTCTGAGGAAGAGGAGGAGGAAGATGAGGAGGACGAGGAGGAAGAAGAGAGTGAAAGCTCAGA
CTCAGAGGAAGAAAGGGCTCATCGCTTAGCAGAACTACAGGAACAGCTTCGGGCAGTACATGAACAACTGGCTGCTCTGTCCCAGGGTCC
AATATCCAAGCCCAAGAGGAAAAGAGAGAAAAAAGAGAAAAAGAAGAAACGGAAGGCAGAGAAGCATCGAGGCCGAGCTGGGGCCGATGA
AGATGACAAGGGGCCTAGGGCACCCCGCCCACCTCAACCTAAGAAGTCCAAGAAAGCAAGTGGCAGTGGGGGTGGCAGTGCTGCTTTAGG
CCCTTCTGGCTTTGGACCTTCTGGAGGAAGTGGCACCAAGCTCCCCAAAAAGGCCACAAAGACAGCCCCACCTGCCCTGCCTACAGGTTA
TGATTCAGAGGAGGAGGAAGAGAGCAGGCCCATGAGTTACGATGAGAAGCGGCAGCTGAGCCTGGACATCAACAAATTACCTGGGGAGAA
GCTGGGCCGAGTTGTGCATATAATCCAAGCCAGGGAGCCCTCTTTACGTGATTCAAACCCAGAAGAGATTGAGATTGATTTTGAAACACT
CAAGCCATCCACACTTAGAGAGCTTGAGCGCTATGTCCTTTCCTGCCTACGTAAGAAACCCCGGAAGCCCTACACCATTAAGAAGCCTGT
GGGAAAGACAAAGGAGGAACTGGCTTTGGAGAAAAAGCGGGAATTAGAAAAGCGGTTACAAGATGTCAGCGGACAGCTCAATTCTACTAA
AAAGCCCCCCAAGAAAGCGAATGAGAAAACAGAGTCATCCTCTGCACAGCAAGTAGCAGTGTCACGCCTTAGCGCTTCCAGCTCCAGCTC
AGATTCCAGCTCCTCCTCTTCCTCGTCGTCGTCTTCAGACACCAGTGATTCAGACTCAGGCTAAGGGGTCAGGCCAGATGGGGCAGGAAG
GCTCCGCAGGACCGGACCCCTAGACCACCCTGCCCCACCTGCCCCTTCCCCCTTTGCTGTGACACTTCTTCATCTCACCCCCCCCCGCCC
CCCTCTAGGAGAGCTGGCTCTGCAGTGGGGGAGGGATGCAGGGACATTTACTGAAGGAGGGACATGGACAAAACAACATTGAATTCCCAG
CCCCATTGGGGAGTGATCTCTTGGACACAGAGCCCCCATTCAAAATGGGGCAGGGCAAGGGTGGGAGTGTGCAAAGCCCTGATCTGGAGT
TACCTGAGGCCACAGCTGCCCTATTCACTTCTAAGGGCCCTGTTTTGAGATTGTTTGTTCTAATTTATTTTAAGCTAGGTAAGGCTGGGG
GGAGGGTGGGGCCGTGGTCCCCTCAGCCTCCATGGGGAGGGAAGAAGGGGGAGCTCTTTTTTTACGTTGATTTTTTTTTTTCTACTCTGT
TTTCCCTTTTTCCTTCCGCTCCATTTGGGGCCCTGGGGGTTTCAGTCATCTCCCCATTTGGTCCCCTGGACTGTCTTTGTTGATTCTAAC
TTGTAAATAAAGAAAATATTATTCAAGTTTTGAGTTACCTTAATATTTGCTTTTGTAGTGTTTCAAAAGGAACATCATAAGAATTGTCTT
GATAATTTTGAGGGAAATATTACTGCAGTGAGAAAAGGCAATAGCTAACCTATAATTGGATTGTCTTAATTTTTAAACCAGTAGGCTTTT


Top

FusionGenePPI for CALR_BRD2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CALRCD40, ELF3, EPB41, LRP1, PLAT, MBL2, PDIA3, CANX, PRF1, FGB, APP, CD1D, APOB, TAPBP, VWF, AR, F5, NR3C1, TF, SLC6A4, NKX2-1, SLC2A1, H2AFX, PSMA3, LRIF1, SMARCB1, MAPK6, TAP1, ELAVL1, SIRT7, CDK2, GRK5, KCNH2, PRKCSH, GANAB, KRT17, HSP90B1, P4HB, HLA-E, LPL, ATF2, MTNR1A, ITGA3, HLA-A, CALR, CLN5, SOX2, SLC27A2, UPF2, PARK2, AARSD1, ACTR2, ANP32B, ARPC1B, ARPC3, ARPC1A, ARPC5, EEF2K, LPP, RPA3, SH3GLB1, NSUN2, PFDN5, PRKACA, RPA1, SH3GL1, THG1L, TPD52L2, LGR4, HUWE1, CUL7, SUZ12, RNF2, EGFR, INHA, NTM, HSPB1, ATP5B, CALU, EEF2, ENO1, ENO2, ENO3, EZR, HNRNPU, HSP90AB1, MATR3, MSN, PTGES3, RCN1, RDX, TKT, TPT1, VCP, WDR1, YWHAE, MAPRE3, NACA2, PCNA, NTRK1, KRAS, TSHR, PLP1, EWSR1, TCTN3, CNTRL, TCTN1, PPME1, F8, B2M, UBE3A, MCM2, RNY3, RNY1, RNY4, TRIM21, U2AF2, CDC73, HYPK, PTPRN, ACP5, DUSP13, SFRP4, WNT7A, CHI3L1, BMP4, PTPN22, PTPRO, TCTN2, EDEM3, HLA-B, TRIM25BRD2E2F2, E2F1, BRD2, HIST1H4A, TBP, TERF2, HIST2H2BE, BRD4, ELAVL1, BRD7, CSNK2A2, OBSL1, FAM90A1, DENND2D, RUVBL2, HIST1H2BG, HIST1H3A, BAG1, CSNK2A1, CSNK2B, EPB41L1, POLR2B, BRPF1, TAGLN2, COX5A, FARP1, TADA3, WHSC1L1, PWWP2B, CDC5L, CDC14B, BRD3, PIP4K2A, CAMKV, PES1, EPB41L5, MDK, INO80B, AR, ERG, SPOP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneCALRchr19:13055304chr6:32944339ENST00000316448+99237_270610418PPIB


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CALR_BRD2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCALRP27797DB00031TenecteplaseCalreticulinbiotechapproved
HgeneCALRP27797DB11093Calcium CitrateCalreticulinsmall moleculeapproved
HgeneCALRP27797DB11348Calcium PhosphateCalreticulinsmall moleculeapproved
HgeneCALRP27797DB00025Antihemophilic factor, human recombinantCalreticulinbiotechapproved|investigational
HgeneCALRP27797DB01065MelatoninCalreticulinsmall moleculeapproved|nutraceutical|vet_approved

Top

RelatedDiseases for CALR_BRD2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCALRC0033975Psychotic Disorders2PSYGENET
HgeneCALRC0036337Schizoaffective Disorder2PSYGENET
HgeneCALRC0349204Nonorganic psychosis2PSYGENET
HgeneCALRC0005586Bipolar Disorder1PSYGENET
HgeneCALRC0009404Colorectal Neoplasms1CTD_human
HgeneCALRC0025205Melanoma, Experimental1CTD_human
HgeneCALRC0027626Neoplasm Invasiveness1CTD_human
HgeneCALRC0033578Prostatic Neoplasms1CTD_human
HgeneCALRC0033937Psychoses, Drug1PSYGENET
HgeneCALRC0036349Paranoid Schizophrenia1PSYGENET
HgeneCALRC0036939Shared Paranoid Disorder1PSYGENET
HgeneCALRC0151744Myocardial Ischemia1CTD_human
HgeneCALRC0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneBRD2C0017636Glioblastoma1CTD_human
TgeneBRD2C0025149Medulloblastoma1CTD_human