FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4716

FusionGeneSummary for C15orf41_RAC2

check button Fusion gene summary
Fusion gene informationFusion gene name: C15orf41_RAC2
Fusion gene ID: 4716
HgeneTgene
Gene symbol

C15orf41

RAC2

Gene ID

84529

5880

Gene namechromosome 15 open reading frame 41Rac family small GTPase 2
SynonymsHH114EN-7|Gx|HSPC022|p21-Rac2
Cytomap

15q14

22q13.1

Type of geneprotein-codingprotein-coding
Descriptionuncharacterized protein C15orf41ras-related C3 botulinum toxin substrate 2Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP-binding protein Rac2)ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)small G protein
Modification date2018051920180523
UniProtAcc

Q9Y2V0

P15153

Ensembl transtripts involved in fusion geneENST00000566621, ENST00000437989, 
ENST00000569302, ENST00000567389, 
ENST00000562877, ENST00000338183, 
ENST00000565792, ENST00000562489, 
ENST00000563167, 
ENST00000249071, 
ENST00000406508, ENST00000405484, 
ENST00000401529, 
Fusion gene scores* DoF score8 X 3 X 6=1445 X 4 X 5=100
# samples 85
** MAII scorelog2(8/144*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: C15orf41 [Title/Abstract] AND RAC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRAC2

GO:0060263

regulation of respiratory burst

16636067


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A19C-06AC15orf41chr15

37002162

+RAC2chr22

37628958

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000566621ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000566621ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000566621ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-intronENST00000566621ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
In-frameENST00000437989ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000437989ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000437989ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-intronENST00000437989ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
In-frameENST00000569302ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000569302ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000569302ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-intronENST00000569302ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
In-frameENST00000567389ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000567389ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000567389ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-intronENST00000567389ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
In-frameENST00000562877ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000562877ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000562877ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-intronENST00000562877ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
In-frameENST00000338183ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000338183ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000338183ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-intronENST00000338183ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
3UTR-3CDSENST00000565792ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
3UTR-5UTRENST00000565792ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
3UTR-5UTRENST00000565792ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
3UTR-intronENST00000565792ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
In-frameENST00000562489ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000562489ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-5UTRENST00000562489ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
5CDS-intronENST00000562489ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-
intron-3CDSENST00000563167ENST00000249071C15orf41chr15

37002162

+RAC2chr22

37628958

-
intron-5UTRENST00000563167ENST00000406508C15orf41chr15

37002162

+RAC2chr22

37628958

-
intron-5UTRENST00000563167ENST00000405484C15orf41chr15

37002162

+RAC2chr22

37628958

-
intron-intronENST00000563167ENST00000401529C15orf41chr15

37002162

+RAC2chr22

37628958

-

Top

FusionProtFeatures for C15orf41_RAC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
C15orf41

Q9Y2V0

RAC2

P15153

Plasma membrane-associated small GTPase which cyclesbetween an active GTP-bound and inactive GDP-bound state. Inactive state binds to a variety of effector proteins to regulatecellular responses, such as secretory processes, phagocytose ofapoptotic cells and epithelial cell polarization. Augments theproduction of reactive oxygen species (ROS) by NADPH oxidase.{ECO:0000269|PubMed:1660188}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRAC2chr15:37002162chr22:37628958ENST00000249071-1732_4035420MotifEffector region
TgeneRAC2chr15:37002162chr22:37628958ENST00000249071-17115_11835420Nucleotide bindingGTP
TgeneRAC2chr15:37002162chr22:37628958ENST00000249071-1757_6135420Nucleotide bindingGTP

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRAC2chr15:37002162chr22:37628958ENST00000249071-1710_1735420Nucleotide bindingGTP


Top

FusionGeneSequence for C15orf41_RAC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_C15orf41_ENST00000566621_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_396aa
MILTKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESTYQRYLNGVVKNGAAPVLLDLAN
EVDTAPSLMARLILERFLQEHEETPPSKSIINSMLRDPSQIPDGVLANQVTQCIVNDCCYGPLVDCIKHAIGHEHEVLLRDLLLEKNLSF
LDEDQLRAKGTDKTPDFILQVPVAVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWNRFDNTSANVMVDSKPVNLGLWDTAGQEDYDRL
RPLSTPQTDVFLICFSLVSPASTENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLEC

>In-frame_C15orf41_ENST00000437989_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_396aa
MILTKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESTYQRYLNGVVKNGAAPVLLDLAN
EVDTAPSLMARLILERFLQEHEETPPSKSIINSMLRDPSQIPDGVLANQVTQCIVNDCCYGPLVDCIKHAIGHEHEVLLRDLLLEKNLSF
LDEDQLRAKGTDKTPDFILQVPVAVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWNRFDNTSANVMVDSKPVNLGLWDTAGQEDYDRL
RPLSTPQTDVFLICFSLVSPASTENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLEC

>In-frame_C15orf41_ENST00000569302_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_402aa
MILTKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESTYQRYLNGVVKNGAAPVLLDLAN
EVDTAPSLMARLILERFLQEHEETPPSKSIINSMLRDPSQIPDGVLANQVTQCIVNDCCYGPLVDCIKHAIGHEHEVLLRDLLLEKNLSF
LDEDQLRAKGTDKTPDFILQVPVVMLCPLAVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWNRFDNTSANVMVDSKPVNLGLWDTAGQ
EDYDRLRPLSTPQTDVFLICFSLVSPASTENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDS

>In-frame_C15orf41_ENST00000567389_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_298aa
MARLILERFLQEHEETPPSKSIINSMLRDPSQIPDGVLANQVTQCIVNDCCYGPLVDCIKHAIGHEHEVLLRDLLLEKNLSFLDEDQLRA
KGTDKTPDFILQVPVAVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWNRFDNTSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSTPQT
DVFLICFSLVSPASTENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGL

>In-frame_C15orf41_ENST00000562877_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_298aa
MARLILERFLQEHEETPPSKSIINSMLRDPSQIPDGVLANQVTQCIVNDCCYGPLVDCIKHAIGHEHEVLLRDLLLEKNLSFLDEDQLRA
KGTDKTPDFILQVPVAVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWNRFDNTSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSTPQT
DVFLICFSLVSPASTENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGL

>In-frame_C15orf41_ENST00000338183_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_298aa
MARLILERFLQEHEETPPSKSIINSMLRDPSQIPDGVLANQVTQCIVNDCCYGPLVDCIKHAIGHEHEVLLRDLLLEKNLSFLDEDQLRA
KGTDKTPDFILQVPVAVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWNRFDNTSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSTPQT
DVFLICFSLVSPASTENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGL

>In-frame_C15orf41_ENST00000562489_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_220aa
MSVAENEDQLRAKGTDKTPDFILQVPVAVEGHIIHWIESKASFGDECSHHAYLHDQFWSYWNRFDNTSANVMVDSKPVNLGLWDTAGQED
YDRLRPLSTPQTDVFLICFSLVSPASTENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_C15orf41_ENST00000566621_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1188nt
ATGATACTGACCAAAGCTCAGTACGACGAGATAGCCCAGTGCCTAGTGTCTGTGCCGCCTACCAGGCAGAGCCTGAGGAAGCTGAAGCAG
AGGTTTCCCAGTCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAACACATGCCAAACATCAT
ACTTCGGAAGCAATTGAAAGTTATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGCTCCTGGACCTGGCCAAT
GAGGTGGACTATGCGCCCTCATTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATT
ATAAATAGTATGCTACGGGACCCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTAC
GGACCACTAGTGGACTGCATCAAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTC
CTAGATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATT
CACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTT
GACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTC
CGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGG
TTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAG
AAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGC
TCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGAAGCGC

>In-frame_C15orf41_ENST00000437989_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1188nt
ATGATACTGACCAAAGCTCAGTACGACGAGATAGCCCAGTGCCTAGTGTCTGTGCCGCCTACCAGGCAGAGCCTGAGGAAGCTGAAGCAG
AGGTTTCCCAGTCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAACACATGCCAAACATCAT
ACTTCGGAAGCAATTGAAAGTTATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGCTCCTGGACCTGGCCAAT
GAGGTGGACTATGCGCCCTCATTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATT
ATAAATAGTATGCTACGGGACCCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTAC
GGACCACTAGTGGACTGCATCAAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTC
CTAGATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATT
CACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTT
GACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTC
CGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGG
TTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAG
AAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGC
TCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGAAGCGC

>In-frame_C15orf41_ENST00000569302_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1206nt
ATGATACTGACCAAAGCTCAGTACGACGAGATAGCCCAGTGCCTAGTGTCTGTGCCGCCTACCAGGCAGAGCCTGAGGAAGCTGAAGCAG
AGGTTTCCCAGTCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAACACATGCCAAACATCAT
ACTTCGGAAGCAATTGAAAGTTATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGCTCCTGGACCTGGCCAAT
GAGGTGGACTATGCGCCCTCATTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATT
ATAAATAGTATGCTACGGGACCCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTAC
GGACCACTAGTGGACTGCATCAAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTC
CTAGATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGTAATGCTTTGTCCCTTAGCT
GTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGG
AGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAG
GAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAG
AACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGAC
GACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCG
GTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCC

>In-frame_C15orf41_ENST00000567389_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_894nt
ATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATTATAAATAGTATGCTACGGGACCCT
TCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTACGGACCACTAGTGGACTGCATCAAG
CATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTCCTAGATGAAGATCAGCTTCGTGCA
AAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCCTCA
TTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTGATG
GTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAGACG
GACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGC
CCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCT
CCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTG

>In-frame_C15orf41_ENST00000562877_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_894nt
ATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATTATAAATAGTATGCTACGGGACCCT
TCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTACGGACCACTAGTGGACTGCATCAAG
CATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTCCTAGATGAAGATCAGCTTCGTGCA
AAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCCTCA
TTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTGATG
GTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAGACG
GACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGC
CCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCT
CCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTG

>In-frame_C15orf41_ENST00000338183_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_894nt
ATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATTATAAATAGTATGCTACGGGACCCT
TCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTACGGACCACTAGTGGACTGCATCAAG
CATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTCCTAGATGAAGATCAGCTTCGTGCA
AAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCCTCA
TTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTGATG
GTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAGACG
GACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGC
CCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCT
CCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTG

>In-frame_C15orf41_ENST00000562489_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_660nt
ATGTCAGTGGCAGAGAATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAA
GGGCACATAATTCACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTAC
TGGAATAGGTTTGACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGAC
TACGACCGTCTCCGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTC
CGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAG
GACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAA
TACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_C15orf41_ENST00000566621_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_2219nt
AAGCCAAGCTAGGGCACTCTGGTGTACAGCCAGTCCCCGCCGCGGAGGTGCCGGTGGAGCCTGGGACCGGGCGAGTCTCCGCCCCGCTTT
TGCAGCTAGGGGTGTGTTTCAGGGGGGATTGGGGCAAGCCAAGCAGGCGAGGACCCGGGCCTGTGCCGCTTTGCCTACCCCTCATCCCTC
GGCACCAAGGCTACTTGAGCCCCAGGGTGTTTTTTCCTTGTTCCCGCCACCTCCTGGTCCCTGGCCCAACATGATACTGACCAAAGCTCA
GTACGACGAGATAGCCCAGTGCCTAGTGTCTGTGCCGCCTACCAGGCAGAGCCTGAGGAAGCTGAAGCAGAGGTTTCCCAGTCAATCGCA
GGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAACACATGCCAAACATCATACTTCGGAAGCAATTGAAAG
TTATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGCTCCTGGACCTGGCCAATGAGGTGGACTATGCGCCCTC
ATTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATTATAAATAGTATGCTACGGGA
CCCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTACGGACCACTAGTGGACTGCAT
CAAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTCCTAGATGAAGATCAGCTTCG
TGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGC
CTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGT
GATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACA
GACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCA
CTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCT
GGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGG
CCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGAAGCGCGCCTGCAGCCTCCTCTAGGG
GTTGCACCCCAGCGCTCCCACCTAGATGGGTCTGATCCTCCAGGATCCCCACCCAAAGCCTGATGGCACCCCGGCTGGCCATGCTGTCCC
CTCCCTGTGGCGTTTCTTAGCAGATGGCTGCAGAGCTTCGTTGATGGTCTTTTCTGTACTGGAGGCCTCCTGAGGCCAGGAACGTGCAAA
TTTGCAGGTGCTGCATCCCAAGCCCCTCATGCTCCTGCCTTCCTGAGGGCCAGAGGGGAGCCCCAGGACCCATTAAGCCACCCCCGTGTT
CCTGCCGTCAGTGCCAACTGCCGCATGTGGAAGCATCTACCCGTTCACTCCAGTCCCACCCCACGCCTGACTCCCCTCTGGAAACTGCAG
GCCAGATGGTTGCTGCCACAACTTGTGTACCTTCAGGGATGGGGCTCTTACTCCCTCCTGAGGCCAGCTGCTCTAATATCGATGGTCCTG
CTTGCCAGAGAGTTCCTCTACCCAGCAAAAATGAGTGTCTCAGAAGTGTGCTCCTCTGGCCTCAGTTCTCCTCTTTTGGAACAACATAAA
ACAAATTTAATTTTCTACGCCTCTGGGGATATCTGCTCAGCCAATGGAAAATCTGGGTTCAACCAGCCCCTGCCATTTCTTAAGACTTTC
TGCTGCACTCACAGGATCCTGAGCTGCACTTACCTGTGAGAGTCTTCAAACTTTTAAACCTTGCCAGTCAGGACTTTTGCTATTGCAAAT

