FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5269

FusionGeneSummary for CADPS2_LMOD2

check button Fusion gene summary
Fusion gene informationFusion gene name: CADPS2_LMOD2
Fusion gene ID: 5269
HgeneTgene
Gene symbol

CADPS2

LMOD2

Gene ID

93664

442721

Gene namecalcium dependent secretion activator 2leiomodin 2
SynonymsCAPS2C-LMOD|CLMOD
Cytomap

7q31.32

7q31.32

Type of geneprotein-codingprotein-coding
Descriptioncalcium-dependent secretion activator 2CAPS-2Ca++-dependent secretion activator 2Ca2+ dependent secretion activator 2Ca2+-dependent activator protein for secretion 2calcium-dependent activator protein for secretion 2leiomodin-2cardiac leiomodinleiomodin 2 (cardiac)
Modification date2018051920180523
UniProtAcc

Q86UW7

Q6P5Q4

Ensembl transtripts involved in fusion geneENST00000313070, ENST00000334010, 
ENST00000412584, ENST00000449022, 
ENST00000476131, 
ENST00000458573, 
ENST00000456238, 
Fusion gene scores* DoF score6 X 5 X 5=1502 X 1 X 2=4
# samples 62
** MAII scorelog2(6/150*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: CADPS2 [Title/Abstract] AND LMOD2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneLMOD2

GO:0030838

positive regulation of actin filament polymerization

26370058

TgeneLMOD2

GO:0045010

actin nucleation

20685966|26370058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A1-A0SN-01ACADPS2chr7

122526053

-LMOD2chr7

123301914

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000313070ENST00000458573CADPS2chr7

122526053

-LMOD2chr7

123301914

+
5CDS-intronENST00000313070ENST00000456238CADPS2chr7

122526053

-LMOD2chr7

123301914

+
In-frameENST00000334010ENST00000458573CADPS2chr7

122526053

-LMOD2chr7

123301914

+
5CDS-intronENST00000334010ENST00000456238CADPS2chr7

122526053

-LMOD2chr7

123301914

+
In-frameENST00000412584ENST00000458573CADPS2chr7

122526053

-LMOD2chr7

123301914

+
5CDS-intronENST00000412584ENST00000456238CADPS2chr7

122526053

-LMOD2chr7

123301914

+
In-frameENST00000449022ENST00000458573CADPS2chr7

122526053

-LMOD2chr7

123301914

+
5CDS-intronENST00000449022ENST00000456238CADPS2chr7

122526053

-LMOD2chr7

123301914

+
intron-3CDSENST00000476131ENST00000458573CADPS2chr7

122526053

-LMOD2chr7

123301914

+
intron-intronENST00000476131ENST00000456238CADPS2chr7

122526053

-LMOD2chr7

123301914

+

Top

FusionProtFeatures for CADPS2_LMOD2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CADPS2

Q86UW7

LMOD2

Q6P5Q4

Mediates nucleation of actin filaments and therebypromotes actin polymerization (PubMed:18403713, PubMed:26370058,PubMed:25250574, PubMed:26417072). Plays a role in the regulationof actin filament length (By similarity). Required for normalsarcomere organization in the heart, and for normal heart function(PubMed:18403713). {ECO:0000250|UniProtKB:Q3UHZ5,ECO:0000269|PubMed:18403713, ECO:0000269|PubMed:25250574,ECO:0000269|PubMed:26370058, ECO:0000269|PubMed:26417072}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+03113_14891548Coiled coilOntology_term=ECO:0000255
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+03385_45091548Compositional biasNote=Pro-rich
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+03478_48791548Compositional biasNote=Poly-Lys

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCADPS2chr7:122526053chr7:123301914ENST00000412584-128367_4471131256DomainNote=C2
HgeneCADPS2chr7:122526053chr7:123301914ENST00000412584-128487_5901131256DomainPH
HgeneCADPS2chr7:122526053chr7:123301914ENST00000412584-128885_10561131256DomainMHD1
HgeneCADPS2chr7:122526053chr7:123301914ENST00000449022-130367_4471131297DomainNote=C2
HgeneCADPS2chr7:122526053chr7:123301914ENST00000449022-130487_5901131297DomainPH
HgeneCADPS2chr7:122526053chr7:123301914ENST00000449022-130885_10561131297DomainMHD1
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+0316_4191548Coiled coilOntology_term=ECO:0000255
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+0314_14291548Compositional biasNote=Glu-rich


Top

FusionGeneSequence for CADPS2_LMOD2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CADPS2_ENST00000313070_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_570aa
MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPSPSVLSEGRDEPQRQLDDEQERRIRLQLYVF
VVRCIAYPFNAKQPTDMARRQQKVAEDKEESEEELIFTESNSEVSEEVYTEEEEEESQEEEEEEDSDEEERTIETAKGINGTVNYDSVNS
DNSKPKIFKSQIENINLTNGSNGRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLTRFAEALKDNTVVKTFSLA
NTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTELRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELP
GPRMSMTSILTRNMDKQRQKRLQEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVATPPPPPPPP
PPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQKKKKGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQ

>In-frame_CADPS2_ENST00000334010_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_570aa
MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPSPSVLSEGRDEPQRQLDDEQERRIRLQLYVF
VVRCIAYPFNAKQPTDMARRQQKVAEDKEESEEELIFTESNSEVSEEVYTEEEEEESQEEEEEEDSDEEERTIETAKGINGTVNYDSVNS
DNSKPKIFKSQIENINLTNGSNGRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLTRFAEALKDNTVVKTFSLA
NTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTELRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELP
GPRMSMTSILTRNMDKQRQKRLQEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVATPPPPPPPP
PPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQKKKKGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQ

>In-frame_CADPS2_ENST00000412584_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_570aa
MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPSPSVLSEGRDEPQRQLDDEQERRIRLQLYVF
VVRCIAYPFNAKQPTDMARRQQKVAEDKEESEEELIFTESNSEVSEEVYTEEEEEESQEEEEEEDSDEEERTIETAKGINGTVNYDSVNS
DNSKPKIFKSQIENINLTNGSNGRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLTRFAEALKDNTVVKTFSLA
NTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTELRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELP
GPRMSMTSILTRNMDKQRQKRLQEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVATPPPPPPPP
PPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQKKKKGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQ

>In-frame_CADPS2_ENST00000449022_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_570aa
MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPSPSVLSEGRDEPQRQLDDEQERRIRLQLYVF
VVRCIAYPFNAKQPTDMARRQQKVAEDKEESEEELIFTESNSEVSEEVYTEEEEEESQEEEEEEDSDEEERTIETAKGINGTVNYDSVNS
DNSKPKIFKSQIENINLTNGSNGRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLTRFAEALKDNTVVKTFSLA
NTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTELRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELP
GPRMSMTSILTRNMDKQRQKRLQEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVATPPPPPPPP
PPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQKKKKGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CADPS2_ENST00000313070_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_1710nt
ATGCTGGACCCGTCTTCCAGCGAAGAGGAGTCGGACGAGGGGCTGGAAGAGGAAAGCCGCGATGTGCTGGTGGCAGCCGGCAGCTCGCAG
CGAGCTCCTCCAGCCCCGACTCGGGAAGGGCGGCGGGACGCGCCGGGGCGCGCGGGCGGCGGCGGCGCGGCCAGATCTGTGAGCCCGAGC
CCCTCTGTGCTCAGCGAGGGGCGAGACGAGCCCCAGCGGCAGCTGGACGATGAGCAGGAGCGGAGGATCCGCCTGCAGCTCTACGTCTTC
GTCGTGAGGTGCATCGCGTACCCCTTCAACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGGTTGCAGAAGACAAAGAGGAA
AGTGAAGAAGAGCTTATCTTTACTGAAAGTAACAGTGAGGTTTCTGAGGAAGTGTATACAGAGGAGGAGGAGGAGGAGTCCCAGGAGGAA
GAGGAGGAAGAAGACAGTGACGAAGAGGAAAGAACAATTGAAACTGCAAAAGGGATTAATGGAACTGTAAATTATGATAGTGTCAATTCT
GACAACTCTAAGCCAAAGATATTTAAAAGTCAAATAGAGAACATAAATTTGACCAATGGCAGCAATGGGAGGAACACAGAGTCCCCAGCT
GCCATTCACCCTTGTGGAAATCCTACAGTGATTGAGGACGCTTTGGACAAGATTAAAAGCAATGACCCTGACACCACAGAAGTCAATTTG
AACAACATTGAGAACATCACAACACAGACCCTTACCCGCTTTGCTGAAGCCCTCAAGGACAACACTGTGGTGAAGACGTTCAGTCTGGCC
AACACGCATGCCGACGACAGTGCAGCCATGGCCATTGCAGAGATGCTCAAAGTCAATGAGCACATCACCAACGTAAACGTCGAGTCCAAC
TTCATAACGGGAAAGGGGATCCTGGCCATCATGAGAGCTCTCCAGCACAACACGGTGCTCACGGAGCTGCGTTTCCATAACCAGAGGCAC
ATCATGGGCAGCCAGGTGGAAATGGAGATTGTCAAGCTGCTGAAGGAGAACACGACGCTGCTGAGGCTGGGATACCATTTTGAACTCCCA
GGACCAAGAATGAGCATGACGAGCATTTTGACAAGAAATATGGATAAACAGAGGCAAAAACGTTTGCAGGAGCAAAAACAGCAGGAGGGA
TACGATGGAGGACCCAATCTTAGGACCAAAGTCTGGCAAAGAGGAACACCTAGCTCTTCACCTTATGTATCTCCCAGGCACTCACCCTGG
TCATCCCCAAAACTCCCCAAAAAAGTCCAGACTGTGAGGAGCCGTCCTCTGTCTCCTGTGGCCACACCTCCTCCTCCTCCCCCTCCTCCT
CCTCCTCCCCCTCCTTCTTCCCAAAGGCTGCCACCACCTCCTCCTCCTCCCCCTCCTCCACTCCCAGAGAAAAAGCTCATTACCAGAAAC
ATTGCAGAAGTCATCAAACAACAGGAGAGTGCCCAACGGGCATTACAAAATGGACAAAAAAAGAAAAAAGGGAAAAAGGTCAAGAAACAG
CCAAACAGTATTCTAAAGGAAATAAAAAATTCTCTGAGGTCAGTGCAAGAGAAGAAAATGGAAGACAGTTCCCGACCTTCTACCCCACAG
AGATCAGCTCATGAGAATCTCATGGAAGCAATTCGGGGAAGCAGCATAAAACAGCTAAAGCGGGTGGAAGTTCCAGAAGCCCTGCGATAA

