FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 465

FusionGeneSummary for ACPP_SAFB2

check button Fusion gene summary
Fusion gene informationFusion gene name: ACPP_SAFB2
Fusion gene ID: 465
HgeneTgene
Gene symbol

ACPP

SAFB2

Gene ID

55

9667

Gene nameacid phosphatase, prostatescaffold attachment factor B2
Synonyms5'-NT|ACP-3|ACP3-
Cytomap

3q22.1

19p13.3

Type of geneprotein-codingprotein-coding
Descriptionprostatic acid phosphataseTMPaseecto-5'-nucleotidaseprostatic acid phosphotasethiamine monophosphatasescaffold attachment factor B2
Modification date2018051920180523
UniProtAcc

P15309

Q14151

Ensembl transtripts involved in fusion geneENST00000336375, ENST00000475741, 
ENST00000351273, ENST00000489084, 
ENST00000252542, ENST00000591310, 
Fusion gene scores* DoF score13 X 6 X 2=1563 X 3 X 3=27
# samples 153
** MAII scorelog2(15/156*10)=-0.0565835283663674
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ACPP [Title/Abstract] AND SAFB2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Tissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneACPP

GO:0046085

adenosine metabolic process

18940592

HgeneACPP

GO:0051289

protein homotetramerization

10639192


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-HC-7233-01AACPPchr3

132036420

+SAFB2chr19

5616346

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336375ENST00000252542ACPPchr3

132036420

+SAFB2chr19

5616346

-
5CDS-intronENST00000336375ENST00000591310ACPPchr3

132036420

+SAFB2chr19

5616346

-
In-frameENST00000475741ENST00000252542ACPPchr3

132036420

+SAFB2chr19

5616346

-
5CDS-intronENST00000475741ENST00000591310ACPPchr3

132036420

+SAFB2chr19

5616346

-
In-frameENST00000351273ENST00000252542ACPPchr3

132036420

+SAFB2chr19

5616346

-
5CDS-intronENST00000351273ENST00000591310ACPPchr3

132036420

+SAFB2chr19

5616346

-
3UTR-3CDSENST00000489084ENST00000252542ACPPchr3

132036420

+SAFB2chr19

5616346

-
3UTR-intronENST00000489084ENST00000591310ACPPchr3

132036420

+SAFB2chr19

5616346

-

Top

FusionProtFeatures for ACPP_SAFB2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACPP

P15309

SAFB2

Q14151

A non-specific tyrosine phosphatase thatdephosphorylates a diverse number of substrates under acidicconditions (pH 4-6) including alkyl, aryl, and acyl orthophosphatemonoesters and phosphorylated proteins. Has lipid phosphataseactivity and inactivates lysophosphatidic acid in seminal plasma. Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons.Generates adenosine from AMP which acts as a pain suppressor. Actsas a tumor suppressor of prostate cancer through dephosphorylationof ERBB2 and deactivation of MAPK-mediated signaling. Binds to scaffold/matrix attachment region (S/MAR) DNA.Can function as an estrogen receptor corepressor and can alsoinhibit cell proliferation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-221482_545113954Compositional biasNote=Lys-rich
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-221619_724113954Compositional biasNote=Glu-rich
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-221621_788113954Compositional biasNote=Arg-rich
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-221792_926113954Compositional biasNote=Gly-rich
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-221407_485113954DomainRRM
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-221713_730113954MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-22130_64113954DomainSAP


Top

FusionGeneSequence for ACPP_SAFB2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACPP_ENST00000336375_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_881aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSK
EYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKL
AEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPS
PEARDSKEDGRKFDFDACNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKV
VGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVI
KKEEKIEKKEEKKPEDIKKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILS
FDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEKARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQE
RIHREREELRRQQEQLRYEQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGD
HRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPPPRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGER

>In-frame_ACPP_ENST00000475741_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_881aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSK
EYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKL
AEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPS
PEARDSKEDGRKFDFDACNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKV
VGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVI
KKEEKIEKKEEKKPEDIKKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILS
FDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEKARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQE
RIHREREELRRQQEQLRYEQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGD
HRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPPPRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGER

>In-frame_ACPP_ENST00000351273_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_881aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSK
EYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKL
AEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPS
PEARDSKEDGRKFDFDACNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKV
VGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVI
KKEEKIEKKEEKKPEDIKKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILS
FDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEKARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQE
RIHREREELRRQQEQLRYEQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRPMMGD
HRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPPPRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGER


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACPP_ENST00000336375_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_2643nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGAGGACATGGAAGCAAGTCTGGAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTG
CTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAA
GAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACT
TCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACT
TGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTT
GCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGC
AAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTA
GAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGC
CCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACC
AGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGC
GGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTT
GTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAG
TGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCC
GACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATT
AAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGA
CCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATT
AGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAAGCTCCAAGAGTCAGGATCGCAAGTCAGAAAGCAAAGAAAAGAGAGACATCTTGTCG
TTTGATAAAATCAAAGAACAAAGGGAGAGAGAGCGCCAGAGGCAGCGGGAACGGGAGATCCGCGAAACGGAGAGGCGGCGGGAGCGCGAG
CAGCGGGAGCGGGAGCAACGCCTCGAGGCCTTCCATGAGCGGAAGGAGAAGGCCCGGCTACAGCGGGAACGCCTGCAGCTCGAGTGCCAG
CGCCAGCGGCTGGAGCGGGAGCGCATGGAGCGGGAGCGGCTGGAGCGCGAGCGCATGCGCGTGGAGCGTGAGCGCAGGAAGGAGCAGGAG
CGCATCCACCGCGAGCGCGAGGAGCTGCGGCGCCAGCAGGAGCAGCTGCGTTACGAGCAGGAGCGGCGGCCCGGGCGGAGGCCCTACGAC
CTGGACCGACGAGATGATGCCTATTGGCCAGAAGGAAAGCGTGTGGCAATGGAGGACCGATATCGTGCAGACTTTCCCCGGCCAGACCAC
CGCTTTCACGACTTCGATCATCGAGACCGGGGCCAGTACCAGGACCACGCCATCGACAGGCGGGAGGGTTCGAGGCCAATGATGGGAGAC
CACCGGGATGGGCAGCACTATGGAGATGACCGCCATGGCCACGGAGGACCCCCAGAGCGCCACGGCCGGGACTCCCGTGATGGCTGGGGG
GGCTACGGCTCCGACAAGAGGCTGAGTGAAGGCCGGGGGCTGCCCCCTCCCCCCAGGGGTGGCCGTGACTGGGGAGAGCACAACCAGCGG
CTAGAGGAGCACCAGGCACGCGCCTGGCAGGGTGCCATGGACGCAGGCGCGGCTAGCCGGGAGCACGCCAGGTGGCAAGGTGGCGAGAGG
GGCCTGTCTGGGCCCTCGGGGCCGGGGCACATGGCAAGCCGCGGTGGAGTGGCGGGGCGAGGCGGCTTTGCACAAGGTGGACATTCCCAG
GGCCACGTGGTGCCAGGTGGCGGACTGGAAGGTGGCGGAGTGGCCAGCCAGGACCGGGGCAGCAGAGTCCCTCACCCACACCCTCATCCC