>In-frame_C15orf41_ENST00000437989_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1986nt
CTGGTCCCTGGCCCAACATGATACTGACCAAAGCTCAGTACGACGAGATAGCCCAGTGCCTAGTGTCTGTGCCGCCTACCAGGCAGAGCC
TGAGGAAGCTGAAGCAGAGGTTTCCCAGTCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAA
CACATGCCAAACATCATACTTCGGAAGCAATTGAAAGTTATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGC
TCCTGGACCTGGCCAATGAGGTGGACTATGCGCCCTCATTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTC
CACCCTCCAAGTCTATTATAAATAGTATGCTACGGGACCCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTG
TGAACGACTGCTGTTACGGACCACTAGTGGACTGCATCAAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAG
AGAAAAACCTGTCCTTCCTAGATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTG
TAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGA
GCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGG
AGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGA
ACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACG
ACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGG
TGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCA
CGCGGCAGCAGAAGCGCGCCTGCAGCCTCCTCTAGGGGTTGCACCCCAGCGCTCCCACCTAGATGGGTCTGATCCTCCAGGATCCCCACC
CAAAGCCTGATGGCACCCCGGCTGGCCATGCTGTCCCCTCCCTGTGGCGTTTCTTAGCAGATGGCTGCAGAGCTTCGTTGATGGTCTTTT
CTGTACTGGAGGCCTCCTGAGGCCAGGAACGTGCAAATTTGCAGGTGCTGCATCCCAAGCCCCTCATGCTCCTGCCTTCCTGAGGGCCAG
AGGGGAGCCCCAGGACCCATTAAGCCACCCCCGTGTTCCTGCCGTCAGTGCCAACTGCCGCATGTGGAAGCATCTACCCGTTCACTCCAG
TCCCACCCCACGCCTGACTCCCCTCTGGAAACTGCAGGCCAGATGGTTGCTGCCACAACTTGTGTACCTTCAGGGATGGGGCTCTTACTC
CCTCCTGAGGCCAGCTGCTCTAATATCGATGGTCCTGCTTGCCAGAGAGTTCCTCTACCCAGCAAAAATGAGTGTCTCAGAAGTGTGCTC
CTCTGGCCTCAGTTCTCCTCTTTTGGAACAACATAAAACAAATTTAATTTTCTACGCCTCTGGGGATATCTGCTCAGCCAATGGAAAATC
TGGGTTCAACCAGCCCCTGCCATTTCTTAAGACTTTCTGCTGCACTCACAGGATCCTGAGCTGCACTTACCTGTGAGAGTCTTCAAACTT
TTAAACCTTGCCAGTCAGGACTTTTGCTATTGCAAATAGAAAACCCAACTCAACCTGCTTAAGCAGAAAATAAATTTATTGATTCAAGTT

>In-frame_C15orf41_ENST00000569302_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_2000nt
TCCCTGGCCCAACATGATACTGACCAAAGCTCAGTACGACGAGATAGCCCAGTGCCTAGTGTCTGTGCCGCCTACCAGGCAGAGCCTGAG
GAAGCTGAAGCAGAGGTTTCCCAGTCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAACACA
TGCCAAACATCATACTTCGGAAGCAATTGAAAGTTATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGCTCCT
GGACCTGGCCAATGAGGTGGACTATGCGCCCTCATTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACC
CTCCAAGTCTATTATAAATAGTATGCTACGGGACCCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAA
CGACTGCTGTTACGGACCACTAGTGGACTGCATCAAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAA
AAACCTGTCCTTCCTAGATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGTAATGCT
TTGTCCCTTAGCTGTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCA
TGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGA
CACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCC
AGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCT
GGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAA
GGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCT
GTGCCCTCAGCCCACGCGGCAGCAGAAGCGCGCCTGCAGCCTCCTCTAGGGGTTGCACCCCAGCGCTCCCACCTAGATGGGTCTGATCCT
CCAGGATCCCCACCCAAAGCCTGATGGCACCCCGGCTGGCCATGCTGTCCCCTCCCTGTGGCGTTTCTTAGCAGATGGCTGCAGAGCTTC
GTTGATGGTCTTTTCTGTACTGGAGGCCTCCTGAGGCCAGGAACGTGCAAATTTGCAGGTGCTGCATCCCAAGCCCCTCATGCTCCTGCC
TTCCTGAGGGCCAGAGGGGAGCCCCAGGACCCATTAAGCCACCCCCGTGTTCCTGCCGTCAGTGCCAACTGCCGCATGTGGAAGCATCTA
CCCGTTCACTCCAGTCCCACCCCACGCCTGACTCCCCTCTGGAAACTGCAGGCCAGATGGTTGCTGCCACAACTTGTGTACCTTCAGGGA
TGGGGCTCTTACTCCCTCCTGAGGCCAGCTGCTCTAATATCGATGGTCCTGCTTGCCAGAGAGTTCCTCTACCCAGCAAAAATGAGTGTC
TCAGAAGTGTGCTCCTCTGGCCTCAGTTCTCCTCTTTTGGAACAACATAAAACAAATTTAATTTTCTACGCCTCTGGGGATATCTGCTCA
GCCAATGGAAAATCTGGGTTCAACCAGCCCCTGCCATTTCTTAAGACTTTCTGCTGCACTCACAGGATCCTGAGCTGCACTTACCTGTGA
GAGTCTTCAAACTTTTAAACCTTGCCAGTCAGGACTTTTGCTATTGCAAATAGAAAACCCAACTCAACCTGCTTAAGCAGAAAATAAATT

>In-frame_C15orf41_ENST00000567389_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1948nt
AAGCTCAGCTTTCTGTTTAGTTGTGAGATTGCATACTCAAGAAGAGGAGGAACATAAAATACGTGATGTCTTCTCTTAAGTCAATCGCAG
GCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAACACATGCCAAACATCATACTTCGGAAGCAATTGAAAGT
TATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGCTCCTGGACCTGGCCAATGAGGTGGACTATGCGCCCTCA
TTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATTATAAATAGTATGCTACGGGAC
CCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTACGGACCACTAGTGGACTGCATC
AAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTCCTAGATGAAGATCAGCTTCGT
GCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCC
TCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTG
ATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAG
ACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCAC
TGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTG
GCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGC
CTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGAAGCGCGCCTGCAGCCTCCTCTAGGGG
TTGCACCCCAGCGCTCCCACCTAGATGGGTCTGATCCTCCAGGATCCCCACCCAAAGCCTGATGGCACCCCGGCTGGCCATGCTGTCCCC
TCCCTGTGGCGTTTCTTAGCAGATGGCTGCAGAGCTTCGTTGATGGTCTTTTCTGTACTGGAGGCCTCCTGAGGCCAGGAACGTGCAAAT
TTGCAGGTGCTGCATCCCAAGCCCCTCATGCTCCTGCCTTCCTGAGGGCCAGAGGGGAGCCCCAGGACCCATTAAGCCACCCCCGTGTTC
CTGCCGTCAGTGCCAACTGCCGCATGTGGAAGCATCTACCCGTTCACTCCAGTCCCACCCCACGCCTGACTCCCCTCTGGAAACTGCAGG
CCAGATGGTTGCTGCCACAACTTGTGTACCTTCAGGGATGGGGCTCTTACTCCCTCCTGAGGCCAGCTGCTCTAATATCGATGGTCCTGC
TTGCCAGAGAGTTCCTCTACCCAGCAAAAATGAGTGTCTCAGAAGTGTGCTCCTCTGGCCTCAGTTCTCCTCTTTTGGAACAACATAAAA
CAAATTTAATTTTCTACGCCTCTGGGGATATCTGCTCAGCCAATGGAAAATCTGGGTTCAACCAGCCCCTGCCATTTCTTAAGACTTTCT
GCTGCACTCACAGGATCCTGAGCTGCACTTACCTGTGAGAGTCTTCAAACTTTTAAACCTTGCCAGTCAGGACTTTTGCTATTGCAAATA

>In-frame_C15orf41_ENST00000562877_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1887nt
AGCTTTCTGTTTAGTTGTGTCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAGAAACACATTAAAAGAACACATGCCA
AACATCATACTTCGGAAGCAATTGAAAGTTATTACCAGAGGTACCTGAATGGAGTGGTGAAAAATGGAGCTGCCCCAGTGCTCCTGGACC
TGGCCAATGAGGTGGACTATGCGCCCTCATTAATGGCTCGGCTTATACTGGAGAGGTTTCTACAGGAACACGAGGAAACTCCACCCTCCA
AGTCTATTATAAATAGTATGCTACGGGACCCTTCTCAGATTCCAGATGGAGTTCTAGCAAATCAGGTCTATCAGTGCATTGTGAACGACT
GCTGTTACGGACCACTAGTGGACTGCATCAAGCATGCCATTGGTCATGAGCATGAGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACC
TGTCCTTCCTAGATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGC
ACATAATTCACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGA
ATAGGTTTGACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACG
ACCGTCTCCGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCG
CCAAGTGGTTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACA
CCATCGAGAAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACC
TGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGC
AGAAGCGCGCCTGCAGCCTCCTCTAGGGGTTGCACCCCAGCGCTCCCACCTAGATGGGTCTGATCCTCCAGGATCCCCACCCAAAGCCTG
ATGGCACCCCGGCTGGCCATGCTGTCCCCTCCCTGTGGCGTTTCTTAGCAGATGGCTGCAGAGCTTCGTTGATGGTCTTTTCTGTACTGG
AGGCCTCCTGAGGCCAGGAACGTGCAAATTTGCAGGTGCTGCATCCCAAGCCCCTCATGCTCCTGCCTTCCTGAGGGCCAGAGGGGAGCC
CCAGGACCCATTAAGCCACCCCCGTGTTCCTGCCGTCAGTGCCAACTGCCGCATGTGGAAGCATCTACCCGTTCACTCCAGTCCCACCCC
ACGCCTGACTCCCCTCTGGAAACTGCAGGCCAGATGGTTGCTGCCACAACTTGTGTACCTTCAGGGATGGGGCTCTTACTCCCTCCTGAG
GCCAGCTGCTCTAATATCGATGGTCCTGCTTGCCAGAGAGTTCCTCTACCCAGCAAAAATGAGTGTCTCAGAAGTGTGCTCCTCTGGCCT
CAGTTCTCCTCTTTTGGAACAACATAAAACAAATTTAATTTTCTACGCCTCTGGGGATATCTGCTCAGCCAATGGAAAATCTGGGTTCAA
CCAGCCCCTGCCATTTCTTAAGACTTTCTGCTGCACTCACAGGATCCTGAGCTGCACTTACCTGTGAGAGTCTTCAAACTTTTAAACCTT

>In-frame_C15orf41_ENST00000338183_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1923nt
AGATTGCATACTCAAGAAGAGGAGGAACATAAAATACGTGATGTCTTCTCTTAAGTCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCC
AGGAGTACCAGAAACACATTAAAAGAACACATGCCAAACATCATACTTCGGAAGCAATTGAAAGTTATTACCAGAGGTACCTGAATGGAG
TGGTGAAAAATGGAGCTGCCCCAGTGCTCCTGGACCTGGCCAATGAGGTGGACTATGCGCCCTCATTAATGGCTCGGCTTATACTGGAGA
GGTTTCTACAGGAACACGAGGAAACTCCACCCTCCAAGTCTATTATAAATAGTATGCTACGGGACCCTTCTCAGATTCCAGATGGAGTTC
TAGCAAATCAGGTCTATCAGTGCATTGTGAACGACTGCTGTTACGGACCACTAGTGGACTGCATCAAGCATGCCATTGGTCATGAGCATG
AGGTCCTGCTGAGAGACTTGCTTCTAGAGAAAAACCTGTCCTTCCTAGATGAAGATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAG
ACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATTCACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACC
ACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTATTCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACC
TGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTCTCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCT
CCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAAGTGCGGCACCACTGCCCCAGCACACCCATCATCCTGG
TGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAGGAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCC
TGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTCACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCA
TCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGAAGCGCGCCTGCAGCCTCCTCTAGGGGTTGCACCCCAGCGCTCCCACCTAGA
TGGGTCTGATCCTCCAGGATCCCCACCCAAAGCCTGATGGCACCCCGGCTGGCCATGCTGTCCCCTCCCTGTGGCGTTTCTTAGCAGATG
GCTGCAGAGCTTCGTTGATGGTCTTTTCTGTACTGGAGGCCTCCTGAGGCCAGGAACGTGCAAATTTGCAGGTGCTGCATCCCAAGCCCC
TCATGCTCCTGCCTTCCTGAGGGCCAGAGGGGAGCCCCAGGACCCATTAAGCCACCCCCGTGTTCCTGCCGTCAGTGCCAACTGCCGCAT
GTGGAAGCATCTACCCGTTCACTCCAGTCCCACCCCACGCCTGACTCCCCTCTGGAAACTGCAGGCCAGATGGTTGCTGCCACAACTTGT
GTACCTTCAGGGATGGGGCTCTTACTCCCTCCTGAGGCCAGCTGCTCTAATATCGATGGTCCTGCTTGCCAGAGAGTTCCTCTACCCAGC
AAAAATGAGTGTCTCAGAAGTGTGCTCCTCTGGCCTCAGTTCTCCTCTTTTGGAACAACATAAAACAAATTTAATTTTCTACGCCTCTGG
GGATATCTGCTCAGCCAATGGAAAATCTGGGTTCAACCAGCCCCTGCCATTTCTTAAGACTTTCTGCTGCACTCACAGGATCCTGAGCTG
CACTTACCTGTGAGAGTCTTCAAACTTTTAAACCTTGCCAGTCAGGACTTTTGCTATTGCAAATAGAAAACCCAACTCAACCTGCTTAAG

>In-frame_C15orf41_ENST00000562489_chr15_37002162_+_RAC2_ENST00000249071_chr22_37628958_-_1510nt
GACTTCAGGTGAAGGACAGGCAGCAGGAGCAGATGAGATTTAGAATACCAAGACTGTGTGTACACGCAGATGTCAGTGGCAGAGAATGAA
GATCAGCTTCGTGCAAAGGGTTATGACAAAACACCAGACTTCATTTTACAAGTACCAGTTGCTGTAGAAGGGCACATAATTCACTGGATT
GAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGACCAGTTCTGGAGCTACTGGAATAGGTTTGACAACTAT
TCAGCCAATGTGATGGTGGACAGCAAGCCAGTGAACCTGGGGCTGTGGGACACTGCTGGGCAGGAGGACTACGACCGTCTCCGGCCGCTC
TCCTATCCACAGACGGACGTCTTCCTCATCTGCTTCTCCCTCGTCAGCCCAGCCTCTTATGAGAACGTCCGCGCCAAGTGGTTCCCAGAA
GTGCGGCACCACTGCCCCAGCACACCCATCATCCTGGTGGGCACCAAGCTGGACCTGCGGGACGACAAGGACACCATCGAGAAACTGAAG
GAGAAGAAGCTGGCTCCCATCACCTACCCGCAGGGCCTGGCACTGGCCAAGGAGATTGACTCGGTGAAATACCTGGAGTGCTCAGCTCTC
ACCCAGAGAGGCCTGAAAACCGTGTTCGACGAGGCCATCCGGGCCGTGCTGTGCCCTCAGCCCACGCGGCAGCAGAAGCGCGCCTGCAGC
CTCCTCTAGGGGTTGCACCCCAGCGCTCCCACCTAGATGGGTCTGATCCTCCAGGATCCCCACCCAAAGCCTGATGGCACCCCGGCTGGC
CATGCTGTCCCCTCCCTGTGGCGTTTCTTAGCAGATGGCTGCAGAGCTTCGTTGATGGTCTTTTCTGTACTGGAGGCCTCCTGAGGCCAG
GAACGTGCAAATTTGCAGGTGCTGCATCCCAAGCCCCTCATGCTCCTGCCTTCCTGAGGGCCAGAGGGGAGCCCCAGGACCCATTAAGCC
ACCCCCGTGTTCCTGCCGTCAGTGCCAACTGCCGCATGTGGAAGCATCTACCCGTTCACTCCAGTCCCACCCCACGCCTGACTCCCCTCT
GGAAACTGCAGGCCAGATGGTTGCTGCCACAACTTGTGTACCTTCAGGGATGGGGCTCTTACTCCCTCCTGAGGCCAGCTGCTCTAATAT
CGATGGTCCTGCTTGCCAGAGAGTTCCTCTACCCAGCAAAAATGAGTGTCTCAGAAGTGTGCTCCTCTGGCCTCAGTTCTCCTCTTTTGG
AACAACATAAAACAAATTTAATTTTCTACGCCTCTGGGGATATCTGCTCAGCCAATGGAAAATCTGGGTTCAACCAGCCCCTGCCATTTC
TTAAGACTTTCTGCTGCACTCACAGGATCCTGAGCTGCACTTACCTGTGAGAGTCTTCAAACTTTTAAACCTTGCCAGTCAGGACTTTTG


Top

FusionGenePPI for C15orf41_RAC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
C15orf41ASF1B, HIST1H3A, ASF1A, TRIM25RAC2CUL1, DEF6, ACTB, DOCK2, NCF2, ICMT, NOS2, ARHGDIB, PAK2, ARHGDIA, CHGB, AFG3L2, VCAM1, ITGA4, CD81, HDAC10, ADAM22, FBXO6, U2AF2, AGAP2, RAC3, DOCK1, ELMO2, RAP1GDS1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for C15orf41_RAC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for C15orf41_RAC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneC15orf41C3810185ANEMIA, CONGENITAL DYSERYTHROPOIETIC, TYPE Ib1UNIPROT
TgeneRAC2C0018799Heart Diseases1CTD_human
TgeneRAC2C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneRAC2C0024299Lymphoma1CTD_human
TgeneRAC2C0025202melanoma1CTD_human
TgeneRAC2C0349639Juvenile Myelomonocytic Leukemia1CTD_human
TgeneRAC2C1842398Neutrophil Immunodeficiency Syndrome1CTD_human;ORPHANET;UNIPROT