FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5090

FusionGeneSummary for C7orf50_MAD1L1

check button Fusion gene summary
Fusion gene informationFusion gene name: C7orf50_MAD1L1
Fusion gene ID: 5090
HgeneTgene
Gene symbol

C7orf50

MAD1L1

Gene ID

84310

8379

Gene namechromosome 7 open reading frame 50mitotic arrest deficient 1 like 1
SynonymsYCR016WMAD1|PIG9|TP53I9|TXBP181
Cytomap

7p22.3

7p22.3

Type of geneprotein-codingprotein-coding
Descriptionuncharacterized protein C7orf50mitotic spindle assembly checkpoint protein MAD1MAD1 mitotic arrest deficient like 1MAD1-like protein 1mitotic arrest deficient 1-like protein 1mitotic checkpoint MAD1 protein homologmitotic-arrest deficient 1, yeast, homolog-like 1tax-binding prote
Modification date2018051920180523
UniProtAcc

Q9BRJ6

Q9Y6D9

Ensembl transtripts involved in fusion geneENST00000357429, ENST00000397100, 
ENST00000397098, ENST00000488073, 
ENST00000402746, ENST00000399654, 
ENST00000406869, ENST00000265854, 
ENST00000486340, 
Fusion gene scores* DoF score7 X 4 X 7=19610 X 12 X 9=1080
# samples 1018
** MAII scorelog2(10/196*10)=-0.970853654340483
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(18/1080*10)=-2.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: C7orf50 [Title/Abstract] AND MAD1L1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMAD1L1

GO:0090235

regulation of metaphase plate congression

20133940


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-L5-A4OQ-01AC7orf50chr7

1166893

-MAD1L1chr7

1855864

-
TCGARVUCECTCGA-E6-A8L9-01AC7orf50chr7

1166893

-MAD1L1chr7

2041756

-
TCGARVUCSTCGA-NA-A4R0-01AC7orf50chr7

1166893

-MAD1L1chr7

1855864

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000357429ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
Frame-shitENST00000357429ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
In-frameENST00000357429ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
Frame-shitENST00000357429ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5CDS-intronENST00000357429ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
In-frameENST00000397100ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
Frame-shitENST00000397100ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
Frame-shitENST00000397100ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
In-frameENST00000397100ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5CDS-intronENST00000397100ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
In-frameENST00000397098ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
Frame-shitENST00000397098ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
Frame-shitENST00000397098ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
In-frameENST00000397098ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5CDS-intronENST00000397098ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5UTR-3CDSENST00000488073ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5UTR-3CDSENST00000488073ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5UTR-3CDSENST00000488073ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5UTR-3CDSENST00000488073ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
5UTR-intronENST00000488073ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

1855864

-
Frame-shitENST00000357429ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000357429ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000357429ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000357429ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5CDS-intronENST00000357429ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397100ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397100ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397100ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397100ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5CDS-intronENST00000397100ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397098ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397098ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397098ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
Frame-shitENST00000397098ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5CDS-intronENST00000397098ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5UTR-3CDSENST00000488073ENST00000402746C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5UTR-3CDSENST00000488073ENST00000399654C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5UTR-3CDSENST00000488073ENST00000406869C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5UTR-3CDSENST00000488073ENST00000265854C7orf50chr7

1166893

-MAD1L1chr7

2041756

-
5UTR-intronENST00000488073ENST00000486340C7orf50chr7

1166893

-MAD1L1chr7

2041756

-

Top

FusionProtFeatures for C7orf50_MAD1L1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
C7orf50

Q9BRJ6

MAD1L1

Q9Y6D9

Component of the spindle-assembly checkpoint thatprevents the onset of anaphase until all chromosomes are properlyaligned at the metaphase plate. May recruit MAD2L1 to unattachedkinetochores. Has a role in the correct positioning of the septum.Required for anchoring MAD2L1 to the nuclear periphery. Binds tothe TERT promoter and represses telomerase expression, possibly byinterfering with MYC binding. {ECO:0000269|PubMed:10049595,ECO:0000269|PubMed:12837246, ECO:0000269|PubMed:20133940}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for C7orf50_MAD1L1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_C7orf50_ENST00000357429_chr7_1166893_-_MAD1L1_ENST00000406869_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000357429_chr7_1166893_-_MAD1L1_ENST00000406869_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_96aa
MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_C7orf50_ENST00000357429_chr7_1166893_-_MAD1L1_ENST00000406869_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000357429_chr7_1166893_-_MAD1L1_ENST00000406869_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_288nt
ATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGC
CCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCA
CACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_C7orf50_ENST00000357429_chr7_1166893_-_MAD1L1_ENST00000406869_chr7_1855864_-_634nt
GCCGGAAGGCGGCGTCCGCGACGCAGCTGTTCACGCTTAGGTGGGCGACGTGGGCGCAGGTGGGCGCAGGATGGCAAAACAGAAGAGAAA
AGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGG
CGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCAT
CGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCC
TGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTG
CCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCA
CGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCGGCCACCAGCCTGGGTTCCTCACCTTGTGAAATAAAATCTTCTCCCCT