>In-frame_CADPS2_ENST00000334010_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_1710nt
ATGCTGGACCCGTCTTCCAGCGAAGAGGAGTCGGACGAGGGGCTGGAAGAGGAAAGCCGCGATGTGCTGGTGGCAGCCGGCAGCTCGCAG
CGAGCTCCTCCAGCCCCGACTCGGGAAGGGCGGCGGGACGCGCCGGGGCGCGCGGGCGGCGGCGGCGCGGCCAGATCTGTGAGCCCGAGC
CCCTCTGTGCTCAGCGAGGGGCGAGACGAGCCCCAGCGGCAGCTGGACGATGAGCAGGAGCGGAGGATCCGCCTGCAGCTCTACGTCTTC
GTCGTGAGGTGCATCGCGTACCCCTTCAACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGGTTGCAGAAGACAAAGAGGAA
AGTGAAGAAGAGCTTATCTTTACTGAAAGTAACAGTGAGGTTTCTGAGGAAGTGTATACAGAGGAGGAGGAGGAGGAGTCCCAGGAGGAA
GAGGAGGAAGAAGACAGTGACGAAGAGGAAAGAACAATTGAAACTGCAAAAGGGATTAATGGAACTGTAAATTATGATAGTGTCAATTCT
GACAACTCTAAGCCAAAGATATTTAAAAGTCAAATAGAGAACATAAATTTGACCAATGGCAGCAATGGGAGGAACACAGAGTCCCCAGCT
GCCATTCACCCTTGTGGAAATCCTACAGTGATTGAGGACGCTTTGGACAAGATTAAAAGCAATGACCCTGACACCACAGAAGTCAATTTG
AACAACATTGAGAACATCACAACACAGACCCTTACCCGCTTTGCTGAAGCCCTCAAGGACAACACTGTGGTGAAGACGTTCAGTCTGGCC
AACACGCATGCCGACGACAGTGCAGCCATGGCCATTGCAGAGATGCTCAAAGTCAATGAGCACATCACCAACGTAAACGTCGAGTCCAAC
TTCATAACGGGAAAGGGGATCCTGGCCATCATGAGAGCTCTCCAGCACAACACGGTGCTCACGGAGCTGCGTTTCCATAACCAGAGGCAC
ATCATGGGCAGCCAGGTGGAAATGGAGATTGTCAAGCTGCTGAAGGAGAACACGACGCTGCTGAGGCTGGGATACCATTTTGAACTCCCA
GGACCAAGAATGAGCATGACGAGCATTTTGACAAGAAATATGGATAAACAGAGGCAAAAACGTTTGCAGGAGCAAAAACAGCAGGAGGGA
TACGATGGAGGACCCAATCTTAGGACCAAAGTCTGGCAAAGAGGAACACCTAGCTCTTCACCTTATGTATCTCCCAGGCACTCACCCTGG
TCATCCCCAAAACTCCCCAAAAAAGTCCAGACTGTGAGGAGCCGTCCTCTGTCTCCTGTGGCCACACCTCCTCCTCCTCCCCCTCCTCCT
CCTCCTCCCCCTCCTTCTTCCCAAAGGCTGCCACCACCTCCTCCTCCTCCCCCTCCTCCACTCCCAGAGAAAAAGCTCATTACCAGAAAC
ATTGCAGAAGTCATCAAACAACAGGAGAGTGCCCAACGGGCATTACAAAATGGACAAAAAAAGAAAAAAGGGAAAAAGGTCAAGAAACAG
CCAAACAGTATTCTAAAGGAAATAAAAAATTCTCTGAGGTCAGTGCAAGAGAAGAAAATGGAAGACAGTTCCCGACCTTCTACCCCACAG
AGATCAGCTCATGAGAATCTCATGGAAGCAATTCGGGGAAGCAGCATAAAACAGCTAAAGCGGGTGGAAGTTCCAGAAGCCCTGCGATAA

>In-frame_CADPS2_ENST00000412584_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_1710nt
ATGCTGGACCCGTCTTCCAGCGAAGAGGAGTCGGACGAGGGGCTGGAAGAGGAAAGCCGCGATGTGCTGGTGGCAGCCGGCAGCTCGCAG
CGAGCTCCTCCAGCCCCGACTCGGGAAGGGCGGCGGGACGCGCCGGGGCGCGCGGGCGGCGGCGGCGCGGCCAGATCTGTGAGCCCGAGC
CCCTCTGTGCTCAGCGAGGGGCGAGACGAGCCCCAGCGGCAGCTGGACGATGAGCAGGAGCGGAGGATCCGCCTGCAGCTCTACGTCTTC
GTCGTGAGGTGCATCGCGTACCCCTTCAACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGGTTGCAGAAGACAAAGAGGAA
AGTGAAGAAGAGCTTATCTTTACTGAAAGTAACAGTGAGGTTTCTGAGGAAGTGTATACAGAGGAGGAGGAGGAGGAGTCCCAGGAGGAA
GAGGAGGAAGAAGACAGTGACGAAGAGGAAAGAACAATTGAAACTGCAAAAGGGATTAATGGAACTGTAAATTATGATAGTGTCAATTCT
GACAACTCTAAGCCAAAGATATTTAAAAGTCAAATAGAGAACATAAATTTGACCAATGGCAGCAATGGGAGGAACACAGAGTCCCCAGCT
GCCATTCACCCTTGTGGAAATCCTACAGTGATTGAGGACGCTTTGGACAAGATTAAAAGCAATGACCCTGACACCACAGAAGTCAATTTG
AACAACATTGAGAACATCACAACACAGACCCTTACCCGCTTTGCTGAAGCCCTCAAGGACAACACTGTGGTGAAGACGTTCAGTCTGGCC
AACACGCATGCCGACGACAGTGCAGCCATGGCCATTGCAGAGATGCTCAAAGTCAATGAGCACATCACCAACGTAAACGTCGAGTCCAAC
TTCATAACGGGAAAGGGGATCCTGGCCATCATGAGAGCTCTCCAGCACAACACGGTGCTCACGGAGCTGCGTTTCCATAACCAGAGGCAC
ATCATGGGCAGCCAGGTGGAAATGGAGATTGTCAAGCTGCTGAAGGAGAACACGACGCTGCTGAGGCTGGGATACCATTTTGAACTCCCA
GGACCAAGAATGAGCATGACGAGCATTTTGACAAGAAATATGGATAAACAGAGGCAAAAACGTTTGCAGGAGCAAAAACAGCAGGAGGGA
TACGATGGAGGACCCAATCTTAGGACCAAAGTCTGGCAAAGAGGAACACCTAGCTCTTCACCTTATGTATCTCCCAGGCACTCACCCTGG
TCATCCCCAAAACTCCCCAAAAAAGTCCAGACTGTGAGGAGCCGTCCTCTGTCTCCTGTGGCCACACCTCCTCCTCCTCCCCCTCCTCCT
CCTCCTCCCCCTCCTTCTTCCCAAAGGCTGCCACCACCTCCTCCTCCTCCCCCTCCTCCACTCCCAGAGAAAAAGCTCATTACCAGAAAC
ATTGCAGAAGTCATCAAACAACAGGAGAGTGCCCAACGGGCATTACAAAATGGACAAAAAAAGAAAAAAGGGAAAAAGGTCAAGAAACAG
CCAAACAGTATTCTAAAGGAAATAAAAAATTCTCTGAGGTCAGTGCAAGAGAAGAAAATGGAAGACAGTTCCCGACCTTCTACCCCACAG
AGATCAGCTCATGAGAATCTCATGGAAGCAATTCGGGGAAGCAGCATAAAACAGCTAAAGCGGGTGGAAGTTCCAGAAGCCCTGCGATAA

