FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4649

FusionGeneSummary for C11orf80_FAM171A1

check button Fusion gene summary
Fusion gene informationFusion gene name: C11orf80_FAM171A1
Fusion gene ID: 4649
HgeneTgene
Gene symbol

C11orf80

FAM171A1

Gene ID

79703

221061

Gene namechromosome 11 open reading frame 80family with sequence similarity 171 member A1
SynonymsTOP6BL|TOPOVIBLC10orf38
Cytomap

11q13.2

10p13

Type of geneprotein-codingprotein-coding
Descriptiontype 2 DNA topoisomerase 6 subunit B-liketype 2 DNA topoisomerase VI subunit B-likeprotein FAM171A1astroprincin
Modification date2018052320180519
UniProtAcc

Q5VUB5

Ensembl transtripts involved in fusion geneENST00000346672, ENST00000360962, 
ENST00000527634, ENST00000540737, 
ENST00000532565, ENST00000525449, 
ENST00000527368, 
ENST00000378116, 
ENST00000477161, 
Fusion gene scores* DoF score10 X 5 X 6=3003 X 3 X 3=27
# samples 113
** MAII scorelog2(11/300*10)=-1.44745897697122
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: C11orf80 [Title/Abstract] AND FAM171A1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-5B-A90C-01AC11orf80chr11

66583670

+FAM171A1chr10

15263059

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000346672ENST00000378116C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
5CDS-5UTRENST00000346672ENST00000477161C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
In-frameENST00000360962ENST00000378116C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
5CDS-5UTRENST00000360962ENST00000477161C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
In-frameENST00000527634ENST00000378116C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
5CDS-5UTRENST00000527634ENST00000477161C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
In-frameENST00000540737ENST00000378116C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
5CDS-5UTRENST00000540737ENST00000477161C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
In-frameENST00000532565ENST00000378116C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
5CDS-5UTRENST00000532565ENST00000477161C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
In-frameENST00000525449ENST00000378116C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
5CDS-5UTRENST00000525449ENST00000477161C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
intron-3CDSENST00000527368ENST00000378116C11orf80chr11

66583670

+FAM171A1chr10

15263059

-
intron-5UTRENST00000527368ENST00000477161C11orf80chr11

66583670

+FAM171A1chr10

15263059

-

Top

FusionProtFeatures for C11orf80_FAM171A1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
C11orf80

FAM171A1

Q5VUB5

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFAM171A1chr11:66583670chr10:15263059ENST00000378116-48325_890251891Topological domainCytoplasmic
TgeneFAM171A1chr11:66583670chr10:15263059ENST00000378116-48304_324251891TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFAM171A1chr11:66583670chr10:15263059ENST00000378116-4822_303251891Topological domainExtracellular


Top

FusionGeneSequence for C11orf80_FAM171A1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_C11orf80_ENST00000346672_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_931aa
MVASAGSLFGGMVLKKFLKEIQSILPGISAKLTWTSEEGSTSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHFS
VKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHTVSRPNFGTIESHCSRIHPVLGHPVMLFIPEDVAGMDLLGELILTPAAALCPSPKV
SSNQLNRISSVSIFLTGPLGLPLILSTWEQPMTTFFKDTSSLVDWKKYHLCMIPNLDLNLDRDLVLPDVSTQVESSEEDQSQTMDPQGQT
LLLFLFVDFHSAFPVQQMEIWGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVVTQDITTTHTVFLLAILGGMAFILLVL
LCLLLTTCRRKCLKPRQHHRKLQLPAGLESSKRDQSTSMSHINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDL
HTPMLKLSYSTSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYNTVLSQPLFEK
QDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVIPAHTMKL
PGDHSTVSQPLVVPADQQLEIERLQAELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGTREWSPQNASMSESLSIPASLNDAALAQ
MNSEVQLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQ
EHQQKEPRAPDSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTADAPSEPAASPHQRRSAHEEE

>In-frame_C11orf80_ENST00000360962_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_1085aa
MGSRCRAWAWTRAWALAEFQARAEEGAAAAAAAAGGYPSTGRCRCSLRGMEGTAVAVFEILRFLIIHWKCDIDVSKGALLEGQLVISIEG
LNSKHQANALHCVTTRWSLTLLPRPECSGAVSAHCNLHLPGSSDSHASVPRVAGITDAHHHAWLIMVASAGSLFGGMVLKKFLKEIQSIL
PGISAKLTWTSEEGSTSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHFSVKVNGILSTEIFGVENEPTLNLGNG
IALLVDSQHTVRPNFGTIESHCSRIHPVLGHPVMLFIPEDVAGMDLLGELILTPAAALCPSPKVSSNQLNRISSVSIFLTGPLGLPLILS
TWEQPMTTFFKDTSSLVDWKKYHLCMIPNLDLNLDRDLVLPDVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGTWLK
SGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVVTQDITTTHTVFLLAILGGMAFILLVLLCLLLTTCRRKCLKPRQHHRKLQLPA
GLESSKRDQSTSMSHINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYSTSQEFSSREELLSCKE
EDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSP
EKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVIPAHTMKLPGDHSTVSQPLVVPADQQLEIERLQA
ELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGTREWSPQNASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKPLPHPR
AWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQEHQQKEPRAPDSTAYTQLVYLDDVEQ
SGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTADAPSEPAASPHQRRSAHEEEEDDDDDDQGEDKKSPWQKREERPLMA

>In-frame_C11orf80_ENST00000527634_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_868aa
MTDCLVIKHFLRKIIMVHPKVRFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHTVSRPNFGTIESHCSRIHPVLGHPVMLFIP
EDVAGMDLLGELILTPAAALCPSPKVSSNQLNRISSQLHIFLTGPLGLPLILSTWEQPMTTFFKDTSSLVDWKKYHLCMIPNLDLNLDRD
LVLPDVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPV
VTQDITTTHTVFLLAILGGMAFILLVLLCLLLTTCRRKCLKPRQHHRKLQLPAGLESSKRDQSTSMSHINLLFSRRASEFPGPLSVTSHG
RPEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYSTSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSME
REGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICC
SSVDQVNDSVYRKVLPALVIPAHTMKLPGDHSTVSQPLVVPADQQLEIERLQAELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGT
REWSPQNASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSG
VDMNEPKSARKGRGDALSLQQNYPPVQEHQQKEPRAPDSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQE

>In-frame_C11orf80_ENST00000540737_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_920aa
MVLKKFLKEIQSILPGISAKLTWTSEEGSTSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHFSVKVNGILSTEI
FGVENEPTLNLGNGIALLVDSQHTVSRPNFGTIESHCSRIHPVLGHPVMLFIPEDVAGMDLLGELILTPAAALCPSPKVSSNQLNRISSV
SIFLTGPLGLPLILSTWEQPMTTFFKDTSSLVDWKKYHLCMIPNLDLNLDRDLVLPDVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHS
AFPVQQMEIWGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVVTQDITTTHTVFLLAILGGMAFILLVLLCLLLTTCRRK
CLKPRQHHRKLQLPAGLESSKRDQSTSMSHINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYST
SQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGS
KLTIQEHLYPAPSSPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVIPAHTMKLPGDHSTVSQPL
VVPADQQLEIERLQAELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGTREWSPQNASMSESLSIPASLNDAALAQMNSEVQLLTEK
ALMELGGGKPLPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQEHQQKEPRAPD
STAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTADAPSEPAASPHQRRSAHEEEEDDDDDDQGED