>In-frame_ACPP_ENST00000475741_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_2643nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGAGGACATGGAAGCAAGTCTGGAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTG
CTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAA
GAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACT
TCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACT
TGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTT
GCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGC
AAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTA
GAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGC
CCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACC
AGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGC
GGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTT
GTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAG
TGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCC
GACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATT
AAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGA
CCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATT
AGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAAGCTCCAAGAGTCAGGATCGCAAGTCAGAAAGCAAAGAAAAGAGAGACATCTTGTCG
TTTGATAAAATCAAAGAACAAAGGGAGAGAGAGCGCCAGAGGCAGCGGGAACGGGAGATCCGCGAAACGGAGAGGCGGCGGGAGCGCGAG
CAGCGGGAGCGGGAGCAACGCCTCGAGGCCTTCCATGAGCGGAAGGAGAAGGCCCGGCTACAGCGGGAACGCCTGCAGCTCGAGTGCCAG
CGCCAGCGGCTGGAGCGGGAGCGCATGGAGCGGGAGCGGCTGGAGCGCGAGCGCATGCGCGTGGAGCGTGAGCGCAGGAAGGAGCAGGAG
CGCATCCACCGCGAGCGCGAGGAGCTGCGGCGCCAGCAGGAGCAGCTGCGTTACGAGCAGGAGCGGCGGCCCGGGCGGAGGCCCTACGAC
CTGGACCGACGAGATGATGCCTATTGGCCAGAAGGAAAGCGTGTGGCAATGGAGGACCGATATCGTGCAGACTTTCCCCGGCCAGACCAC
CGCTTTCACGACTTCGATCATCGAGACCGGGGCCAGTACCAGGACCACGCCATCGACAGGCGGGAGGGTTCGAGGCCAATGATGGGAGAC
CACCGGGATGGGCAGCACTATGGAGATGACCGCCATGGCCACGGAGGACCCCCAGAGCGCCACGGCCGGGACTCCCGTGATGGCTGGGGG
GGCTACGGCTCCGACAAGAGGCTGAGTGAAGGCCGGGGGCTGCCCCCTCCCCCCAGGGGTGGCCGTGACTGGGGAGAGCACAACCAGCGG
CTAGAGGAGCACCAGGCACGCGCCTGGCAGGGTGCCATGGACGCAGGCGCGGCTAGCCGGGAGCACGCCAGGTGGCAAGGTGGCGAGAGG
GGCCTGTCTGGGCCCTCGGGGCCGGGGCACATGGCAAGCCGCGGTGGAGTGGCGGGGCGAGGCGGCTTTGCACAAGGTGGACATTCCCAG
GGCCACGTGGTGCCAGGTGGCGGACTGGAAGGTGGCGGAGTGGCCAGCCAGGACCGGGGCAGCAGAGTCCCTCACCCACACCCTCATCCC

