FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5052

FusionGeneSummary for C6orf203_PDSS2

check button Fusion gene summary
Fusion gene informationFusion gene name: C6orf203_PDSS2
Fusion gene ID: 5052
HgeneTgene
Gene symbol

C6orf203

PDSS2

Gene ID

51250

57107

Gene namechromosome 6 open reading frame 203decaprenyl diphosphate synthase subunit 2
SynonymsHSPC230|PRED31C6orf210|COQ10D3|DLP1|bA59I9.3|hDLP1
Cytomap

6q21

6q21

Type of geneprotein-codingprotein-coding
Descriptionuncharacterized protein C6orf203decaprenyl-diphosphate synthase subunit 2all-trans-decaprenyl-diphosphate synthase subunit 2decaprenyl pyrophosphate synthase subunit 2decaprenyl pyrophosphate synthetase subunit 2prenyl (decaprenyl) diphosphate synthase, subunit 2subunit 2 of decapr
Modification date2018051920180527
UniProtAcc

Q9P0P8

Q86YH6

Ensembl transtripts involved in fusion geneENST00000405204, ENST00000443043, 
ENST00000311381, ENST00000489790, 
ENST00000369037, ENST00000453874, 
ENST00000369031, 
Fusion gene scores* DoF score2 X 1 X 2=47 X 5 X 6=210
# samples 28
** MAII scorelog2(2/4*10)=2.32192809488736log2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: C6orf203 [Title/Abstract] AND PDSS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePDSS2

GO:0006744

ubiquinone biosynthetic process

16262699

TgenePDSS2

GO:0008299

isoprenoid biosynthetic process

16262699


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-FD-A43P-01AC6orf203chr6

107361434

+PDSS2chr6

107475981

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000405204ENST00000369037C6orf203chr6

107361434

+PDSS2chr6

107475981

-
Frame-shitENST00000405204ENST00000453874C6orf203chr6

107361434

+PDSS2chr6

107475981

-
5CDS-intronENST00000405204ENST00000369031C6orf203chr6

107361434

+PDSS2chr6

107475981

-
In-frameENST00000443043ENST00000369037C6orf203chr6

107361434

+PDSS2chr6

107475981

-
Frame-shitENST00000443043ENST00000453874C6orf203chr6

107361434

+PDSS2chr6

107475981

-
5CDS-intronENST00000443043ENST00000369031C6orf203chr6

107361434

+PDSS2chr6

107475981

-
In-frameENST00000311381ENST00000369037C6orf203chr6

107361434

+PDSS2chr6

107475981

-
Frame-shitENST00000311381ENST00000453874C6orf203chr6

107361434

+PDSS2chr6

107475981

-
5CDS-intronENST00000311381ENST00000369031C6orf203chr6

107361434

+PDSS2chr6

107475981

-
3UTR-3CDSENST00000489790ENST00000369037C6orf203chr6

107361434

+PDSS2chr6

107475981

-
3UTR-3CDSENST00000489790ENST00000453874C6orf203chr6

107361434

+PDSS2chr6

107475981

-
3UTR-intronENST00000489790ENST00000369031C6orf203chr6

107361434

+PDSS2chr6

107475981

-

Top

FusionProtFeatures for C6orf203_PDSS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
C6orf203

Q9P0P8

PDSS2

Q86YH6

Supplies decaprenyl diphosphate, the precursor for theside chain of the isoprenoid quinones ubiquinone-10.{ECO:0000269|PubMed:16262699}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for C6orf203_PDSS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_C6orf203_ENST00000405204_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_209aa
MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLTFSSTKLRAPNTKTLFTNIFSLRLPGLLLSPECIFPFSVRLKSNIRS
TKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNTKDLEKAVQSFRTDVVLKTGLDIGRNCEKESKLAKV_LQLLTCVVTMET

>In-frame_C6orf203_ENST00000443043_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_214aa
MIISAMAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLTFSSTKLRAPNTKTLFTNIFSLRLPGLLLSPECIFPFSVRLK
SNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNTKDLEKAVQSFRTDVVLKTGLDIGRNCEKESKLAKV_LQLLTCV