>In-frame_C11orf80_ENST00000532565_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_867aa
MTDCLVIKHFLRKIIMVHPKVRFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHTVRPNFGTIESHCSRIHPVLGHPVMLFIPE
DVAGMDLLGELILTPAAALCPSPKVSSNQLNRISSQLHIFLTGPLGLPLILSTWEQPMTTFFKDTSSLVDWKKYHLCMIPNLDLNLDRDL
VLPDVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVV
TQDITTTHTVFLLAILGGMAFILLVLLCLLLTTCRRKCLKPRQHHRKLQLPAGLESSKRDQSTSMSHINLLFSRRASEFPGPLSVTSHGR
PEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYSTSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMER
EGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICCS
SVDQVNDSVYRKVLPALVIPAHTMKLPGDHSTVSQPLVVPADQQLEIERLQAELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGTR
EWSPQNASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGV
DMNEPKSARKGRGDALSLQQNYPPVQEHQQKEPRAPDSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEE

>In-frame_C11orf80_ENST00000525449_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_930aa
MVASAGSLFGGMVLKKFLKEIQSILPGISAKLTWTSEEGSTSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHFS
VKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHTVRPNFGTIESHCSRIHPVLGHPVMLFIPEDVAGMDLLGELILTPAAALCPSPKVS
SNQLNRISSVSIFLTGPLGLPLILSTWEQPMTTFFKDTSSLVDWKKYHLCMIPNLDLNLDRDLVLPDVSTQVESSEEDQSQTMDPQGQTL
LLFLFVDFHSAFPVQQMEIWGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVVTQDITTTHTVFLLAILGGMAFILLVLL
CLLLTTCRRKCLKPRQHHRKLQLPAGLESSKRDQSTSMSHINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDLH
TPMLKLSYSTSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQ
DREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVIPAHTMKLP
GDHSTVSQPLVVPADQQLEIERLQAELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGTREWSPQNASMSESLSIPASLNDAALAQM
NSEVQLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQE
HQQKEPRAPDSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTADAPSEPAASPHQRRSAHEEEE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_C11orf80_ENST00000346672_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_2793nt
ATGGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAAGAAGTTCCTAAAAGAAATACAGTCCATACTGCCCGGAATCTCTGCA
AAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATATGACAGGGGTAACACCCTTCCAGATGATTTTTGAGGTTGATGAAAAG
CCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCCTAAGGTCAGATTTCATTTCAGT
GTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTC
GACTCCCAGCATTATGTGAGTAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATG
CTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTT
TCTTCCAACCAGCTTAACAGGATTTCTTCAGTTTCCATATTTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAG
CCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGATACCCAATTTGGATCTCAATTTG
GATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACT
CTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGT
CTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCA
GGTCCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTG
CTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGT
TCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACC
AGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTG
CACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGC
CAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAA
TCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAG
CAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAG
CTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTA
ATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTC
CCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAAT
CCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGAT
GCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAG
ATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTC
TCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTG
GACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAA
GAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAA
TGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGC
CTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAG
GAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAGAAACGGGAGGAGAGGCCCCTGATGGCGTTTAACATTAAA

>In-frame_C11orf80_ENST00000360962_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_3255nt
ATGGGCTCGCGCTGCCGGGCGTGGGCGTGGACTCGGGCGTGGGCACTGGCGGAGTTCCAAGCCCGGGCTGAGGAGGGGGCGGCGGCGGCG
GCGGCGGCGGCGGGCGGGTACCCTTCGACTGGGCGTTGCCGCTGTTCCCTGCGCGGCATGGAGGGGACGGCCGTGGCCGTGTTCGAGATT
TTGAGATTTTTAATAATTCACTGGAAGTGTGACATAGATGTATCAAAGGGAGCATTGCTAGAAGGGCAGCTAGTGATTTCCATAGAAGGA
TTAAATTCTAAGCACCAGGCAAATGCTCTTCATTGTGTAACAACTAGATGGAGTCTCACTCTGTTACCCAGGCCGGAGTGCAGTGGCGCA
GTCTCGGCTCACTGCAACCTCCACCTCCCAGGTTCAAGTGATTCTCATGCCTCAGTCCCCCGAGTAGCTGGGATTACAGATGCCCACCAC
CATGCCTGGCTAATTATGGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAAGAAGTTCCTAAAAGAAATACAGTCCATACTG
CCCGGAATCTCTGCAAAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATATGACAGGGGTAACACCCTTCCAGATGATTTTT
GAGGTTGATGAAAAGCCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCCTAAGGTC
AGATTTCATTTCAGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGGGAATGGA
ATTGCTCTTTTGGTCGACTCCCAGCATTATGTGAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCCTGTGCTAGGA
CATCCAGTAATGCTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACTGTGCCCC
AGCCCAAAGGTTTCTTCCAACCAGCTTAACAGGATTTCTTCAGTTTCCATATTTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCA
ACTTGGGAGCAGCCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGATACCCAATTTG
GATCTCAATTTGGATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCT
CAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAG
AGCGGTCTGGGTCTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCC
CCTCCCATCCCAGGTCCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATA
CTTTTGGTTTTGCTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCA
GGACTGGAGAGTTCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCG
CTGTCCGTCACCAGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGC
GAAGGGGACCTGCACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAA
GAGGATAAAAGCCAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTA
AAGGCAAGAAAATCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCT
TTATTTGAAAAGCAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCT
GAGAAAGAACAGCTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGG
CCCGGCCAGTTAATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCAT
TATATGAAACTCCCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCT
GAGCTGTCCAATCCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAG
CACCTGCAGGATGCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCG
GCTTTGGCTCAGATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGG
GCGTGGTTCGTCTCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAAT
GATGCCAGTTTGGACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTAC
CCGCCCGTCCAAGAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAG
AGTGGTAGCGAATGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGC
CAGCTGCCCAGCCTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCC
CACGAGGAAGAGGAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAGAAACGGGAGGAGAGGCCCCTGATGGCG

>In-frame_C11orf80_ENST00000527634_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_2604nt
ATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCCTAAGGTCAGATTTCATTTCAGTGTAAAGGTAAAT
GGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTCGACTCCCAGCAT
TATGTGAGTAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATGCTTTTCATCCCT
GAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTTTCTTCCAACCAG
CTTAACAGGATTTCTTCACAACTACACATATTTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAGCCGATGACT
ACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGATACCCAATTTGGATCTCAATTTGGATAGAGAT
TTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTT
TTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGTCTTGTGCAC
CAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCAGGTCCCGTT
GTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTGCTGTGTCTC
CTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGTTCCAAAAGA
GACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACCAGCCACGGC
CGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTGCACACCCCC
ATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGCCAGATCTCC
TTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAATCTATGGAA
AGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAGCAGGACAGA
GAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAGCTGCTGGAC
CGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTAATCTGCTGC
AGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTCCCCGGGGAC
CACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAATCCCCATGCC
GGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGATGCGGGCACC
CGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAGATGAACAGT
GAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTCTCCTTGGAT
GGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTGGACTCTGGC
GTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAAGAGCACCAG
CAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAATGTGGGACC
ACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGCCTGCAGGAG
GAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAGGAAGACGAT

>In-frame_C11orf80_ENST00000540737_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_2760nt
ATGGTCCTCAAGAAGTTCCTAAAAGAAATACAGTCCATACTGCCCGGAATCTCTGCAAAGCTGACTTGGACTTCAGAGGAAGGCAGCTAT
TCTCAGGATATGACAGGGGTAACACCCTTCCAGATGATTTTTGAGGTTGATGAAAAGCCCAGAACCTTGATGACAGATTGTCTGGTTATA
AAGCATTTTTTACGTAAAATCATCATGGTGCACCCTAAGGTCAGATTTCATTTCAGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATC
TTTGGGGTGGAGAATGAACCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTCGACTCCCAGCATTATGTGAGTAGACCAAATTTT
GGTACAATTGAATCACACTGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATGCTTTTCATCCCTGAAGACGTGGCTGGCATGGAC
TTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTTTCTTCCAACCAGCTTAACAGGATTTCTTCAGTT
TCCATATTTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAGCCGATGACTACTTTCTTCAAAGATACCTCTTCT
TTAGTTGACTGGAAAAAATACCATTTGTGTATGATACCCAATTTGGATCTCAATTTGGATAGAGATTTGGTGCTTCCAGATGTGAGTTAT
CAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGT
GCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGTCTTGTGCACCAGGAAGGCAGCCAGCTGACGTGG
ACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCAGGTCCCGTTGTAACACAGGACATTACCACGTAT
CACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTGCTGTGTCTCCTTTTATATTATTGCAGGAGGAAG
TGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGTTCCAAAAGAGACCAGTCCACGTCCATGTCACAC
ATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACCAGCCACGGCCGCCCCGAGGCCCCCGGCACGAAG
GAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTGCACACCCCCATGCTCAAGCTCTCCTACAGCACC
TCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGCCAGATCTCCTTTGATAACCTCACTCCAAGTGGG
ACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAATCTATGGAAAGAGAAGGCTACGAGTCCTCGGGC
AATGATGACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAGCAGGACAGAGAAGGTCCAGCCTCCACGGGAAGC
AAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAGCTGCTGGACCGCAGACCCACTGAATGTATGATG
TCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTAATCTGCTGCAGTTCTGTCGACCAGGTCAATGAC
AGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTCCCCGGGGACCACTCCTATGTCAGCCAGCCCCTC
GTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAATCCCCATGCCGGGATCTTCCCACACCCGTCCTCA
CAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGATGCGGGCACCCGGGAGTGGAGCCCTCAGAACGCA
TCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAGATGAACAGTGAGGTGCAGCTCCTGACTGAAAAG
GCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTCTCCTTGGATGGCAGGTCCAACGCTCACGTTAGA
CATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTGGACTCTGGCGTAGATATGAATGAACCAAAATCA
GCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAAGAGCACCAGCAGAAAGAGCCTCGAGCCCCAGAC
AGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAATGTGGGACCACGGTCTGTACCCCCGAGGACAGT
GCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGCCTGCAGGAGGAGACGACCAGACGGACTGCGGAT
GCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAGGAAGACGATGATGATGATGACCAAGGAGAAGAC

>In-frame_C11orf80_ENST00000532565_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_2601nt
ATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCCTAAGGTCAGATTTCATTTCAGTGTAAAGGTAAAT
GGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTCGACTCCCAGCAT
TATGTGAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATGCTTTTCATCCCTGAA
GACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTTTCTTCCAACCAGCTT
AACAGGATTTCTTCACAACTACACATATTTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAGCCGATGACTACT
TTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGATACCCAATTTGGATCTCAATTTGGATAGAGATTTG
GTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTT
CTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGTCTTGTGCACCAG
GAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCAGGTCCCGTTGTA
ACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTGCTGTGTCTCCTT
TTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGTTCCAAAAGAGAC
CAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACCAGCCACGGCCGC
CCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTGCACACCCCCATG
CTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGCCAGATCTCCTTT
GATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAATCTATGGAAAGA
GAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAGCAGGACAGAGAA
GGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAGCTGCTGGACCGC
AGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTAATCTGCTGCAGT
TCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTCCCCGGGGACCAC
TCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAATCCCCATGCCGGG
ATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGATGCGGGCACCCGG
GAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAGATGAACAGTGAG
GTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTCTCCTTGGATGGC
AGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTGGACTCTGGCGTA
GATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAAGAGCACCAGCAG
AAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAATGTGGGACCACG
GTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGCCTGCAGGAGGAG
ACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAGGAAGACGATGAT

>In-frame_C11orf80_ENST00000525449_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_2790nt
ATGGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAAGAAGTTCCTAAAAGAAATACAGTCCATACTGCCCGGAATCTCTGCA
AAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATATGACAGGGGTAACACCCTTCCAGATGATTTTTGAGGTTGATGAAAAG
CCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCCTAAGGTCAGATTTCATTTCAGT
GTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTC
GACTCCCAGCATTATGTGAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATGCTT
TTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTTTCT
TCCAACCAGCTTAACAGGATTTCTTCAGTTTCCATATTTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAGCCG
ATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGATACCCAATTTGGATCTCAATTTGGAT
AGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTG
CTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGTCTT
GTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCAGGT
CCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTGCTG
TGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGTTCC
AAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACCAGC
CACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTGCAC
ACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGCCAG
ATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAATCT
ATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAGCAG
GACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAGCTG
CTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTAATC
TGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTCCCC
GGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAATCCC
CATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGATGCG
GGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAGATG
AACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTCTCC
TTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTGGAC
TCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAAGAG
CACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAATGT
GGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGCCTG
CAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAGGAA
GACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAGAAACGGGAGGAGAGGCCCCTGATGGCGTTTAACATTAAATGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_C11orf80_ENST00000346672_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_4537nt
GGAAGGGATGGGCTCGCGCTGCCGGGCGTGGGCGTGGACTCGGGCGTGGGCACTGGCGGAGTTCCAAGCCCGGGCTGAGGAGGGGGCGGC
GGCGGCGGCGGCGGCGGCGGGCGGGTACCCTTCGACTGGGCGTTGCCGCTGTTCCCTGCGCGGCATGGAGGGGACGGCCGTGGCCGTGTT
CGAGATTTTGAGATTTTTAATAATTCACTGGAAGTGTGACATAGATGTATCAAAGGGAGCATTGCTAGAAGGGCAGCTAGTGATTTCCAT
AGAAGGATTAAATTCTAAGCACCAGGCAAATGCTCTTCATTGTGTAACAACTAGATGGAGTCTCACTCTGTTACCCAGGCCGGAGTGCAG
TGGCGCAGTCTCGGCTCACTGCAACCTCCACCTCCCAGGTTCAAGTGATTCTCATGCCTCAGTCCCCCGAGTAGCTGGGATTACAGATGC
CCACCACCATGCCTGGCTAATTATGGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAAGAAGTTCCTAAAAGAAATACAGTC
CATACTGCCCGGAATCTCTGCAAAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATATGACAGGGGTAACACCCTTCCAGAT
GATTTTTGAGGTTGATGAAAAGCCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCC
TAAGGTCAGATTTCATTTCAGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGG
GAATGGAATTGCTCTTTTGGTCGACTCCCAGCATTATGTGAGTAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCC
TGTGCTAGGACATCCAGTAATGCTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGC
ACTGTGCCCCAGCCCAAAGGTTTCTTCCAACCAGCTTAACAGGATTTCTTCAGTTTCCATATTTCTATATGGACCTTTGGGTCTGCCTCT
GATATTGTCAACTTGGGAGCAGCCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGAT
ACCCAATTTGGATCTCAATTTGGATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGAC
TATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAAC
GTGGCTGAAGAGCGGTCTGGGTCTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGC
CGCCATGTCCCCTCCCATCCCAGGTCCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAAT
GGCTTTCATACTTTTGGTTTTGCTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCA
GCTCCCTGCAGGACTGGAGAGTTCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATT
CCCTGGCCCGCTGTCCGTCACCAGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTC
TCCGGGCGGCGAAGGGGACCTGCACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTC
TTGCAAGGAAGAGGATAAAAGCCAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGT
TTTTCCCTTAAAGGCAAGAAAATCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCT
CTCACAGCCTTTATTTGAAAAGCAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCC
TTCATCACCTGAGAAAGAACAGCTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTC
CTTCCCACGGCCCGGCCAGTTAATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCAT
CCCGGCTCATTATATGAAACTCCCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAG
ACTACAGGCTGAGCTGTCCAATCCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCAT
CTCTCAGCAGCACCTGCAGGATGCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCT
GAACGACGCGGCTTTGGCTCAGATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCC
GCACCCCCGGGCGTGGTTCGTCTCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAA
CGGAAGTAATGATGCCAGTTTGGACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCA
GCAGAACTACCCGCCCGTCCAAGAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGA
CGTGGAACAGAGTGGTAGCGAATGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAG
AAGTGGTGGCCAGCTGCCCAGCCTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAG
AAGATCTGCCCACGAGGAAGAGGAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAGAAACGGGAGGAGAGGCC
CCTGATGGCGTTTAACATTAAATGAGCTATCGCAGACCCACCTGACTGTGGAATATAAAATTGCCAAATATCCTTTCTCATGGAAGCGCG
TACCCGTTCGTGGAGGAAACGGAACGGCAGCCCAGCCGTGGGACGGACGTGGACGTTTACTGCATTCCTGTTTGCCGTGTAAATGTTAGA
AAGGAATTAAAGTTATTACTCGGAATAAAGGATGACTTTGGCGGATGTCGCCCCTGCAAGGAGGTGGCTGAAAGTGGTGTCCAGATGTCC
TTCCGAGGACTCGGCGTATCCGCCACCAGGGACATTAAGAAACCGCACGTGATGTCGCTATGCTCTAACGATCACCTCAGTTCTCCCTCG
GATTCTGGGAACAGATGAAACTTTTTGCATCGCTTGAGTCATTTTTATCACAATAATCCTACTGTGAAGCTGTCGTTGAGAACTTAGGTT
GGCACGTAGCGTCTCAAGGTATGCGTTCTCTCAAAGGAAAGCTATGCATCGCTGCTTCGTTGTCTGATTTTGCTTAGATTTTGCTTTGGT
TAGGTTGCGTTTTGGGGTTTGCCTTTTTTTGTTGTCGCTTAAATGCAATTTGGTTGTAAAGATTTGATTCCTTTGTGTTCATCTGTTCCG
CTTCTCAGCGGTCCATCTCAGCGTCTCCCTTCAGGAACCGCTGAGTGTCCTCTCTTAACATCCAAGCCTTTTAATGAAATCGTACTGAAA
TCTGTATCAGCTAAGAGTCCTCCAATCCTGGTCCCATTAACTCCAAGTGCCTTTTTGACAGTGACAACAGACAGTCCCTCGCTTTTTGTT
GTTGTTGGTTTTCTTAACCCCTTTAATGGAACTGCCTGGATTTTATACAGTTATTAAAGGATGTCTCTTTTGCTTTAAACTGCATGCTGC
CAAGTGCCATTTGGGGTCAGCATCCTCGTTTCAACACAGTGTGCTCTCTAGTTATCATGTGTAACGTGGGTTCTGTTTAGCGAAGATAGA
CTAGAGGACACGTTAGAGATGCCCTTCCCTGCTCCATCCCTGTGGCACCATTATGGTTTTTTGGCTGTTTGTATATACGGTTACGTATTA
ACTCTGGAATCCTATGGGCTCATCTTGCTCACCCAATGTGGGAGTCTGGTTTGAGCAAGCGAGCTGAATGTGACTATTAAAAAAAATTTA
AAAAAAAAAAAGAAAATCTTATGTACTATCCAAAAGTGCCAGAATGACTCTTCTGTGCATTCTTCTTAAAGAGCTGCTTGGTTATCCAAA