>In-frame_ACPP_ENST00000351273_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_2643nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGAGGACATGGAAGCAAGTCTGGAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTG
CTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAA
GAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACT
TCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACT
TGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTT
GCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGC
AAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTA
GAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGC
CCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACC
AGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGC
GGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTT
GTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAG
TGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCC
GACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATT
AAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGA
CCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATT
AGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAAGCTCCAAGAGTCAGGATCGCAAGTCAGAAAGCAAAGAAAAGAGAGACATCTTGTCG
TTTGATAAAATCAAAGAACAAAGGGAGAGAGAGCGCCAGAGGCAGCGGGAACGGGAGATCCGCGAAACGGAGAGGCGGCGGGAGCGCGAG
CAGCGGGAGCGGGAGCAACGCCTCGAGGCCTTCCATGAGCGGAAGGAGAAGGCCCGGCTACAGCGGGAACGCCTGCAGCTCGAGTGCCAG
CGCCAGCGGCTGGAGCGGGAGCGCATGGAGCGGGAGCGGCTGGAGCGCGAGCGCATGCGCGTGGAGCGTGAGCGCAGGAAGGAGCAGGAG
CGCATCCACCGCGAGCGCGAGGAGCTGCGGCGCCAGCAGGAGCAGCTGCGTTACGAGCAGGAGCGGCGGCCCGGGCGGAGGCCCTACGAC
CTGGACCGACGAGATGATGCCTATTGGCCAGAAGGAAAGCGTGTGGCAATGGAGGACCGATATCGTGCAGACTTTCCCCGGCCAGACCAC
CGCTTTCACGACTTCGATCATCGAGACCGGGGCCAGTACCAGGACCACGCCATCGACAGGCGGGAGGGTTCGAGGCCAATGATGGGAGAC
CACCGGGATGGGCAGCACTATGGAGATGACCGCCATGGCCACGGAGGACCCCCAGAGCGCCACGGCCGGGACTCCCGTGATGGCTGGGGG
GGCTACGGCTCCGACAAGAGGCTGAGTGAAGGCCGGGGGCTGCCCCCTCCCCCCAGGGGTGGCCGTGACTGGGGAGAGCACAACCAGCGG
CTAGAGGAGCACCAGGCACGCGCCTGGCAGGGTGCCATGGACGCAGGCGCGGCTAGCCGGGAGCACGCCAGGTGGCAAGGTGGCGAGAGG
GGCCTGTCTGGGCCCTCGGGGCCGGGGCACATGGCAAGCCGCGGTGGAGTGGCGGGGCGAGGCGGCTTTGCACAAGGTGGACATTCCCAG
GGCCACGTGGTGCCAGGTGGCGGACTGGAAGGTGGCGGAGTGGCCAGCCAGGACCGGGGCAGCAGAGTCCCTCACCCACACCCTCATCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACPP_ENST00000336375_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_2977nt
TCAATCCCTTAATTAAATAGCTTCCCCTCTACAGGCTTTTGAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAAC
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGAGGACATGGAAGCAAGTCTGGAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTG
CTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAA
GAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACT
TCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACT
TGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTT
GCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGC
AAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTA
GAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGC
CCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACC
AGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGC
GGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTT
GTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAG
TGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCC
GACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATT
AAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGA
CCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATT
AGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAAGCTCCAAGAGTCAGGATCGCAAGTCAGAAAGCAAAGAAAAGAGAGACATCTTGTCG
TTTGATAAAATCAAAGAACAAAGGGAGAGAGAGCGCCAGAGGCAGCGGGAACGGGAGATCCGCGAAACGGAGAGGCGGCGGGAGCGCGAG
CAGCGGGAGCGGGAGCAACGCCTCGAGGCCTTCCATGAGCGGAAGGAGAAGGCCCGGCTACAGCGGGAACGCCTGCAGCTCGAGTGCCAG
CGCCAGCGGCTGGAGCGGGAGCGCATGGAGCGGGAGCGGCTGGAGCGCGAGCGCATGCGCGTGGAGCGTGAGCGCAGGAAGGAGCAGGAG
CGCATCCACCGCGAGCGCGAGGAGCTGCGGCGCCAGCAGGAGCAGCTGCGTTACGAGCAGGAGCGGCGGCCCGGGCGGAGGCCCTACGAC
CTGGACCGACGAGATGATGCCTATTGGCCAGAAGGAAAGCGTGTGGCAATGGAGGACCGATATCGTGCAGACTTTCCCCGGCCAGACCAC
CGCTTTCACGACTTCGATCATCGAGACCGGGGCCAGTACCAGGACCACGCCATCGACAGGCGGGAGGGTTCGAGGCCAATGATGGGAGAC
CACCGGGATGGGCAGCACTATGGAGATGACCGCCATGGCCACGGAGGACCCCCAGAGCGCCACGGCCGGGACTCCCGTGATGGCTGGGGG
GGCTACGGCTCCGACAAGAGGCTGAGTGAAGGCCGGGGGCTGCCCCCTCCCCCCAGGGGTGGCCGTGACTGGGGAGAGCACAACCAGCGG
CTAGAGGAGCACCAGGCACGCGCCTGGCAGGGTGCCATGGACGCAGGCGCGGCTAGCCGGGAGCACGCCAGGTGGCAAGGTGGCGAGAGG
GGCCTGTCTGGGCCCTCGGGGCCGGGGCACATGGCAAGCCGCGGTGGAGTGGCGGGGCGAGGCGGCTTTGCACAAGGTGGACATTCCCAG
GGCCACGTGGTGCCAGGTGGCGGACTGGAAGGTGGCGGAGTGGCCAGCCAGGACCGGGGCAGCAGAGTCCCTCACCCACACCCTCATCCC
CCCCCGTACCCCCACTTCACCCGCCGCTACTAAGTCCCACTCGCTGCGAGTTTTCGGGTGGGCAGACGCACTGTTGAATCTGGTAGCCAG
GGTTCCCTCGAACTTGGGGGATCTTTTTAAAAGCAAAGTAAATCCTGCCACCATGTTGTAGCTCAATACAATGTGAACTCACTTTTTTTT
TTTTTTTAAATAAATGTGTTCTTGTTCTGCCATTTTTAAATCAAGGTTTCTGTTAACGAGGCATTCCATTTTCCATTAATAAAGTTTACC