>In-frame_C6orf203_ENST00000311381_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_209aa
MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLTFSSTKLRAPNTKTLFTNIFSLRLPGLLLSPECIFPFSVRLKSNIRS
TKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNTKDLEKAVQSFRTDVVLKTGLDIGRNCEKESKLAKV_LQLLTCVVTMET


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_C6orf203_ENST00000405204_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_629nt
ATGGCTATGGCTAGTGTTAAATTGCTTGCCGGTGTTTTAAGAAAGCCAGATGCCTGGATTGGACTCTGGGGTGTTCTCCGAGGGACACCT
TCATCATACAAACTCTGTACTTCCTGGAATCGATACTTGTATTTTTCTAGTACCAAGTTACGTGCACCAAATTATAAAACACTTTTTTAT
AATATTTTCTCACTGAGACTCCCAGGGCTTTTACTATCTCCAGAATGTATTTTTCCTTTTTCCGTAAGACTCAAAAGTAATATAAGGTCT
ACAAAATCTACTAAAAAGTCTCTGCAAAAAGTAGATGAAGAGGACTCTGATGAAGAAAGCCATCATGATGAGATGAGTGAGCAGGAAGAG
GAGCTTGAGGATGATCCTACTGTAGTCAAAAACTATAAAGACCTGGAAAAAGCAGTTCAGTCTTTTCGGTATGATGTTGTCCTGAAGACG
GGGCTAGATATTGGGAGAAATTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACA

>In-frame_C6orf203_ENST00000443043_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_644nt
ATGATTATAAGCGCCATGGCTATGGCTAGTGTTAAATTGCTTGCCGGTGTTTTAAGAAAGCCAGATGCCTGGATTGGACTCTGGGGTGTT
CTCCGAGGGACACCTTCATCATACAAACTCTGTACTTCCTGGAATCGATACTTGTATTTTTCTAGTACCAAGTTACGTGCACCAAATTAT
AAAACACTTTTTTATAATATTTTCTCACTGAGACTCCCAGGGCTTTTACTATCTCCAGAATGTATTTTTCCTTTTTCCGTAAGACTCAAA
AGTAATATAAGGTCTACAAAATCTACTAAAAAGTCTCTGCAAAAAGTAGATGAAGAGGACTCTGATGAAGAAAGCCATCATGATGAGATG
AGTGAGCAGGAAGAGGAGCTTGAGGATGATCCTACTGTAGTCAAAAACTATAAAGACCTGGAAAAAGCAGTTCAGTCTTTTCGGTATGAT
GTTGTCCTGAAGACGGGGCTAGATATTGGGAGAAATTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTC
GTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTCCCTCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTTTGCTGTGA

>In-frame_C6orf203_ENST00000311381_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_629nt
ATGGCTATGGCTAGTGTTAAATTGCTTGCCGGTGTTTTAAGAAAGCCAGATGCCTGGATTGGACTCTGGGGTGTTCTCCGAGGGACACCT
TCATCATACAAACTCTGTACTTCCTGGAATCGATACTTGTATTTTTCTAGTACCAAGTTACGTGCACCAAATTATAAAACACTTTTTTAT
AATATTTTCTCACTGAGACTCCCAGGGCTTTTACTATCTCCAGAATGTATTTTTCCTTTTTCCGTAAGACTCAAAAGTAATATAAGGTCT
ACAAAATCTACTAAAAAGTCTCTGCAAAAAGTAGATGAAGAGGACTCTGATGAAGAAAGCCATCATGATGAGATGAGTGAGCAGGAAGAG
GAGCTTGAGGATGATCCTACTGTAGTCAAAAACTATAAAGACCTGGAAAAAGCAGTTCAGTCTTTTCGGTATGATGTTGTCCTGAAGACG
GGGCTAGATATTGGGAGAAATTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_C6orf203_ENST00000405204_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_3298nt
AGATAGGGGTAGCCTGGAGGCCTGCAGTCCGCGCGGCCGCGGGGAGGGACGAGAGGGCCTGACGTACAGGTGAGTGCGCCTCTGCTGGCG
CGCCGCGCCGGGCCCCCTGCCCGCGCCCCCTGTCACTTCGCCTCTCCGCCCCGCCCACGCTCCCGCCGGGTCTCCCCGTGAGTGTCCCGT
GTCCTGCCAGCCTCGGGACGCCCCGCGAGCTCAGGGCTGCGCAGGGACTGTGGTAATTGAGCGCGGCGAAGCCTTCCGTTCCTGCCTCCT
GTCGCTCCTGCTGGCTCCGAATGCAGACTGCGAACCCGGGGACGCAGTTGTCCATTTCCTTTGACCTTGGGGACCCAGGAAGGTGCACTG
CCCGCGGGGGTGGGGAGGGAGCGAGAGGAATCCGACCCTGTCTCAGCCCACAGCCTCCGAGGTCTCCAAGTAAAGGGAAGGATCTTTAGC
TGCATTAGACTTCAAAGCGTTTAGACCAGTTTCTCCATCTTACGGAGCGGTGAACGGGCTCAGGAATGTGGAGCGTTTCCTGGCGTCAAG
CAGGTCAAAGTCAGCGCTGCTTTTTTTACAGACACTGCTTTTCTTACAGTCTTCGATTATAAGCGCCATGGCTATGGCTAGTGTTAAATT
GCTTGCCGGTGTTTTAAGAAAGCCAGATGCCTGGATTGGACTCTGGGGTGTTCTCCGAGGGACACCTTCATCATACAAACTCTGTACTTC
CTGGAATCGATACTTGTATTTTTCTAGTACCAAGTTACGTGCACCAAATTATAAAACACTTTTTTATAATATTTTCTCACTGAGACTCCC
AGGGCTTTTACTATCTCCAGAATGTATTTTTCCTTTTTCCGTAAGACTCAAAAGTAATATAAGGTCTACAAAATCTACTAAAAAGTCTCT
GCAAAAAGTAGATGAAGAGGACTCTGATGAAGAAAGCCATCATGATGAGATGAGTGAGCAGGAAGAGGAGCTTGAGGATGATCCTACTGT
AGTCAAAAACTATAAAGACCTGGAAAAAGCAGTTCAGTCTTTTCGGTATGATGTTGTCCTGAAGACGGGGCTAGATATTGGGAGAAATTG
CGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGC
TTTCCTCCCTCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTTTGCTGTGACCAGATTTTCATGACATCAAATTAAAAAGACACTATTG