>In-frame_C11orf80_ENST00000360962_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_4534nt
GGAAGGGATGGGCTCGCGCTGCCGGGCGTGGGCGTGGACTCGGGCGTGGGCACTGGCGGAGTTCCAAGCCCGGGCTGAGGAGGGGGCGGC
GGCGGCGGCGGCGGCGGCGGGCGGGTACCCTTCGACTGGGCGTTGCCGCTGTTCCCTGCGCGGCATGGAGGGGACGGCCGTGGCCGTGTT
CGAGATTTTGAGATTTTTAATAATTCACTGGAAGTGTGACATAGATGTATCAAAGGGAGCATTGCTAGAAGGGCAGCTAGTGATTTCCAT
AGAAGGATTAAATTCTAAGCACCAGGCAAATGCTCTTCATTGTGTAACAACTAGATGGAGTCTCACTCTGTTACCCAGGCCGGAGTGCAG
TGGCGCAGTCTCGGCTCACTGCAACCTCCACCTCCCAGGTTCAAGTGATTCTCATGCCTCAGTCCCCCGAGTAGCTGGGATTACAGATGC
CCACCACCATGCCTGGCTAATTATGGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAAGAAGTTCCTAAAAGAAATACAGTC
CATACTGCCCGGAATCTCTGCAAAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATATGACAGGGGTAACACCCTTCCAGAT
GATTTTTGAGGTTGATGAAAAGCCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCC
TAAGGTCAGATTTCATTTCAGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGG
GAATGGAATTGCTCTTTTGGTCGACTCCCAGCATTATGTGAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCCTGT
GCTAGGACATCCAGTAATGCTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACT
GTGCCCCAGCCCAAAGGTTTCTTCCAACCAGCTTAACAGGATTTCTTCAGTTTCCATATTTCTATATGGACCTTTGGGTCTGCCTCTGAT
ATTGTCAACTTGGGAGCAGCCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGATACC
CAATTTGGATCTCAATTTGGATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTAT
GGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTG
GCTGAAGAGCGGTCTGGGTCTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGC
CATGTCCCCTCCCATCCCAGGTCCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGC
TTTCATACTTTTGGTTTTGCTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCT
CCCTGCAGGACTGGAGAGTTCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCC
TGGCCCGCTGTCCGTCACCAGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCC
GGGCGGCGAAGGGGACCTGCACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTG
CAAGGAAGAGGATAAAAGCCAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTT
TCCCTTAAAGGCAAGAAAATCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCTCTC
ACAGCCTTTATTTGAAAAGCAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTC
ATCACCTGAGAAAGAACAGCTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTT
CCCACGGCCCGGCCAGTTAATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCC
GGCTCATTATATGAAACTCCCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACT
ACAGGCTGAGCTGTCCAATCCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTC
TCAGCAGCACCTGCAGGATGCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAA
CGACGCGGCTTTGGCTCAGATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCA
CCCCCGGGCGTGGTTCGTCTCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGG
AAGTAATGATGCCAGTTTGGACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCA
GAACTACCCGCCCGTCCAAGAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGT
GGAACAGAGTGGTAGCGAATGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAG
TGGTGGCCAGCTGCCCAGCCTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAG
ATCTGCCCACGAGGAAGAGGAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAGAAACGGGAGGAGAGGCCCCT
GATGGCGTTTAACATTAAATGAGCTATCGCAGACCCACCTGACTGTGGAATATAAAATTGCCAAATATCCTTTCTCATGGAAGCGCGTAC
CCGTTCGTGGAGGAAACGGAACGGCAGCCCAGCCGTGGGACGGACGTGGACGTTTACTGCATTCCTGTTTGCCGTGTAAATGTTAGAAAG
GAATTAAAGTTATTACTCGGAATAAAGGATGACTTTGGCGGATGTCGCCCCTGCAAGGAGGTGGCTGAAAGTGGTGTCCAGATGTCCTTC
CGAGGACTCGGCGTATCCGCCACCAGGGACATTAAGAAACCGCACGTGATGTCGCTATGCTCTAACGATCACCTCAGTTCTCCCTCGGAT
TCTGGGAACAGATGAAACTTTTTGCATCGCTTGAGTCATTTTTATCACAATAATCCTACTGTGAAGCTGTCGTTGAGAACTTAGGTTGGC
ACGTAGCGTCTCAAGGTATGCGTTCTCTCAAAGGAAAGCTATGCATCGCTGCTTCGTTGTCTGATTTTGCTTAGATTTTGCTTTGGTTAG
GTTGCGTTTTGGGGTTTGCCTTTTTTTGTTGTCGCTTAAATGCAATTTGGTTGTAAAGATTTGATTCCTTTGTGTTCATCTGTTCCGCTT
CTCAGCGGTCCATCTCAGCGTCTCCCTTCAGGAACCGCTGAGTGTCCTCTCTTAACATCCAAGCCTTTTAATGAAATCGTACTGAAATCT
GTATCAGCTAAGAGTCCTCCAATCCTGGTCCCATTAACTCCAAGTGCCTTTTTGACAGTGACAACAGACAGTCCCTCGCTTTTTGTTGTT
GTTGGTTTTCTTAACCCCTTTAATGGAACTGCCTGGATTTTATACAGTTATTAAAGGATGTCTCTTTTGCTTTAAACTGCATGCTGCCAA
GTGCCATTTGGGGTCAGCATCCTCGTTTCAACACAGTGTGCTCTCTAGTTATCATGTGTAACGTGGGTTCTGTTTAGCGAAGATAGACTA
GAGGACACGTTAGAGATGCCCTTCCCTGCTCCATCCCTGTGGCACCATTATGGTTTTTTGGCTGTTTGTATATACGGTTACGTATTAACT
CTGGAATCCTATGGGCTCATCTTGCTCACCCAATGTGGGAGTCTGGTTTGAGCAAGCGAGCTGAATGTGACTATTAAAAAAAATTTAAAA
AAAAAAAAGAAAATCTTATGTACTATCCAAAAGTGCCAGAATGACTCTTCTGTGCATTCTTCTTAAAGAGCTGCTTGGTTATCCAAAAAT

>In-frame_C11orf80_ENST00000527634_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_4103nt
GGACTCGGGCGTGGGCACTGGCGGAGTTCCAAGCCCGGGCTGAGGAGGGGGCGGCGGCGGCGGCGGCGGCGGCGGGCGGGTACCCTTCGA
CTGGGCGTTGCCGCTGTTCCCTGCGCGGCATGGAGGGGACGGCCGTGGCCGTGTTCGAGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCAT
GGTCCTCAAGAAGTTCCTAAAAGGTTGATGAAAAGCCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCA
TCATGGTGCACCCTAAGGTCAGATTTCATTTCAGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCA
CTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTCGACTCCCAGCATTATGTGAGTAGACCAAATTTTGGTACAATTGAATCACACTGCA
GCAGAATTCACCCTGTGCTAGGACATCCAGTAATGCTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGA
CTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTTTCTTCCAACCAGCTTAACAGGATTTCTTCACAACTACACATATTTCTATATGGAC
CTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAGCCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAAT
ACCATTTGTGTATGATACCCAATTTGGATCTCAATTTGGATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGG
AGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAA
TGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGTCTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGT
TGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCAGGTCCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGG
CCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTGCTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGC
ACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGTTCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCAC
GCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACCAGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCC
ATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTGCACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCC
GGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGCCAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACC
ATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAATCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTA
GTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAGCAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAAC
ATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAGCTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACC
TCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTAATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTAC
TGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTCCCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGC
AGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAATCCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCC
TGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGATGCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCT
CCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAGATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGG
GTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTCTCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCC
AAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTGGACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAG
ATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAAGAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGC
TCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAATGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGG
AGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGCCTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAG
CCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAGGAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAGA
AACGGGAGGAGAGGCCCCTGATGGCGTTTAACATTAAATGAGCTATCGCAGACCCACCTGACTGTGGAATATAAAATTGCCAAATATCCT
TTCTCATGGAAGCGCGTACCCGTTCGTGGAGGAAACGGAACGGCAGCCCAGCCGTGGGACGGACGTGGACGTTTACTGCATTCCTGTTTG
CCGTGTAAATGTTAGAAAGGAATTAAAGTTATTACTCGGAATAAAGGATGACTTTGGCGGATGTCGCCCCTGCAAGGAGGTGGCTGAAAG
TGGTGTCCAGATGTCCTTCCGAGGACTCGGCGTATCCGCCACCAGGGACATTAAGAAACCGCACGTGATGTCGCTATGCTCTAACGATCA
CCTCAGTTCTCCCTCGGATTCTGGGAACAGATGAAACTTTTTGCATCGCTTGAGTCATTTTTATCACAATAATCCTACTGTGAAGCTGTC
GTTGAGAACTTAGGTTGGCACGTAGCGTCTCAAGGTATGCGTTCTCTCAAAGGAAAGCTATGCATCGCTGCTTCGTTGTCTGATTTTGCT
TAGATTTTGCTTTGGTTAGGTTGCGTTTTGGGGTTTGCCTTTTTTTGTTGTCGCTTAAATGCAATTTGGTTGTAAAGATTTGATTCCTTT
GTGTTCATCTGTTCCGCTTCTCAGCGGTCCATCTCAGCGTCTCCCTTCAGGAACCGCTGAGTGTCCTCTCTTAACATCCAAGCCTTTTAA
TGAAATCGTACTGAAATCTGTATCAGCTAAGAGTCCTCCAATCCTGGTCCCATTAACTCCAAGTGCCTTTTTGACAGTGACAACAGACAG
TCCCTCGCTTTTTGTTGTTGTTGGTTTTCTTAACCCCTTTAATGGAACTGCCTGGATTTTATACAGTTATTAAAGGATGTCTCTTTTGCT
TTAAACTGCATGCTGCCAAGTGCCATTTGGGGTCAGCATCCTCGTTTCAACACAGTGTGCTCTCTAGTTATCATGTGTAACGTGGGTTCT
GTTTAGCGAAGATAGACTAGAGGACACGTTAGAGATGCCCTTCCCTGCTCCATCCCTGTGGCACCATTATGGTTTTTTGGCTGTTTGTAT
ATACGGTTACGTATTAACTCTGGAATCCTATGGGCTCATCTTGCTCACCCAATGTGGGAGTCTGGTTTGAGCAAGCGAGCTGAATGTGAC
TATTAAAAAAAATTTAAAAAAAAAAAAGAAAATCTTATGTACTATCCAAAAGTGCCAGAATGACTCTTCTGTGCATTCTTCTTAAAGAGC