>In-frame_ACPP_ENST00000475741_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_2938nt
TGAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAACATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGC
CTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGGAGTTGAAGTTTGTGACTTTGGAGGACATG
GAAGCAAGTCTGGAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGAT
TTTGGGGAGGATGGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAG
CCCCCAGAGCATGCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAA
TCCCTTTTGGAGCCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTG
GAGCAGCCATTTGCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAA
GAGGGTGATTTAGATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCC
GCGGAGCAGCCAGGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTC
GCGGAGGCCTCTAGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTT
GATTTTGACGCTTGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAA
GAAAAAGATATAAAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCC
ACAACACGCGCTACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGG
GCTCGATGCTATGGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGA
ATGATCTCCGTAGAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCG
AGTGTCGACAGACATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAG
CCTGAAGACATTAAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGA
GGAATGGAGCGGACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAAGCTCC
AAGAGTCAGGATCGCAAGTCAGAAAGCAAAGAAAAGAGAGACATCTTGTCGTTTGATAAAATCAAAGAACAAAGGGAGAGAGAGCGCCAG
AGGCAGCGGGAACGGGAGATCCGCGAAACGGAGAGGCGGCGGGAGCGCGAGCAGCGGGAGCGGGAGCAACGCCTCGAGGCCTTCCATGAG
CGGAAGGAGAAGGCCCGGCTACAGCGGGAACGCCTGCAGCTCGAGTGCCAGCGCCAGCGGCTGGAGCGGGAGCGCATGGAGCGGGAGCGG
CTGGAGCGCGAGCGCATGCGCGTGGAGCGTGAGCGCAGGAAGGAGCAGGAGCGCATCCACCGCGAGCGCGAGGAGCTGCGGCGCCAGCAG
GAGCAGCTGCGTTACGAGCAGGAGCGGCGGCCCGGGCGGAGGCCCTACGACCTGGACCGACGAGATGATGCCTATTGGCCAGAAGGAAAG
CGTGTGGCAATGGAGGACCGATATCGTGCAGACTTTCCCCGGCCAGACCACCGCTTTCACGACTTCGATCATCGAGACCGGGGCCAGTAC
CAGGACCACGCCATCGACAGGCGGGAGGGTTCGAGGCCAATGATGGGAGACCACCGGGATGGGCAGCACTATGGAGATGACCGCCATGGC
CACGGAGGACCCCCAGAGCGCCACGGCCGGGACTCCCGTGATGGCTGGGGGGGCTACGGCTCCGACAAGAGGCTGAGTGAAGGCCGGGGG
CTGCCCCCTCCCCCCAGGGGTGGCCGTGACTGGGGAGAGCACAACCAGCGGCTAGAGGAGCACCAGGCACGCGCCTGGCAGGGTGCCATG
GACGCAGGCGCGGCTAGCCGGGAGCACGCCAGGTGGCAAGGTGGCGAGAGGGGCCTGTCTGGGCCCTCGGGGCCGGGGCACATGGCAAGC
CGCGGTGGAGTGGCGGGGCGAGGCGGCTTTGCACAAGGTGGACATTCCCAGGGCCACGTGGTGCCAGGTGGCGGACTGGAAGGTGGCGGA
GTGGCCAGCCAGGACCGGGGCAGCAGAGTCCCTCACCCACACCCTCATCCCCCCCCGTACCCCCACTTCACCCGCCGCTACTAAGTCCCA
CTCGCTGCGAGTTTTCGGGTGGGCAGACGCACTGTTGAATCTGGTAGCCAGGGTTCCCTCGAACTTGGGGGATCTTTTTAAAAGCAAAGT
AAATCCTGCCACCATGTTGTAGCTCAATACAATGTGAACTCACTTTTTTTTTTTTTTTAAATAAATGTGTTCTTGTTCTGCCATTTTTAA