TTAGTTAGCTGAAAATCCTAGGGAATGAGGTTGATTGGGAGCGCTTTCACGATGCGTTAATGACTTTTAAAACATATGCATTTTTCCTTC
CTTTTATCACATTGCTAAATGAGTTCTGCTTTCTTTTTGGAACTGCTACAAACAAAATTAGAAGAAAAAAAGGTCAAGCAGTTTTCACTT
GTCACGCCAGAAGCACACTTGAGGCTGCAGTCGCAGAAATAATTAATGAGATTCGCTCCTGTGACCTCAGCAAATGGACAGGAAATAAGT
CCTTATTGATTGGACCGAGCCAGGGATGGCGCCAGGGCGGTGGCCTGTGGTTTTTCCTGCTAGAGAGGACAAAGCAAGTTGGAAGCTGCA
GGTGTCAAGAGAAATGCTCTCAATACCAACCAGGGAGGATTGTCTAATCAAAAACTAGTGACCAATTTGTCATAATGGAGAGTAGTTCAA
TGGATTGAGAAAAATATGTTTTATTTGTTGGCTTGTAATTATGTCTCTGGATTATTATTATTTTTTTTTTAGATGTAGTTTTGCTCTTGT
TGCCCAGGCTGGAGTGCAATGGTGCAGTTTTGACTCACTGCAACCTCCGCCTCCTGGGTTCAAGTGATTCTCCTGCCTCAGCCTCCCGAG
TAGCTGGAATTACAGGCACCTGCCACCACGCCTGGCTAATTTTGTATTTTTAGTAGAGATGGGGTTTCACTATGTTGGTCAGGCTAGTCT
CGAACTCCTGACCTCAGGTGATCCGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTAGAGGCTTGAGCCACTGCACCTGGCCTCATGTCTC
TGGATTTATAATGCAGTATGAATATACTTTGTGCTTTATGGTTTTTATAATGTCTTTTTGGAGAAATTGCCGAAAAGTTGCCAAATACTT
GAAGTAGGAGATTAAAATGTTATCAAATGTTAAATTGGTTATATTAGGAATAGTCTGTTTTTCTTTCCTGAAGATCAGTTTTTTTATTCA
AACACATTTCAAAGAACCAAATTTTTTTTTTCTTTAAGGAAAAAGGAGCTTTTTTTCAAGTGAAATGTATTCATTTGTAATACTTTGGTT
TAAGGCATACTTTAATTTTTACGAGTTTCAGAAACAGAATTTTTGTACTAGGGAATTCATTGGTGAGAGTGTTCTTTTAACCTCAGAATG
TCAAATTTTGGTCTTGAACCACAGACATCCAATTACAGAAAGAATATAAGCAATCTCACAGGCCTGCAATCGGACACTGTCTCTGTGTGG
TTCATAGGAGATGATTTTTGAGGTTTGCACTCATGCAATTTGAGAACACCGTTGACAAGAAGGCTGAGTTTACATAAATGATCTAGATTG
AAACTCAGCTACCTTTCTTCCTCATGTGGTGTAATTACAGCCCTATCTGGAGACAGCGAATACAGCAAACAGATTTTATTACCTAGTTCG
CTCAAACACTACATGAAGTTATTTTAGTTAAAGCCCTCCCCCAAAAGTTATAAAACCATTTTATCAGGGCCCAACATGTGGCATGCAATG
AAGAGAAAATGTAAAGCTACAGAGGTTAATGTATTGTATTATAAAATATTTTAAGTGTACTCAAAATATCATAATTGTACAGTTTATGCC
ACCATAATTTGAGGCCTATAGATTTAGCTTAAGAGAACACTGTTCTGTTTGAAATGCTTTCTGTCACTGAAATTGGCTTAATTAGTAACC
ATGGATAAGATGCTTTAGATCAGACTAGGTTTTAATCATTAACTTCCACAAAGAAGTCATACTTTGCGTTAGGTGTGCTGGTTGGATGTG
CAGGAACTTCAGCAAGCAGTAGGTTTTACTAAGCAGATGGTCGGGCACTGCAGGGCACCAGGCAGGATCCTAGGGCGCCTCTTATTCTGC
GTTAGCATCTGGTTTGCTGTATGACCTTGCACAAGTCACTTCCTTCTGAGCCTCAATTTTCTCATCTGTACAATGAGATTCAAAAGTTGA