>In-frame_C11orf80_ENST00000540737_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_4194nt
ACTGGCGGAGTTCCAAGCCCGGGCTGAGGAGGGGGCGGCGGCGGCGGCGGCGGCGGCGGGCGGGTACCCTTCGACTGGGCGTTGCCGCTG
TTCCCTGCGCGGCATGGAGGGGACGGCCGTGGCCGTGTTCGAGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAAGAAGTTC
CTAAAAGAAATACAGTCCATACTGCCCGGAATCTCTGCAAAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATATGACAGGG
GTAACACCCTTCCAGATGATTTTTGAGGTTGATGAAAAGCCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAA
ATCATCATGGTGCACCCTAAGGTCAGATTTCATTTCAGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAA
CCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTCGACTCCCAGCATTATGTGAGTAGACCAAATTTTGGTACAATTGAATCACAC
TGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATGCTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATA
CTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTTTCTTCCAACCAGCTTAACAGGATTTCTTCAGTTTCCATATTTCTATATGGA
CCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAGCCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAA
TACCATTTGTGTATGATACCCAATTTGGATCTCAATTTGGATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAG
GAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAA
ATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGTCTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAG
TTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCAGGTCCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTG
GCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTGCTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAG
CACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGTTCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCA
CGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACCAGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTC
CATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTGCACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCC
CGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGCCAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTAC
CATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAATCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGT
AGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAGCAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAA
CATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAGCTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCAC
CTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTAATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTA
CTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTCCCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAG
CAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAATCCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCC
CTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGATGCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTC
TCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAGATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGG
GGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTCTCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTC
CAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTGGACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGA
GATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAAGAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAG
CTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAATGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTG
GAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGCCTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCA
GCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAGGAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAG
AAACGGGAGGAGAGGCCCCTGATGGCGTTTAACATTAAATGAGCTATCGCAGACCCACCTGACTGTGGAATATAAAATTGCCAAATATCC
TTTCTCATGGAAGCGCGTACCCGTTCGTGGAGGAAACGGAACGGCAGCCCAGCCGTGGGACGGACGTGGACGTTTACTGCATTCCTGTTT
GCCGTGTAAATGTTAGAAAGGAATTAAAGTTATTACTCGGAATAAAGGATGACTTTGGCGGATGTCGCCCCTGCAAGGAGGTGGCTGAAA
GTGGTGTCCAGATGTCCTTCCGAGGACTCGGCGTATCCGCCACCAGGGACATTAAGAAACCGCACGTGATGTCGCTATGCTCTAACGATC
ACCTCAGTTCTCCCTCGGATTCTGGGAACAGATGAAACTTTTTGCATCGCTTGAGTCATTTTTATCACAATAATCCTACTGTGAAGCTGT
CGTTGAGAACTTAGGTTGGCACGTAGCGTCTCAAGGTATGCGTTCTCTCAAAGGAAAGCTATGCATCGCTGCTTCGTTGTCTGATTTTGC
TTAGATTTTGCTTTGGTTAGGTTGCGTTTTGGGGTTTGCCTTTTTTTGTTGTCGCTTAAATGCAATTTGGTTGTAAAGATTTGATTCCTT
TGTGTTCATCTGTTCCGCTTCTCAGCGGTCCATCTCAGCGTCTCCCTTCAGGAACCGCTGAGTGTCCTCTCTTAACATCCAAGCCTTTTA
ATGAAATCGTACTGAAATCTGTATCAGCTAAGAGTCCTCCAATCCTGGTCCCATTAACTCCAAGTGCCTTTTTGACAGTGACAACAGACA
GTCCCTCGCTTTTTGTTGTTGTTGGTTTTCTTAACCCCTTTAATGGAACTGCCTGGATTTTATACAGTTATTAAAGGATGTCTCTTTTGC
TTTAAACTGCATGCTGCCAAGTGCCATTTGGGGTCAGCATCCTCGTTTCAACACAGTGTGCTCTCTAGTTATCATGTGTAACGTGGGTTC
TGTTTAGCGAAGATAGACTAGAGGACACGTTAGAGATGCCCTTCCCTGCTCCATCCCTGTGGCACCATTATGGTTTTTTGGCTGTTTGTA
TATACGGTTACGTATTAACTCTGGAATCCTATGGGCTCATCTTGCTCACCCAATGTGGGAGTCTGGTTTGAGCAAGCGAGCTGAATGTGA
CTATTAAAAAAAATTTAAAAAAAAAAAAGAAAATCTTATGTACTATCCAAAAGTGCCAGAATGACTCTTCTGTGCATTCTTCTTAAAGAG