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_605nt
GCCGGAAGGCGGCGTCCGCGACGCAGCTGTTCACGCTTAGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACA
AAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_588nt
GCCGGAAGGCGGCGTCCGCGACGCAGCTGTTCACGCTTAGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACA
AAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_1491nt
GCGACGCAGCTGTTCACGCTTAGGTGGGCGACGTGGGCGCAGGTGGGCGCAGGTAGGCGCGTGGGGCGGCGGCGGGGTGGCCGGCGGGTC
AGGGCGCCAGGAGACCCAGAGCCCCGGGGCGGGCTCCCGCGGGGCTCCGCCCCCTCCACGTGGGTGCGCGGAGGCCCGGCGCGGCGCGAC
CGGGCGGCGGCCCTGGGGTCCGCGGTGCTGGGGAGGCTGGTGCGGCCGGTGCGGCCGGTGCGTCCCGGCGCGGGCTCCGACACCCGCACC
CGCCTCTGGGTTAACTCAGCGCGGGCGAGTGGAAGGGACTCAGCTGGCTCCTAGGTTTCAGGCCGTCAGGGCTTGCAGTGGCTCTGGTTT
CATTGTCTTTCTCTGAAGACGCCCTGATTGCCCTCCGAGGCTTTCAGCTCCCACTTTCTCTTTTTCAATTTTTGAGGCAGTGTCTCGCTG
TGCCACCCAGGCTGGAGTGCAATGGCGTGATCATAGCTCACTGCAGCCTCCACCTCCTGGGCTCAAGCCGTCCTCCCGCCTCATCCTCCC
AAGTAGCTGGGACCACATGCGCGCGCCACCACACCCGGATAATTTTTAAAAATGTTTTTTGTAGAAATGGGGTCTCACCATGTTACCCAG
GCTGGTCTCGAATTCTTGGGCTCAAGCGATGGATCCTCCTGCCTCGGCCTCCCAAAGTGCTGGGATTACAGGAGTGAGCCAACGCGCTTG
GCCTCACTTTCCATCATAAGCATGCTTTCCGTTTCCTTCCTTCCGTCATTCATTCATTCATTTTTAAAAAACGTTCATTGGGTTCCTCCT
GCACTGTTCGGGGCATTGGGCTACAGCTGTCAACAAGTGGAGACAAGTCTGTGATCTAGTGAACTTCCATTCTGGAGGGGAGAGACAGAT
GAACAAGGTGCACAGAGCAGGTGATGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAG
GCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAG
ATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTC
AGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGA
CCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGC
TGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCG

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_1474nt
GCGACGCAGCTGTTCACGCTTAGGTGGGCGACGTGGGCGCAGGTGGGCGCAGGTAGGCGCGTGGGGCGGCGGCGGGGTGGCCGGCGGGTC
AGGGCGCCAGGAGACCCAGAGCCCCGGGGCGGGCTCCCGCGGGGCTCCGCCCCCTCCACGTGGGTGCGCGGAGGCCCGGCGCGGCGCGAC
CGGGCGGCGGCCCTGGGGTCCGCGGTGCTGGGGAGGCTGGTGCGGCCGGTGCGGCCGGTGCGTCCCGGCGCGGGCTCCGACACCCGCACC
CGCCTCTGGGTTAACTCAGCGCGGGCGAGTGGAAGGGACTCAGCTGGCTCCTAGGTTTCAGGCCGTCAGGGCTTGCAGTGGCTCTGGTTT
CATTGTCTTTCTCTGAAGACGCCCTGATTGCCCTCCGAGGCTTTCAGCTCCCACTTTCTCTTTTTCAATTTTTGAGGCAGTGTCTCGCTG
TGCCACCCAGGCTGGAGTGCAATGGCGTGATCATAGCTCACTGCAGCCTCCACCTCCTGGGCTCAAGCCGTCCTCCCGCCTCATCCTCCC
AAGTAGCTGGGACCACATGCGCGCGCCACCACACCCGGATAATTTTTAAAAATGTTTTTTGTAGAAATGGGGTCTCACCATGTTACCCAG
GCTGGTCTCGAATTCTTGGGCTCAAGCGATGGATCCTCCTGCCTCGGCCTCCCAAAGTGCTGGGATTACAGGAGTGAGCCAACGCGCTTG
GCCTCACTTTCCATCATAAGCATGCTTTCCGTTTCCTTCCTTCCGTCATTCATTCATTCATTTTTAAAAAACGTTCATTGGGTTCCTCCT
GCACTGTTCGGGGCATTGGGCTACAGCTGTCAACAAGTGGAGACAAGTCTGTGATCTAGTGAACTTCCATTCTGGAGGGGAGAGACAGAT
GAACAAGGTGCACAGAGCAGGTGATGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAG
GCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAG
ATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTC
AGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGA
CCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGC
TGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCG

>In-frame_C7orf50_ENST00000357429_chr7_1166893_-_MAD1L1_ENST00000406869_chr7_1855864_-_634nt
GCCGGAAGGCGGCGTCCGCGACGCAGCTGTTCACGCTTAGGTGGGCGACGTGGGCGCAGGTGGGCGCAGGATGGCAAAACAGAAGAGAAA
AGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGG
CGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCAT
CGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCC
TGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTG
CCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCA
CGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCGGCCACCAGCCTGGGTTCCTCACCTTGTGAAATAAAATCTTCTCCCCT

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_605nt
GCCGGAAGGCGGCGTCCGCGACGCAGCTGTTCACGCTTAGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACA
AAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_C7orf50_ENST00000397100_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_588nt
GCCGGAAGGCGGCGTCCGCGACGCAGCTGTTCACGCTTAGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACA
AAAAGCTGAAGAAGGCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCC
CCTCGGGTTCCAAGATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCA
TCCCTGCCTTCCTCAGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCAC
TCTGCTTGGCCTGACCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATG
ACTGACAGACACGCTGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTG

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000402746_chr7_1855864_-_1491nt
GCGACGCAGCTGTTCACGCTTAGGTGGGCGACGTGGGCGCAGGTGGGCGCAGGTAGGCGCGTGGGGCGGCGGCGGGGTGGCCGGCGGGTC
AGGGCGCCAGGAGACCCAGAGCCCCGGGGCGGGCTCCCGCGGGGCTCCGCCCCCTCCACGTGGGTGCGCGGAGGCCCGGCGCGGCGCGAC
CGGGCGGCGGCCCTGGGGTCCGCGGTGCTGGGGAGGCTGGTGCGGCCGGTGCGGCCGGTGCGTCCCGGCGCGGGCTCCGACACCCGCACC
CGCCTCTGGGTTAACTCAGCGCGGGCGAGTGGAAGGGACTCAGCTGGCTCCTAGGTTTCAGGCCGTCAGGGCTTGCAGTGGCTCTGGTTT
CATTGTCTTTCTCTGAAGACGCCCTGATTGCCCTCCGAGGCTTTCAGCTCCCACTTTCTCTTTTTCAATTTTTGAGGCAGTGTCTCGCTG
TGCCACCCAGGCTGGAGTGCAATGGCGTGATCATAGCTCACTGCAGCCTCCACCTCCTGGGCTCAAGCCGTCCTCCCGCCTCATCCTCCC
AAGTAGCTGGGACCACATGCGCGCGCCACCACACCCGGATAATTTTTAAAAATGTTTTTTGTAGAAATGGGGTCTCACCATGTTACCCAG
GCTGGTCTCGAATTCTTGGGCTCAAGCGATGGATCCTCCTGCCTCGGCCTCCCAAAGTGCTGGGATTACAGGAGTGAGCCAACGCGCTTG
GCCTCACTTTCCATCATAAGCATGCTTTCCGTTTCCTTCCTTCCGTCATTCATTCATTCATTTTTAAAAAACGTTCATTGGGTTCCTCCT
GCACTGTTCGGGGCATTGGGCTACAGCTGTCAACAAGTGGAGACAAGTCTGTGATCTAGTGAACTTCCATTCTGGAGGGGAGAGACAGAT
GAACAAGGTGCACAGAGCAGGTGATGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAG
GCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAG
ATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTC
AGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGA
CCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGC
TGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCG

>In-frame_C7orf50_ENST00000397098_chr7_1166893_-_MAD1L1_ENST00000265854_chr7_1855864_-_1474nt
GCGACGCAGCTGTTCACGCTTAGGTGGGCGACGTGGGCGCAGGTGGGCGCAGGTAGGCGCGTGGGGCGGCGGCGGGGTGGCCGGCGGGTC
AGGGCGCCAGGAGACCCAGAGCCCCGGGGCGGGCTCCCGCGGGGCTCCGCCCCCTCCACGTGGGTGCGCGGAGGCCCGGCGCGGCGCGAC
CGGGCGGCGGCCCTGGGGTCCGCGGTGCTGGGGAGGCTGGTGCGGCCGGTGCGGCCGGTGCGTCCCGGCGCGGGCTCCGACACCCGCACC
CGCCTCTGGGTTAACTCAGCGCGGGCGAGTGGAAGGGACTCAGCTGGCTCCTAGGTTTCAGGCCGTCAGGGCTTGCAGTGGCTCTGGTTT
CATTGTCTTTCTCTGAAGACGCCCTGATTGCCCTCCGAGGCTTTCAGCTCCCACTTTCTCTTTTTCAATTTTTGAGGCAGTGTCTCGCTG
TGCCACCCAGGCTGGAGTGCAATGGCGTGATCATAGCTCACTGCAGCCTCCACCTCCTGGGCTCAAGCCGTCCTCCCGCCTCATCCTCCC
AAGTAGCTGGGACCACATGCGCGCGCCACCACACCCGGATAATTTTTAAAAATGTTTTTTGTAGAAATGGGGTCTCACCATGTTACCCAG
GCTGGTCTCGAATTCTTGGGCTCAAGCGATGGATCCTCCTGCCTCGGCCTCCCAAAGTGCTGGGATTACAGGAGTGAGCCAACGCGCTTG
GCCTCACTTTCCATCATAAGCATGCTTTCCGTTTCCTTCCTTCCGTCATTCATTCATTCATTTTTAAAAAACGTTCATTGGGTTCCTCCT
GCACTGTTCGGGGCATTGGGCTACAGCTGTCAACAAGTGGAGACAAGTCTGTGATCTAGTGAACTTCCATTCTGGAGGGGAGAGACAGAT
GAACAAGGTGCACAGAGCAGGTGATGGATGGCAAAACAGAAGAGAAAAGTTCCTGAAGTGACAGAGAAAAAGAACAAAAAGCTGAAGAAG
GCGTCAGCAGAGGGGCCACTGCTGGGCCCTGAGGCTGCACCAAGTGGCGAAGGAGCCGGCTCCAAGGCCACCAGCCCCTCGGGTTCCAAG
ATGCAGCTACTGGAGACAGAGTTCTCACACACCGTGGGCGAGCTCATCGAGGTGCACCTGCGGCGCCAGGACAGCATCCCTGCCTTCCTC
AGCTCGCTCACCCTCGAGCTCTTCAGCCGCCAGACCGTGGCGTAGCCTGCAGGCTCGGGGGCATAGCCGGAGCCACTCTGCTTGGCCTGA
CCTGCAGGTCCCCTGCCCCGCCAGCCACAGGCTGGGTGCACGTCCTGCCTCTCCAGCCCCACAGGGCAGCAGCATGACTGACAGACACGC
TGGGACCTACGTCGGGCTTCCTGCTGGGGCGGCCAGCACCCTCTCCACGTGCAGACCCCATGCGTCCCGGAGCCTGGTGTGTGGGCGTCG


Top

FusionGenePPI for C7orf50_MAD1L1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
C7orf50CCDC85B, NEDD4L, HDGF, CUL1, COPS5, CAND1, PRNP, APP, PAXIP1, FBXO25, RPA3, RPA2, RPA1, ADARB1, THAP1, RNF2, HIST1H1A, RPL8, THAP7, PRR11, NTRK1, PCNT, NOP56, NCL, CYLD, TRIM25MAD1L1TEX11, NINL, NONO, FAM131C, TRIM29, AMOTL2, TUBGCP4, MAD1L1, MAD2L1, HDAC1, HDAC2, MNT, NRD1, MAD2L1BP, CDC27, COIL, UBC, METTL21C, ZW10, SIN3A, BAG5, FLNB, ZZEF1, CDC20, TPR, TRIP13, ALOX5, TSC22D3, MFAP1, PSMA1, TPM1, TPM3, RNF8, SPATA2, USP15, NEBL, LGALSL, CCHCR1, ZSCAN32, CCDC94, TSHZ3, HAUS1, CWF19L2, CLEC11A, KCNAB3, VPS28, SCARA3, IKZF3, NUDC, STK24, NTRK1, APC, FOXJ2, SNW1, CDC5L, SENP3, PTRF, ZADH2, BMP1, ASB7, HSPA8, C6orf141


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for C7orf50_MAD1L1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for C7orf50_MAD1L1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMAD1L1C0036341Schizophrenia1PSYGENET
TgeneMAD1L1C1336708Testicular Germ Cell Tumor1CTD_human
TgeneMAD1L1C3495559Juvenile arthritis1CTD_human