>In-frame_C6orf203_ENST00000443043_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_3381nt
AGATAGGGGTAGCCTGGAGGCCTGCAGTCCGCGCGGCCGCGGGGAGGGACGAGAGGGCCTGACGTACAGGTGAGTGCGCCTCTGCTGGCG
CGCCGCGCCGGGCCCCCTGCCCGCGCCCCCTGTCACTTCGCCTCTCCGCCCCGCCCACGCTCCCGCCGGGTCTCCCCGTGAGTGTCCCGT
GTCCTGCCAGCCTCGGGACGCCCCGCGAGCTCAGGGCTGCGCAGGGACTGTGGTAATTGAGCGCGGCGAAGCCTTCCGTTCCTGCCTCCT
GTCGCTCCTGCTGGCTCCGAATGCAGACTGCGAACCCGGGGACGCAGTTGTCCATTTCCTTTGACCTTGGGGACCCAGGAAGGTGCACTG
CCCGCGGGGGTGGGGAGGGAGCGAGAGGAATCCGACCCTGTCTCAGCCCACAGCCTCCGAGGTCTCCAAGTAAAGGGAAGGATCTTTAGC
TGCATTAGACTTCAAAGCGTTTAGACCAGTTTCTCCATCTTACGGAGCGGTGAACGGGCTCAGGAATGTGGAGCGTTTCCTGGCGTCAAG
CAGGTCAAAGTCAGCGCTGCTTTTTTTACAGACACTGCTTTTCTTACAGTCTTCGACTATAAACTCTACAAGAATAGGAATCTTCGTATT
TTTTTCCTCTGCTGAATTCCTAGTGCCCAGATTAGTGCTTGGCACATGATTATAAGCGCCATGGCTATGGCTAGTGTTAAATTGCTTGCC
GGTGTTTTAAGAAAGCCAGATGCCTGGATTGGACTCTGGGGTGTTCTCCGAGGGACACCTTCATCATACAAACTCTGTACTTCCTGGAAT
CGATACTTGTATTTTTCTAGTACCAAGTTACGTGCACCAAATTATAAAACACTTTTTTATAATATTTTCTCACTGAGACTCCCAGGGCTT
TTACTATCTCCAGAATGTATTTTTCCTTTTTCCGTAAGACTCAAAAGTAATATAAGGTCTACAAAATCTACTAAAAAGTCTCTGCAAAAA
GTAGATGAAGAGGACTCTGATGAAGAAAGCCATCATGATGAGATGAGTGAGCAGGAAGAGGAGCTTGAGGATGATCCTACTGTAGTCAAA
AACTATAAAGACCTGGAAAAAGCAGTTCAGTCTTTTCGGTATGATGTTGTCCTGAAGACGGGGCTAGATATTGGGAGAAATTGCGAGAAA
GAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGAGAGCTTTCCTC
CCTCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTTTGCTGTGACCAGATTTTCATGACATCAAATTAAAAAGACACTATTGTTAGTTA
GCTGAAAATCCTAGGGAATGAGGTTGATTGGGAGCGCTTTCACGATGCGTTAATGACTTTTAAAACATATGCATTTTTCCTTCCTTTTAT
CACATTGCTAAATGAGTTCTGCTTTCTTTTTGGAACTGCTACAAACAAAATTAGAAGAAAAAAAGGTCAAGCAGTTTTCACTTGTCACGC
CAGAAGCACACTTGAGGCTGCAGTCGCAGAAATAATTAATGAGATTCGCTCCTGTGACCTCAGCAAATGGACAGGAAATAAGTCCTTATT
GATTGGACCGAGCCAGGGATGGCGCCAGGGCGGTGGCCTGTGGTTTTTCCTGCTAGAGAGGACAAAGCAAGTTGGAAGCTGCAGGTGTCA
AGAGAAATGCTCTCAATACCAACCAGGGAGGATTGTCTAATCAAAAACTAGTGACCAATTTGTCATAATGGAGAGTAGTTCAATGGATTG
AGAAAAATATGTTTTATTTGTTGGCTTGTAATTATGTCTCTGGATTATTATTATTTTTTTTTTAGATGTAGTTTTGCTCTTGTTGCCCAG
GCTGGAGTGCAATGGTGCAGTTTTGACTCACTGCAACCTCCGCCTCCTGGGTTCAAGTGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGG
AATTACAGGCACCTGCCACCACGCCTGGCTAATTTTGTATTTTTAGTAGAGATGGGGTTTCACTATGTTGGTCAGGCTAGTCTCGAACTC
CTGACCTCAGGTGATCCGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTAGAGGCTTGAGCCACTGCACCTGGCCTCATGTCTCTGGATTT
ATAATGCAGTATGAATATACTTTGTGCTTTATGGTTTTTATAATGTCTTTTTGGAGAAATTGCCGAAAAGTTGCCAAATACTTGAAGTAG
GAGATTAAAATGTTATCAAATGTTAAATTGGTTATATTAGGAATAGTCTGTTTTTCTTTCCTGAAGATCAGTTTTTTTATTCAAACACAT
TTCAAAGAACCAAATTTTTTTTTTCTTTAAGGAAAAAGGAGCTTTTTTTCAAGTGAAATGTATTCATTTGTAATACTTTGGTTTAAGGCA
TACTTTAATTTTTACGAGTTTCAGAAACAGAATTTTTGTACTAGGGAATTCATTGGTGAGAGTGTTCTTTTAACCTCAGAATGTCAAATT
TTGGTCTTGAACCACAGACATCCAATTACAGAAAGAATATAAGCAATCTCACAGGCCTGCAATCGGACACTGTCTCTGTGTGGTTCATAG
GAGATGATTTTTGAGGTTTGCACTCATGCAATTTGAGAACACCGTTGACAAGAAGGCTGAGTTTACATAAATGATCTAGATTGAAACTCA
GCTACCTTTCTTCCTCATGTGGTGTAATTACAGCCCTATCTGGAGACAGCGAATACAGCAAACAGATTTTATTACCTAGTTCGCTCAAAC
ACTACATGAAGTTATTTTAGTTAAAGCCCTCCCCCAAAAGTTATAAAACCATTTTATCAGGGCCCAACATGTGGCATGCAATGAAGAGAA
AATGTAAAGCTACAGAGGTTAATGTATTGTATTATAAAATATTTTAAGTGTACTCAAAATATCATAATTGTACAGTTTATGCCACCATAA
TTTGAGGCCTATAGATTTAGCTTAAGAGAACACTGTTCTGTTTGAAATGCTTTCTGTCACTGAAATTGGCTTAATTAGTAACCATGGATA
AGATGCTTTAGATCAGACTAGGTTTTAATCATTAACTTCCACAAAGAAGTCATACTTTGCGTTAGGTGTGCTGGTTGGATGTGCAGGAAC
TTCAGCAAGCAGTAGGTTTTACTAAGCAGATGGTCGGGCACTGCAGGGCACCAGGCAGGATCCTAGGGCGCCTCTTATTCTGCGTTAGCA
TCTGGTTTGCTGTATGACCTTGCACAAGTCACTTCCTTCTGAGCCTCAATTTTCTCATCTGTACAATGAGATTCAAAAGTTGACCTGAAA

>In-frame_C6orf203_ENST00000311381_chr6_107361434_+_PDSS2_ENST00000369037_chr6_107475981_-_2762nt
AGCCTGGAGGCCTGCAGTCCGCGCGGCCGCGGGGAGGGACGAGAGGGCCTGACGTACAGATTATAAGCGCCATGGCTATGGCTAGTGTTA
AATTGCTTGCCGGTGTTTTAAGAAAGCCAGATGCCTGGATTGGACTCTGGGGTGTTCTCCGAGGGACACCTTCATCATACAAACTCTGTA
CTTCCTGGAATCGATACTTGTATTTTTCTAGTACCAAGTTACGTGCACCAAATTATAAAACACTTTTTTATAATATTTTCTCACTGAGAC
TCCCAGGGCTTTTACTATCTCCAGAATGTATTTTTCCTTTTTCCGTAAGACTCAAAAGTAATATAAGGTCTACAAAATCTACTAAAAAGT
CTCTGCAAAAAGTAGATGAAGAGGACTCTGATGAAGAAAGCCATCATGATGAGATGAGTGAGCAGGAAGAGGAGCTTGAGGATGATCCTA
CTGTAGTCAAAAACTATAAAGACCTGGAAAAAGCAGTTCAGTCTTTTCGGTATGATGTTGTCCTGAAGACGGGGCTAGATATTGGGAGAA
ATTGCGAGAAAGAATCAAAGCTGGCAAAGGTGTGACTTCAGCTATTGACCTGTGTCGTTACCATGGAAACAAGGCACTGGAGGCCCTGGA
GAGCTTTCCTCCCTCGGAGGCCAGATCTGCTTTAGAAAACATTGTGTTTGCTGTGACCAGATTTTCATGACATCAAATTAAAAAGACACT
ATTGTTAGTTAGCTGAAAATCCTAGGGAATGAGGTTGATTGGGAGCGCTTTCACGATGCGTTAATGACTTTTAAAACATATGCATTTTTC
CTTCCTTTTATCACATTGCTAAATGAGTTCTGCTTTCTTTTTGGAACTGCTACAAACAAAATTAGAAGAAAAAAAGGTCAAGCAGTTTTC
ACTTGTCACGCCAGAAGCACACTTGAGGCTGCAGTCGCAGAAATAATTAATGAGATTCGCTCCTGTGACCTCAGCAAATGGACAGGAAAT
AAGTCCTTATTGATTGGACCGAGCCAGGGATGGCGCCAGGGCGGTGGCCTGTGGTTTTTCCTGCTAGAGAGGACAAAGCAAGTTGGAAGC
TGCAGGTGTCAAGAGAAATGCTCTCAATACCAACCAGGGAGGATTGTCTAATCAAAAACTAGTGACCAATTTGTCATAATGGAGAGTAGT
TCAATGGATTGAGAAAAATATGTTTTATTTGTTGGCTTGTAATTATGTCTCTGGATTATTATTATTTTTTTTTTAGATGTAGTTTTGCTC
TTGTTGCCCAGGCTGGAGTGCAATGGTGCAGTTTTGACTCACTGCAACCTCCGCCTCCTGGGTTCAAGTGATTCTCCTGCCTCAGCCTCC
CGAGTAGCTGGAATTACAGGCACCTGCCACCACGCCTGGCTAATTTTGTATTTTTAGTAGAGATGGGGTTTCACTATGTTGGTCAGGCTA
GTCTCGAACTCCTGACCTCAGGTGATCCGCCTGCCTCGGCCTCCCAAAGTGCTGGGATTAGAGGCTTGAGCCACTGCACCTGGCCTCATG
TCTCTGGATTTATAATGCAGTATGAATATACTTTGTGCTTTATGGTTTTTATAATGTCTTTTTGGAGAAATTGCCGAAAAGTTGCCAAAT
ACTTGAAGTAGGAGATTAAAATGTTATCAAATGTTAAATTGGTTATATTAGGAATAGTCTGTTTTTCTTTCCTGAAGATCAGTTTTTTTA
TTCAAACACATTTCAAAGAACCAAATTTTTTTTTTCTTTAAGGAAAAAGGAGCTTTTTTTCAAGTGAAATGTATTCATTTGTAATACTTT
GGTTTAAGGCATACTTTAATTTTTACGAGTTTCAGAAACAGAATTTTTGTACTAGGGAATTCATTGGTGAGAGTGTTCTTTTAACCTCAG
AATGTCAAATTTTGGTCTTGAACCACAGACATCCAATTACAGAAAGAATATAAGCAATCTCACAGGCCTGCAATCGGACACTGTCTCTGT
GTGGTTCATAGGAGATGATTTTTGAGGTTTGCACTCATGCAATTTGAGAACACCGTTGACAAGAAGGCTGAGTTTACATAAATGATCTAG
ATTGAAACTCAGCTACCTTTCTTCCTCATGTGGTGTAATTACAGCCCTATCTGGAGACAGCGAATACAGCAAACAGATTTTATTACCTAG
TTCGCTCAAACACTACATGAAGTTATTTTAGTTAAAGCCCTCCCCCAAAAGTTATAAAACCATTTTATCAGGGCCCAACATGTGGCATGC
AATGAAGAGAAAATGTAAAGCTACAGAGGTTAATGTATTGTATTATAAAATATTTTAAGTGTACTCAAAATATCATAATTGTACAGTTTA
TGCCACCATAATTTGAGGCCTATAGATTTAGCTTAAGAGAACACTGTTCTGTTTGAAATGCTTTCTGTCACTGAAATTGGCTTAATTAGT
AACCATGGATAAGATGCTTTAGATCAGACTAGGTTTTAATCATTAACTTCCACAAAGAAGTCATACTTTGCGTTAGGTGTGCTGGTTGGA
TGTGCAGGAACTTCAGCAAGCAGTAGGTTTTACTAAGCAGATGGTCGGGCACTGCAGGGCACCAGGCAGGATCCTAGGGCGCCTCTTATT
CTGCGTTAGCATCTGGTTTGCTGTATGACCTTGCACAAGTCACTTCCTTCTGAGCCTCAATTTTCTCATCTGTACAATGAGATTCAAAAG


Top

FusionGenePPI for C6orf203_PDSS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
C6orf203ICT1, APP, COPS5, C6orf203, WBSCR16, SLC30A9, MRPL1, MRPL9, MRPL40, MRPL33, NRD1, MRPL22, MRPL13, MRPL16, POLDIP2, MRPL46, MRPL35, MRPL21, MRPL2, MRPL32, ATP5E, PMPCA, NDUFV1, ECH1, MRPL14, ATP5O, C1QBP, MRPL53, CPNE7PDSS2ELAVL1, APP, OXLD1, ACAD9, SDHA, THEM4, FDPS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for C6orf203_PDSS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for C6orf203_PDSS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePDSS2C3553358COENZYME Q10 DEFICIENCY, PRIMARY, 31UNIPROT