>In-frame_C11orf80_ENST00000532565_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_4385nt
GGAGGGGACGGCCGTGGCCGTGTTCGAGATTTTGAGATTTTTAATAATTCACTGGAAGTGTGACATAGATGTATCAAAGGGAGCATTGCT
AGAAGGGCAGCTAGTGATTTCCATAGAAGGATTAAATTCTAAGCACCAGGCAAATGCTCTTCATTGTGTAACAACTAGATGGAGTCTCAC
TCTGTTACCCAGGCCGGAGTGCAGTGGCGCAGTCTCGGCTCACTGCAACCTCCACCTCCCAGGTTCAAGTGATTCTCATGCCTCAGTCCC
CCGAGTAGCTGGGATTACAGATGCCCACCACCATGCCTGGCTAATTATGGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAA
GAAGTTCCTAAAAGAAATACAGTCCATACTGCCCGGAATCTCTGCAAAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATAT
GACAGGGGTAACACCCTTCCAGATGATTTTTGAGGCAGGTTGATGAAAAGCCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATT
TTTTACGTAAAATCATCATGGTGCACCCTAAGGTCAGATTTCATTTCAGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGG
TGGAGAATGAACCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTGGTCGACTCCCAGCATTATGTGAGACCAAATTTTGGTACAATTG
AATCACACTGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATGCTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAG
AACTGATACTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTTTCTTCCAACCAGCTTAACAGGATTTCTTCACAACTACACATAT
TTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAGCCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTG
ACTGGAAAAAATACCATTTGTGTATGATACCCAATTTGGATCTCAATTTGGATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGG
AATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTC
CAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGTCTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACA
TTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCAGGTCCCGTTGTAACACAGGACATTACCACGTATCACACGG
TGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTGCTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGA
AACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGTTCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACT
TGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACCAGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGA
TGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTGCACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGG
AATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGCCAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGG
GGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAATCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATG
ACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAGCAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCA
CCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAGCTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGAT
CAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTAATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTT
ACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTCCCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCC
CGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAATCCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCC
AGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGATGCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGT
CGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAGATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGA
TGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTCTCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCAT
ACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTGGACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGA
AGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAAGAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGG
CCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAATGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGC
GATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGCCTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCT
CGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAGGAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAA
GCCCCTGGCAGAAACGGGAGGAGAGGCCCCTGATGGCGTTTAACATTAAATGAGCTATCGCAGACCCACCTGACTGTGGAATATAAAATT
GCCAAATATCCTTTCTCATGGAAGCGCGTACCCGTTCGTGGAGGAAACGGAACGGCAGCCCAGCCGTGGGACGGACGTGGACGTTTACTG
CATTCCTGTTTGCCGTGTAAATGTTAGAAAGGAATTAAAGTTATTACTCGGAATAAAGGATGACTTTGGCGGATGTCGCCCCTGCAAGGA
GGTGGCTGAAAGTGGTGTCCAGATGTCCTTCCGAGGACTCGGCGTATCCGCCACCAGGGACATTAAGAAACCGCACGTGATGTCGCTATG
CTCTAACGATCACCTCAGTTCTCCCTCGGATTCTGGGAACAGATGAAACTTTTTGCATCGCTTGAGTCATTTTTATCACAATAATCCTAC
TGTGAAGCTGTCGTTGAGAACTTAGGTTGGCACGTAGCGTCTCAAGGTATGCGTTCTCTCAAAGGAAAGCTATGCATCGCTGCTTCGTTG
TCTGATTTTGCTTAGATTTTGCTTTGGTTAGGTTGCGTTTTGGGGTTTGCCTTTTTTTGTTGTCGCTTAAATGCAATTTGGTTGTAAAGA
TTTGATTCCTTTGTGTTCATCTGTTCCGCTTCTCAGCGGTCCATCTCAGCGTCTCCCTTCAGGAACCGCTGAGTGTCCTCTCTTAACATC
CAAGCCTTTTAATGAAATCGTACTGAAATCTGTATCAGCTAAGAGTCCTCCAATCCTGGTCCCATTAACTCCAAGTGCCTTTTTGACAGT
GACAACAGACAGTCCCTCGCTTTTTGTTGTTGTTGGTTTTCTTAACCCCTTTAATGGAACTGCCTGGATTTTATACAGTTATTAAAGGAT
GTCTCTTTTGCTTTAAACTGCATGCTGCCAAGTGCCATTTGGGGTCAGCATCCTCGTTTCAACACAGTGTGCTCTCTAGTTATCATGTGT
AACGTGGGTTCTGTTTAGCGAAGATAGACTAGAGGACACGTTAGAGATGCCCTTCCCTGCTCCATCCCTGTGGCACCATTATGGTTTTTT
GGCTGTTTGTATATACGGTTACGTATTAACTCTGGAATCCTATGGGCTCATCTTGCTCACCCAATGTGGGAGTCTGGTTTGAGCAAGCGA
GCTGAATGTGACTATTAAAAAAAATTTAAAAAAAAAAAAGAAAATCTTATGTACTATCCAAAAGTGCCAGAATGACTCTTCTGTGCATTC