>In-frame_ACPP_ENST00000351273_chr3_132036420_+_SAFB2_ENST00000252542_chr19_5616346_-_2937nt
GAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAACATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCC
TTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGGAGTTGAAGTTTGTGACTTTGGAGGACATGG
AAGCAAGTCTGGAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATT
TTGGGGAGGATGGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGC
CCCCAGAGCATGCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAAT
CCCTTTTGGAGCCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGG
AGCAGCCATTTGCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAG
AGGGTGATTTAGATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCG
CGGAGCAGCCAGGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCG
CGGAGGCCTCTAGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTG
ATTTTGACGCTTGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAG
AAAAAGATATAAAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCA
CAACACGCGCTACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGG
CTCGATGCTATGGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAA
TGATCTCCGTAGAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGA
GTGTCGACAGACATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGC
CTGAAGACATTAAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAG
GAATGGAGCGGACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAAGCTCCA
AGAGTCAGGATCGCAAGTCAGAAAGCAAAGAAAAGAGAGACATCTTGTCGTTTGATAAAATCAAAGAACAAAGGGAGAGAGAGCGCCAGA
GGCAGCGGGAACGGGAGATCCGCGAAACGGAGAGGCGGCGGGAGCGCGAGCAGCGGGAGCGGGAGCAACGCCTCGAGGCCTTCCATGAGC
GGAAGGAGAAGGCCCGGCTACAGCGGGAACGCCTGCAGCTCGAGTGCCAGCGCCAGCGGCTGGAGCGGGAGCGCATGGAGCGGGAGCGGC
TGGAGCGCGAGCGCATGCGCGTGGAGCGTGAGCGCAGGAAGGAGCAGGAGCGCATCCACCGCGAGCGCGAGGAGCTGCGGCGCCAGCAGG
AGCAGCTGCGTTACGAGCAGGAGCGGCGGCCCGGGCGGAGGCCCTACGACCTGGACCGACGAGATGATGCCTATTGGCCAGAAGGAAAGC
GTGTGGCAATGGAGGACCGATATCGTGCAGACTTTCCCCGGCCAGACCACCGCTTTCACGACTTCGATCATCGAGACCGGGGCCAGTACC
AGGACCACGCCATCGACAGGCGGGAGGGTTCGAGGCCAATGATGGGAGACCACCGGGATGGGCAGCACTATGGAGATGACCGCCATGGCC
ACGGAGGACCCCCAGAGCGCCACGGCCGGGACTCCCGTGATGGCTGGGGGGGCTACGGCTCCGACAAGAGGCTGAGTGAAGGCCGGGGGC
TGCCCCCTCCCCCCAGGGGTGGCCGTGACTGGGGAGAGCACAACCAGCGGCTAGAGGAGCACCAGGCACGCGCCTGGCAGGGTGCCATGG
ACGCAGGCGCGGCTAGCCGGGAGCACGCCAGGTGGCAAGGTGGCGAGAGGGGCCTGTCTGGGCCCTCGGGGCCGGGGCACATGGCAAGCC
GCGGTGGAGTGGCGGGGCGAGGCGGCTTTGCACAAGGTGGACATTCCCAGGGCCACGTGGTGCCAGGTGGCGGACTGGAAGGTGGCGGAG
TGGCCAGCCAGGACCGGGGCAGCAGAGTCCCTCACCCACACCCTCATCCCCCCCCGTACCCCCACTTCACCCGCCGCTACTAAGTCCCAC
TCGCTGCGAGTTTTCGGGTGGGCAGACGCACTGTTGAATCTGGTAGCCAGGGTTCCCTCGAACTTGGGGGATCTTTTTAAAAGCAAAGTA
AATCCTGCCACCATGTTGTAGCTCAATACAATGTGAACTCACTTTTTTTTTTTTTTTAAATAAATGTGTTCTTGTTCTGCCATTTTTAAA


Top

FusionGenePPI for ACPP_SAFB2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACPPACPP, UBC, SHBG, MMRN1, DDX19B, RPS6KB2, TBC1D22B, FTH1, CDK15, CCDC103, CPLX3, FBXL4, AIRE, ZIC1, DUSP21, IL31RA, FCRL5, KIF3A, NPPA, HSF2, FCF1, LACC1, L2HGDHSAFB2SAFB, ESR1, SORBS3, CHGB, MAP1LC3A, RB1CC1, NCOR1, HDAC3, TOPORS, CUL3, COPS5, CAND1, SRCAP, IK, APOA1, FNTA, FUS, GIT2, ZSCAN18, MOV10, CUL7, OBSL1, EZH2, SUZ12, EED, BMI1, TP53, RSPH9, RBMX, FNDC4, ZFP41, HNRNPUL1, CCAR1, SSB, HNRNPA1, MYO1C, PPP1CB, PPP1CC, EMC2, MATR3, MPHOSPH8, CAMKK1, MEX3C, ELAVL2, DHPS, TRIP6, APOBEC3D, CAPN13, CIZ1, CLK3, COX15, VDAC1, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneSAFB2chr3:132036420chr19:5616346ENST00000252542-221600_953113954SAFB1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACPP_SAFB2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneACPPP15309DB06688Sipuleucel-TProstatic acid phosphatasebiotechapproved|investigational

Top

RelatedDiseases for ACPP_SAFB2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACPPC3495559Juvenile arthritis1CTD_human