>In-frame_CADPS2_ENST00000449022_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_1710nt
ATGCTGGACCCGTCTTCCAGCGAAGAGGAGTCGGACGAGGGGCTGGAAGAGGAAAGCCGCGATGTGCTGGTGGCAGCCGGCAGCTCGCAG
CGAGCTCCTCCAGCCCCGACTCGGGAAGGGCGGCGGGACGCGCCGGGGCGCGCGGGCGGCGGCGGCGCGGCCAGATCTGTGAGCCCGAGC
CCCTCTGTGCTCAGCGAGGGGCGAGACGAGCCCCAGCGGCAGCTGGACGATGAGCAGGAGCGGAGGATCCGCCTGCAGCTCTACGTCTTC
GTCGTGAGGTGCATCGCGTACCCCTTCAACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGGTTGCAGAAGACAAAGAGGAA
AGTGAAGAAGAGCTTATCTTTACTGAAAGTAACAGTGAGGTTTCTGAGGAAGTGTATACAGAGGAGGAGGAGGAGGAGTCCCAGGAGGAA
GAGGAGGAAGAAGACAGTGACGAAGAGGAAAGAACAATTGAAACTGCAAAAGGGATTAATGGAACTGTAAATTATGATAGTGTCAATTCT
GACAACTCTAAGCCAAAGATATTTAAAAGTCAAATAGAGAACATAAATTTGACCAATGGCAGCAATGGGAGGAACACAGAGTCCCCAGCT
GCCATTCACCCTTGTGGAAATCCTACAGTGATTGAGGACGCTTTGGACAAGATTAAAAGCAATGACCCTGACACCACAGAAGTCAATTTG
AACAACATTGAGAACATCACAACACAGACCCTTACCCGCTTTGCTGAAGCCCTCAAGGACAACACTGTGGTGAAGACGTTCAGTCTGGCC
AACACGCATGCCGACGACAGTGCAGCCATGGCCATTGCAGAGATGCTCAAAGTCAATGAGCACATCACCAACGTAAACGTCGAGTCCAAC
TTCATAACGGGAAAGGGGATCCTGGCCATCATGAGAGCTCTCCAGCACAACACGGTGCTCACGGAGCTGCGTTTCCATAACCAGAGGCAC
ATCATGGGCAGCCAGGTGGAAATGGAGATTGTCAAGCTGCTGAAGGAGAACACGACGCTGCTGAGGCTGGGATACCATTTTGAACTCCCA
GGACCAAGAATGAGCATGACGAGCATTTTGACAAGAAATATGGATAAACAGAGGCAAAAACGTTTGCAGGAGCAAAAACAGCAGGAGGGA
TACGATGGAGGACCCAATCTTAGGACCAAAGTCTGGCAAAGAGGAACACCTAGCTCTTCACCTTATGTATCTCCCAGGCACTCACCCTGG
TCATCCCCAAAACTCCCCAAAAAAGTCCAGACTGTGAGGAGCCGTCCTCTGTCTCCTGTGGCCACACCTCCTCCTCCTCCCCCTCCTCCT
CCTCCTCCCCCTCCTTCTTCCCAAAGGCTGCCACCACCTCCTCCTCCTCCCCCTCCTCCACTCCCAGAGAAAAAGCTCATTACCAGAAAC
ATTGCAGAAGTCATCAAACAACAGGAGAGTGCCCAACGGGCATTACAAAATGGACAAAAAAAGAAAAAAGGGAAAAAGGTCAAGAAACAG
CCAAACAGTATTCTAAAGGAAATAAAAAATTCTCTGAGGTCAGTGCAAGAGAAGAAAATGGAAGACAGTTCCCGACCTTCTACCCCACAG
AGATCAGCTCATGAGAATCTCATGGAAGCAATTCGGGGAAGCAGCATAAAACAGCTAAAGCGGGTGGAAGTTCCAGAAGCCCTGCGATAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CADPS2_ENST00000313070_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_2677nt
ATTCAATTCCACGTGTTGCTTGTTGTAGGCGCCACAGGTTCCCCACCTGCGTCCGGGCGCTCGGGCGGCTCCGCCTCTGCCGGCGGGCTC
TGGGGAACCGCTGGGTCGGCGCGCCCGGGGCTGGCGGAGCAATTCCTGAGGCGCCCAAGCTCACCCCCAACGCTAACTCCGCCTATTCAG
TCCCGGCGGCTCCCCCTCTCCCCCCTCCCAATCCTCCTCCCGGCTCCTGCCCGCCCCTTTCGCCCTGGTGGTAGGAAACACTCCTGAATC
TAACTCGACGTGTCCGGAAAGCCCTGGCCAGTTTTCCTTTCGTTCTGCGGCCGCTGCAGCCAGCCCCGCGGCTCCCTCAGACCCGCGGGC
GCAGCCGCCGGGGGTGAGGCGCTTGGGGACCGCGGGCCGAGCGGCGGGGATCCCCGAGCACCATGCTGGACCCGTCTTCCAGCGAAGAGG
AGTCGGACGAGGGGCTGGAAGAGGAAAGCCGCGATGTGCTGGTGGCAGCCGGCAGCTCGCAGCGAGCTCCTCCAGCCCCGACTCGGGAAG
GGCGGCGGGACGCGCCGGGGCGCGCGGGCGGCGGCGGCGCGGCCAGATCTGTGAGCCCGAGCCCCTCTGTGCTCAGCGAGGGGCGAGACG
AGCCCCAGCGGCAGCTGGACGATGAGCAGGAGCGGAGGATCCGCCTGCAGCTCTACGTCTTCGTCGTGAGGTGCATCGCGTACCCCTTCA
ACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGGTTGCAGAAGACAAAGAGGAAAGTGAAGAAGAGCTTATCTTTACTGAAA
GTAACAGTGAGGTTTCTGAGGAAGTGTATACAGAGGAGGAGGAGGAGGAGTCCCAGGAGGAAGAGGAGGAAGAAGACAGTGACGAAGAGG
AAAGAACAATTGAAACTGCAAAAGGGATTAATGGAACTGTAAATTATGATAGTGTCAATTCTGACAACTCTAAGCCAAAGATATTTAAAA
GTCAAATAGAGAACATAAATTTGACCAATGGCAGCAATGGGAGGAACACAGAGTCCCCAGCTGCCATTCACCCTTGTGGAAATCCTACAG
TGATTGAGGACGCTTTGGACAAGATTAAAAGCAATGACCCTGACACCACAGAAGTCAATTTGAACAACATTGAGAACATCACAACACAGA
CCCTTACCCGCTTTGCTGAAGCCCTCAAGGACAACACTGTGGTGAAGACGTTCAGTCTGGCCAACACGCATGCCGACGACAGTGCAGCCA
TGGCCATTGCAGAGATGCTCAAAGTCAATGAGCACATCACCAACGTAAACGTCGAGTCCAACTTCATAACGGGAAAGGGGATCCTGGCCA
TCATGAGAGCTCTCCAGCACAACACGGTGCTCACGGAGCTGCGTTTCCATAACCAGAGGCACATCATGGGCAGCCAGGTGGAAATGGAGA
TTGTCAAGCTGCTGAAGGAGAACACGACGCTGCTGAGGCTGGGATACCATTTTGAACTCCCAGGACCAAGAATGAGCATGACGAGCATTT
TGACAAGAAATATGGATAAACAGAGGCAAAAACGTTTGCAGGAGCAAAAACAGCAGGAGGGATACGATGGAGGACCCAATCTTAGGACCA
AAGTCTGGCAAAGAGGAACACCTAGCTCTTCACCTTATGTATCTCCCAGGCACTCACCCTGGTCATCCCCAAAACTCCCCAAAAAAGTCC
AGACTGTGAGGAGCCGTCCTCTGTCTCCTGTGGCCACACCTCCTCCTCCTCCCCCTCCTCCTCCTCCTCCCCCTCCTTCTTCCCAAAGGC
TGCCACCACCTCCTCCTCCTCCCCCTCCTCCACTCCCAGAGAAAAAGCTCATTACCAGAAACATTGCAGAAGTCATCAAACAACAGGAGA
GTGCCCAACGGGCATTACAAAATGGACAAAAAAAGAAAAAAGGGAAAAAGGTCAAGAAACAGCCAAACAGTATTCTAAAGGAAATAAAAA
ATTCTCTGAGGTCAGTGCAAGAGAAGAAAATGGAAGACAGTTCCCGACCTTCTACCCCACAGAGATCAGCTCATGAGAATCTCATGGAAG
CAATTCGGGGAAGCAGCATAAAACAGCTAAAGCGGGTGGAAGTTCCAGAAGCCCTGCGATAAAAACATGATCTTTAGAAGAGGATGCAGA
ACTGTTCAGTGGTATTACATGAAATGCATTGTGAGATGTTTCTAAAATACCTTCTTCAATTCAAAATGATCCCTGACTTTAAAAATAATC
TCACCCATTAATTCCAAAGAGAATCTTAAGAAACAATCAGCATGTTTCTTCTGTAAATATGAAAATAAATTTCTTTTTTATGTCGTGAGA
TTTGTATTGGCAAGAAGCAGTTAATTTAAAGATGCTCTTCCTATCTGTGGATGTGTTGGTAACTCCGAGTTGTAATGAGTTCATGAAATG
TGCTGTTATTTTTGTAATCTCAATAAATGTGGATTGAAGTTTTTTCCCTTTTTTTAAAGCCAAACTAATATTTTTCTGTGACTTGATACA
TCTGTCAGATTTTTGTAATCTCGATAAATGTGTATTGAAGTTTTTTCCCTTTTTTTAAAAAGCCAAACTAATATTTTTCTGTGAGTTAAT

>In-frame_CADPS2_ENST00000334010_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_2677nt
ATTCAATTCCACGTGTTGCTTGTTGTAGGCGCCACAGGTTCCCCACCTGCGTCCGGGCGCTCGGGCGGCTCCGCCTCTGCCGGCGGGCTC
TGGGGAACCGCTGGGTCGGCGCGCCCGGGGCTGGCGGAGCAATTCCTGAGGCGCCCAAGCTCACCCCCAACGCTAACTCCGCCTATTCAG
TCCCGGCGGCTCCCCCTCTCCCCCCTCCCAATCCTCCTCCCGGCTCCTGCCCGCCCCTTTCGCCCTGGTGGTAGGAAACACTCCTGAATC
TAACTCGACGTGTCCGGAAAGCCCTGGCCAGTTTTCCTTTCGTTCTGCGGCCGCTGCAGCCAGCCCCGCGGCTCCCTCAGACCCGCGGGC
GCAGCCGCCGGGGGTGAGGCGCTTGGGGACCGCGGGCCGAGCGGCGGGGATCCCCGAGCACCATGCTGGACCCGTCTTCCAGCGAAGAGG
AGTCGGACGAGGGGCTGGAAGAGGAAAGCCGCGATGTGCTGGTGGCAGCCGGCAGCTCGCAGCGAGCTCCTCCAGCCCCGACTCGGGAAG
GGCGGCGGGACGCGCCGGGGCGCGCGGGCGGCGGCGGCGCGGCCAGATCTGTGAGCCCGAGCCCCTCTGTGCTCAGCGAGGGGCGAGACG
AGCCCCAGCGGCAGCTGGACGATGAGCAGGAGCGGAGGATCCGCCTGCAGCTCTACGTCTTCGTCGTGAGGTGCATCGCGTACCCCTTCA
ACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGGTTGCAGAAGACAAAGAGGAAAGTGAAGAAGAGCTTATCTTTACTGAAA
GTAACAGTGAGGTTTCTGAGGAAGTGTATACAGAGGAGGAGGAGGAGGAGTCCCAGGAGGAAGAGGAGGAAGAAGACAGTGACGAAGAGG
AAAGAACAATTGAAACTGCAAAAGGGATTAATGGAACTGTAAATTATGATAGTGTCAATTCTGACAACTCTAAGCCAAAGATATTTAAAA
GTCAAATAGAGAACATAAATTTGACCAATGGCAGCAATGGGAGGAACACAGAGTCCCCAGCTGCCATTCACCCTTGTGGAAATCCTACAG
TGATTGAGGACGCTTTGGACAAGATTAAAAGCAATGACCCTGACACCACAGAAGTCAATTTGAACAACATTGAGAACATCACAACACAGA
CCCTTACCCGCTTTGCTGAAGCCCTCAAGGACAACACTGTGGTGAAGACGTTCAGTCTGGCCAACACGCATGCCGACGACAGTGCAGCCA
TGGCCATTGCAGAGATGCTCAAAGTCAATGAGCACATCACCAACGTAAACGTCGAGTCCAACTTCATAACGGGAAAGGGGATCCTGGCCA
TCATGAGAGCTCTCCAGCACAACACGGTGCTCACGGAGCTGCGTTTCCATAACCAGAGGCACATCATGGGCAGCCAGGTGGAAATGGAGA
TTGTCAAGCTGCTGAAGGAGAACACGACGCTGCTGAGGCTGGGATACCATTTTGAACTCCCAGGACCAAGAATGAGCATGACGAGCATTT
TGACAAGAAATATGGATAAACAGAGGCAAAAACGTTTGCAGGAGCAAAAACAGCAGGAGGGATACGATGGAGGACCCAATCTTAGGACCA
AAGTCTGGCAAAGAGGAACACCTAGCTCTTCACCTTATGTATCTCCCAGGCACTCACCCTGGTCATCCCCAAAACTCCCCAAAAAAGTCC
AGACTGTGAGGAGCCGTCCTCTGTCTCCTGTGGCCACACCTCCTCCTCCTCCCCCTCCTCCTCCTCCTCCCCCTCCTTCTTCCCAAAGGC
TGCCACCACCTCCTCCTCCTCCCCCTCCTCCACTCCCAGAGAAAAAGCTCATTACCAGAAACATTGCAGAAGTCATCAAACAACAGGAGA
GTGCCCAACGGGCATTACAAAATGGACAAAAAAAGAAAAAAGGGAAAAAGGTCAAGAAACAGCCAAACAGTATTCTAAAGGAAATAAAAA
ATTCTCTGAGGTCAGTGCAAGAGAAGAAAATGGAAGACAGTTCCCGACCTTCTACCCCACAGAGATCAGCTCATGAGAATCTCATGGAAG
CAATTCGGGGAAGCAGCATAAAACAGCTAAAGCGGGTGGAAGTTCCAGAAGCCCTGCGATAAAAACATGATCTTTAGAAGAGGATGCAGA
ACTGTTCAGTGGTATTACATGAAATGCATTGTGAGATGTTTCTAAAATACCTTCTTCAATTCAAAATGATCCCTGACTTTAAAAATAATC
TCACCCATTAATTCCAAAGAGAATCTTAAGAAACAATCAGCATGTTTCTTCTGTAAATATGAAAATAAATTTCTTTTTTATGTCGTGAGA
TTTGTATTGGCAAGAAGCAGTTAATTTAAAGATGCTCTTCCTATCTGTGGATGTGTTGGTAACTCCGAGTTGTAATGAGTTCATGAAATG
TGCTGTTATTTTTGTAATCTCAATAAATGTGGATTGAAGTTTTTTCCCTTTTTTTAAAGCCAAACTAATATTTTTCTGTGACTTGATACA
TCTGTCAGATTTTTGTAATCTCGATAAATGTGTATTGAAGTTTTTTCCCTTTTTTTAAAAAGCCAAACTAATATTTTTCTGTGAGTTAAT

>In-frame_CADPS2_ENST00000412584_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_2376nt
TTTTCCTTTCGTTCTGCGGCCGCTGCAGCCAGCCCCGCGGCTCCCTCAGACCCGCGGGCGCAGCCGCCGGGGGTGAGGCGCTTGGGGACC
GCGGGCCGAGCGGCGGGGATCCCCGAGCACCATGCTGGACCCGTCTTCCAGCGAAGAGGAGTCGGACGAGGGGCTGGAAGAGGAAAGCCG
CGATGTGCTGGTGGCAGCCGGCAGCTCGCAGCGAGCTCCTCCAGCCCCGACTCGGGAAGGGCGGCGGGACGCGCCGGGGCGCGCGGGCGG
CGGCGGCGCGGCCAGATCTGTGAGCCCGAGCCCCTCTGTGCTCAGCGAGGGGCGAGACGAGCCCCAGCGGCAGCTGGACGATGAGCAGGA
GCGGAGGATCCGCCTGCAGCTCTACGTCTTCGTCGTGAGGTGCATCGCGTACCCCTTCAACGCCAAGCAGCCCACCGACATGGCCCGGAG
GCAGCAGAAGGTTGCAGAAGACAAAGAGGAAAGTGAAGAAGAGCTTATCTTTACTGAAAGTAACAGTGAGGTTTCTGAGGAAGTGTATAC
AGAGGAGGAGGAGGAGGAGTCCCAGGAGGAAGAGGAGGAAGAAGACAGTGACGAAGAGGAAAGAACAATTGAAACTGCAAAAGGGATTAA
TGGAACTGTAAATTATGATAGTGTCAATTCTGACAACTCTAAGCCAAAGATATTTAAAAGTCAAATAGAGAACATAAATTTGACCAATGG
CAGCAATGGGAGGAACACAGAGTCCCCAGCTGCCATTCACCCTTGTGGAAATCCTACAGTGATTGAGGACGCTTTGGACAAGATTAAAAG
CAATGACCCTGACACCACAGAAGTCAATTTGAACAACATTGAGAACATCACAACACAGACCCTTACCCGCTTTGCTGAAGCCCTCAAGGA
CAACACTGTGGTGAAGACGTTCAGTCTGGCCAACACGCATGCCGACGACAGTGCAGCCATGGCCATTGCAGAGATGCTCAAAGTCAATGA
GCACATCACCAACGTAAACGTCGAGTCCAACTTCATAACGGGAAAGGGGATCCTGGCCATCATGAGAGCTCTCCAGCACAACACGGTGCT
CACGGAGCTGCGTTTCCATAACCAGAGGCACATCATGGGCAGCCAGGTGGAAATGGAGATTGTCAAGCTGCTGAAGGAGAACACGACGCT
GCTGAGGCTGGGATACCATTTTGAACTCCCAGGACCAAGAATGAGCATGACGAGCATTTTGACAAGAAATATGGATAAACAGAGGCAAAA
ACGTTTGCAGGAGCAAAAACAGCAGGAGGGATACGATGGAGGACCCAATCTTAGGACCAAAGTCTGGCAAAGAGGAACACCTAGCTCTTC
ACCTTATGTATCTCCCAGGCACTCACCCTGGTCATCCCCAAAACTCCCCAAAAAAGTCCAGACTGTGAGGAGCCGTCCTCTGTCTCCTGT
GGCCACACCTCCTCCTCCTCCCCCTCCTCCTCCTCCTCCCCCTCCTTCTTCCCAAAGGCTGCCACCACCTCCTCCTCCTCCCCCTCCTCC
ACTCCCAGAGAAAAAGCTCATTACCAGAAACATTGCAGAAGTCATCAAACAACAGGAGAGTGCCCAACGGGCATTACAAAATGGACAAAA
AAAGAAAAAAGGGAAAAAGGTCAAGAAACAGCCAAACAGTATTCTAAAGGAAATAAAAAATTCTCTGAGGTCAGTGCAAGAGAAGAAAAT
GGAAGACAGTTCCCGACCTTCTACCCCACAGAGATCAGCTCATGAGAATCTCATGGAAGCAATTCGGGGAAGCAGCATAAAACAGCTAAA
GCGGGTGGAAGTTCCAGAAGCCCTGCGATAAAAACATGATCTTTAGAAGAGGATGCAGAACTGTTCAGTGGTATTACATGAAATGCATTG
TGAGATGTTTCTAAAATACCTTCTTCAATTCAAAATGATCCCTGACTTTAAAAATAATCTCACCCATTAATTCCAAAGAGAATCTTAAGA
AACAATCAGCATGTTTCTTCTGTAAATATGAAAATAAATTTCTTTTTTATGTCGTGAGATTTGTATTGGCAAGAAGCAGTTAATTTAAAG
ATGCTCTTCCTATCTGTGGATGTGTTGGTAACTCCGAGTTGTAATGAGTTCATGAAATGTGCTGTTATTTTTGTAATCTCAATAAATGTG
GATTGAAGTTTTTTCCCTTTTTTTAAAGCCAAACTAATATTTTTCTGTGACTTGATACATCTGTCAGATTTTTGTAATCTCGATAAATGT
GTATTGAAGTTTTTTCCCTTTTTTTAAAAAGCCAAACTAATATTTTTCTGTGAGTTAATACATCTGTCAGGTGTGTATGTAACATTACTG

>In-frame_CADPS2_ENST00000449022_chr7_122526053_-_LMOD2_ENST00000458573_chr7_123301914_+_2275nt
GGCGGGGATCCCCGAGCACCATGCTGGACCCGTCTTCCAGCGAAGAGGAGTCGGACGAGGGGCTGGAAGAGGAAAGCCGCGATGTGCTGG
TGGCAGCCGGCAGCTCGCAGCGAGCTCCTCCAGCCCCGACTCGGGAAGGGCGGCGGGACGCGCCGGGGCGCGCGGGCGGCGGCGGCGCGG
CCAGATCTGTGAGCCCGAGCCCCTCTGTGCTCAGCGAGGGGCGAGACGAGCCCCAGCGGCAGCTGGACGATGAGCAGGAGCGGAGGATCC
GCCTGCAGCTCTACGTCTTCGTCGTGAGGTGCATCGCGTACCCCTTCAACGCCAAGCAGCCCACCGACATGGCCCGGAGGCAGCAGAAGG
TTGCAGAAGACAAAGAGGAAAGTGAAGAAGAGCTTATCTTTACTGAAAGTAACAGTGAGGTTTCTGAGGAAGTGTATACAGAGGAGGAGG
AGGAGGAGTCCCAGGAGGAAGAGGAGGAAGAAGACAGTGACGAAGAGGAAAGAACAATTGAAACTGCAAAAGGGATTAATGGAACTGTAA
ATTATGATAGTGTCAATTCTGACAACTCTAAGCCAAAGATATTTAAAAGTCAAATAGAGAACATAAATTTGACCAATGGCAGCAATGGGA
GGAACACAGAGTCCCCAGCTGCCATTCACCCTTGTGGAAATCCTACAGTGATTGAGGACGCTTTGGACAAGATTAAAAGCAATGACCCTG
ACACCACAGAAGTCAATTTGAACAACATTGAGAACATCACAACACAGACCCTTACCCGCTTTGCTGAAGCCCTCAAGGACAACACTGTGG
TGAAGACGTTCAGTCTGGCCAACACGCATGCCGACGACAGTGCAGCCATGGCCATTGCAGAGATGCTCAAAGTCAATGAGCACATCACCA
ACGTAAACGTCGAGTCCAACTTCATAACGGGAAAGGGGATCCTGGCCATCATGAGAGCTCTCCAGCACAACACGGTGCTCACGGAGCTGC
GTTTCCATAACCAGAGGCACATCATGGGCAGCCAGGTGGAAATGGAGATTGTCAAGCTGCTGAAGGAGAACACGACGCTGCTGAGGCTGG
GATACCATTTTGAACTCCCAGGACCAAGAATGAGCATGACGAGCATTTTGACAAGAAATATGGATAAACAGAGGCAAAAACGTTTGCAGG
AGCAAAAACAGCAGGAGGGATACGATGGAGGACCCAATCTTAGGACCAAAGTCTGGCAAAGAGGAACACCTAGCTCTTCACCTTATGTAT
CTCCCAGGCACTCACCCTGGTCATCCCCAAAACTCCCCAAAAAAGTCCAGACTGTGAGGAGCCGTCCTCTGTCTCCTGTGGCCACACCTC
CTCCTCCTCCCCCTCCTCCTCCTCCTCCCCCTCCTTCTTCCCAAAGGCTGCCACCACCTCCTCCTCCTCCCCCTCCTCCACTCCCAGAGA
AAAAGCTCATTACCAGAAACATTGCAGAAGTCATCAAACAACAGGAGAGTGCCCAACGGGCATTACAAAATGGACAAAAAAAGAAAAAAG
GGAAAAAGGTCAAGAAACAGCCAAACAGTATTCTAAAGGAAATAAAAAATTCTCTGAGGTCAGTGCAAGAGAAGAAAATGGAAGACAGTT
CCCGACCTTCTACCCCACAGAGATCAGCTCATGAGAATCTCATGGAAGCAATTCGGGGAAGCAGCATAAAACAGCTAAAGCGGGTGGAAG
TTCCAGAAGCCCTGCGATAAAAACATGATCTTTAGAAGAGGATGCAGAACTGTTCAGTGGTATTACATGAAATGCATTGTGAGATGTTTC
TAAAATACCTTCTTCAATTCAAAATGATCCCTGACTTTAAAAATAATCTCACCCATTAATTCCAAAGAGAATCTTAAGAAACAATCAGCA
TGTTTCTTCTGTAAATATGAAAATAAATTTCTTTTTTATGTCGTGAGATTTGTATTGGCAAGAAGCAGTTAATTTAAAGATGCTCTTCCT
ATCTGTGGATGTGTTGGTAACTCCGAGTTGTAATGAGTTCATGAAATGTGCTGTTATTTTTGTAATCTCAATAAATGTGGATTGAAGTTT
TTTCCCTTTTTTTAAAGCCAAACTAATATTTTTCTGTGACTTGATACATCTGTCAGATTTTTGTAATCTCGATAAATGTGTATTGAAGTT
TTTTCCCTTTTTTTAAAAAGCCAAACTAATATTTTTCTGTGAGTTAATACATCTGTCAGGTGTGTATGTAACATTACTGGACATTAAAAA


Top

FusionGenePPI for CADPS2_LMOD2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CADPS2UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2E1, UBE2E3, UBE2N, UBE2U, UBE2W, ASB6, ASB12, BZRAP1, SRPK2, C19orf45LMOD2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+03162_49791548actin 2
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+03521_54091548actin 3


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCADPS2chr7:122526053chr7:123301914ENST00000412584-128755_10741131256DRD2
HgeneCADPS2chr7:122526053chr7:123301914ENST00000449022-130755_10741131297DRD2
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+031_16191548actin 1
TgeneLMOD2chr7:122526053chr7:123301914ENST00000458573+031_4791548tropomyosin alpha


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CADPS2_LMOD2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCADPS2Q86UW7DB11093Calcium CitrateCalcium-dependent secretion activator 2small moleculeapproved
HgeneCADPS2Q86UW7DB11348Calcium PhosphateCalcium-dependent secretion activator 2small moleculeapproved

Top

RelatedDiseases for CADPS2_LMOD2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCADPS2C0004352Autistic Disorder1CTD_human
HgeneCADPS2C0008370Cholestasis1CTD_human
HgeneCADPS2C0036341Schizophrenia1PSYGENET
HgeneCADPS2C0236969Substance-Related Disorders1CTD_human
HgeneCADPS2C4277682Chemical and Drug Induced Liver Injury1CTD_human
TgeneLMOD2C0033975Psychotic Disorders1PSYGENET
TgeneLMOD2C0036341Schizophrenia1PSYGENET
TgeneLMOD2C0349204Nonorganic psychosis1PSYGENET