>In-frame_C11orf80_ENST00000525449_chr11_66583670_+_FAM171A1_ENST00000378116_chr10_15263059_-_4335nt
ATAATTCACTGGAAGTGTGACATAGATGTATCAAAGGGAGCATTGCTAGAAGGGCAGCTAGTGATTTCCATAGAAGGATTAAATTCTAAG
CACCAGGCAAATGCTCTTCATTGTGTAACAACTAGATGGAGTCTCACTCTGTTACCCAGGCCGGAGTGCAGTGGCGCAGTCTCGGCTCAC
TGCAACCTCCACCTCCCAGGTTCAAGTGATTCTCATGCCTCAGTCCCCCGAGTAGCTGGGATTACAGATGCCCACCACCATGCCTGGCTA
ATTATGGTTGCTTCTGCAGGAAGCCTTTTTGGTGGCATGGTCCTCAAGAAGTTCCTAAAAGAAATACAGTCCATACTGCCCGGAATCTCT
GCAAAGCTGACTTGGACTTCAGAGGAAGGCAGCTATTCTCAGGATATGACAGGGGTAACACCCTTCCAGATGATTTTTGAGGTTGATGAA
AAGCCCAGAACCTTGATGACAGATTGTCTGGTTATAAAGCATTTTTTACGTAAAATCATCATGGTGCACCCTAAGGTCAGATTTCATTTC
AGTGTAAAGGTAAATGGAATCCTCTCCACAGAGATCTTTGGGGTGGAGAATGAACCCACTTTGAACCTTGGGAATGGAATTGCTCTTTTG
GTCGACTCCCAGCATTATGTGAGACCAAATTTTGGTACAATTGAATCACACTGCAGCAGAATTCACCCTGTGCTAGGACATCCAGTAATG
CTTTTCATCCCTGAAGACGTGGCTGGCATGGACTTGTTGGGAGAACTGATACTGACTCCAGCAGCTGCACTGTGCCCCAGCCCAAAGGTT
TCTTCCAACCAGCTTAACAGGATTTCTTCAGTTTCCATATTTCTATATGGACCTTTGGGTCTGCCTCTGATATTGTCAACTTGGGAGCAG
CCGATGACTACTTTCTTCAAAGATACCTCTTCTTTAGTTGACTGGAAAAAATACCATTTGTGTATGATACCCAATTTGGATCTCAATTTG
GATAGAGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACT
CTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAACGTGGCTGAAGAGCGGTCTGGGT
CTTGTGCACCAGGAAGGCAGCCAGCTGACGTGGACATACATTGCCCCCCAGTTGGGGTACTGGGTGGCCGCCATGTCCCCTCCCATCCCA
GGTCCCGTTGTAACACAGGACATTACCACGTATCACACGGTGTTTCTTTTGGCCATTTTAGGAGGAATGGCTTTCATACTTTTGGTTTTG
CTGTGTCTCCTTTTATATTATTGCAGGAGGAAGTGCTTGAAACCTCGTCAGCACCACAGAAAACTGCAGCTCCCTGCAGGACTGGAGAGT
TCCAAAAGAGACCAGTCCACGTCCATGTCACACATTAACTTGCTGTTTTCACGCCGAGCGTCAGAATTCCCTGGCCCGCTGTCCGTCACC
AGCCACGGCCGCCCCGAGGCCCCCGGCACGAAGGAACTGATGAGTGGAGTCCATTTGGAAATGATGTCTCCGGGCGGCGAAGGGGACCTG
CACACCCCCATGCTCAAGCTCTCCTACAGCACCTCCCAGGAATTTAGCTCCCGGGAGGAGCTCCTCTCTTGCAAGGAAGAGGATAAAAGC
CAGATCTCCTTTGATAACCTCACTCCAAGTGGGACGCTGGGGAAAGACTACCATAAGTCAGTGGAGGTTTTTCCCTTAAAGGCAAGAAAA
TCTATGGAAAGAGAAGGCTACGAGTCCTCGGGCAATGATGACTACAGGGGTAGTTACAACACCGTGCTCTCACAGCCTTTATTTGAAAAG
CAGGACAGAGAAGGTCCAGCCTCCACGGGAAGCAAACTCACCATTCAGGAACATCTGTACCCCGCGCCTTCATCACCTGAGAAAGAACAG
CTGCTGGACCGCAGACCCACTGAATGTATGATGTCGCGATCAGTAGATCACCTCGAGAGACCTACGTCCTTCCCACGGCCCGGCCAGTTA
ATCTGCTGCAGTTCTGTCGACCAGGTCAATGACAGCGTTTACAGGAAAGTACTGCCTGCCTTGGTCATCCCGGCTCATTATATGAAACTC
CCCGGGGACCACTCCTATGTCAGCCAGCCCCTCGTCGTCCCGGCTGATCAGCAGCTTGAGATAGAAAGACTACAGGCTGAGCTGTCCAAT
CCCCATGCCGGGATCTTCCCACACCCGTCCTCACAGATCCAGCCCCAGCCCCTGTCTTCCCAGGCCATCTCTCAGCAGCACCTGCAGGAT
GCGGGCACCCGGGAGTGGAGCCCTCAGAACGCATCCATGTCGGAGTCTCTCTCCATCCCAGCTTCCCTGAACGACGCGGCTTTGGCTCAG
ATGAACAGTGAGGTGCAGCTCCTGACTGAAAAGGCCCTGATGGAGCTTGGGGGTGGGAAGCCGCTTCCGCACCCCCGGGCGTGGTTCGTC
TCCTTGGATGGCAGGTCCAACGCTCACGTTAGACATTCATACATTGATCTCCAAAGAGCTGGAAGGAACGGAAGTAATGATGCCAGTTTG
GACTCTGGCGTAGATATGAATGAACCAAAATCAGCCCGGAAGGGAAGGGGAGATGCTTTGTCTCTGCAGCAGAACTACCCGCCCGTCCAA
GAGCACCAGCAGAAAGAGCCTCGAGCCCCAGACAGCACGGCCTACACGCAGCTCGTGTACCTGGATGACGTGGAACAGAGTGGTAGCGAA
TGTGGGACCACGGTCTGTACCCCCGAGGACAGTGCCCTGCGATGCTTGTTGGAGGGGTCGAGTCGGAGAAGTGGTGGCCAGCTGCCCAGC
CTGCAGGAGGAGACGACCAGACGGACTGCGGATGCCCCCTCGGAGCCAGCAGCCAGCCCCCACCAGAGAAGATCTGCCCACGAGGAAGAG
GAAGACGATGATGATGATGACCAAGGAGAAGACAAGAAAAGCCCCTGGCAGAAACGGGAGGAGAGGCCCCTGATGGCGTTTAACATTAAA
TGAGCTATCGCAGACCCACCTGACTGTGGAATATAAAATTGCCAAATATCCTTTCTCATGGAAGCGCGTACCCGTTCGTGGAGGAAACGG
AACGGCAGCCCAGCCGTGGGACGGACGTGGACGTTTACTGCATTCCTGTTTGCCGTGTAAATGTTAGAAAGGAATTAAAGTTATTACTCG
GAATAAAGGATGACTTTGGCGGATGTCGCCCCTGCAAGGAGGTGGCTGAAAGTGGTGTCCAGATGTCCTTCCGAGGACTCGGCGTATCCG
CCACCAGGGACATTAAGAAACCGCACGTGATGTCGCTATGCTCTAACGATCACCTCAGTTCTCCCTCGGATTCTGGGAACAGATGAAACT
TTTTGCATCGCTTGAGTCATTTTTATCACAATAATCCTACTGTGAAGCTGTCGTTGAGAACTTAGGTTGGCACGTAGCGTCTCAAGGTAT
GCGTTCTCTCAAAGGAAAGCTATGCATCGCTGCTTCGTTGTCTGATTTTGCTTAGATTTTGCTTTGGTTAGGTTGCGTTTTGGGGTTTGC
CTTTTTTTGTTGTCGCTTAAATGCAATTTGGTTGTAAAGATTTGATTCCTTTGTGTTCATCTGTTCCGCTTCTCAGCGGTCCATCTCAGC
GTCTCCCTTCAGGAACCGCTGAGTGTCCTCTCTTAACATCCAAGCCTTTTAATGAAATCGTACTGAAATCTGTATCAGCTAAGAGTCCTC
CAATCCTGGTCCCATTAACTCCAAGTGCCTTTTTGACAGTGACAACAGACAGTCCCTCGCTTTTTGTTGTTGTTGGTTTTCTTAACCCCT
TTAATGGAACTGCCTGGATTTTATACAGTTATTAAAGGATGTCTCTTTTGCTTTAAACTGCATGCTGCCAAGTGCCATTTGGGGTCAGCA
TCCTCGTTTCAACACAGTGTGCTCTCTAGTTATCATGTGTAACGTGGGTTCTGTTTAGCGAAGATAGACTAGAGGACACGTTAGAGATGC
CCTTCCCTGCTCCATCCCTGTGGCACCATTATGGTTTTTTGGCTGTTTGTATATACGGTTACGTATTAACTCTGGAATCCTATGGGCTCA
TCTTGCTCACCCAATGTGGGAGTCTGGTTTGAGCAAGCGAGCTGAATGTGACTATTAAAAAAAATTTAAAAAAAAAAAAGAAAATCTTAT
GTACTATCCAAAAGTGCCAGAATGACTCTTCTGTGCATTCTTCTTAAAGAGCTGCTTGGTTATCCAAAAATGAAAATTCAAAATAAACTC


Top

FusionGenePPI for C11orf80_FAM171A1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
C11orf80FAM171A1NTRK1, TMEM17, CTDSPL, FAM171B, PCDHGB1, TNFRSF17


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for C11orf80_FAM171A1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for C11orf80_FAM171A1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource