FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 460

FusionGeneSummary for ACPP_NEDD4L

check button Fusion gene summary
Fusion gene informationFusion gene name: ACPP_NEDD4L
Fusion gene ID: 460
HgeneTgene
Gene symbol

ACPP

NEDD4L

Gene ID

55

23327

Gene nameacid phosphatase, prostateneural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
Synonyms5'-NT|ACP-3|ACP3NEDD4-2|NEDD4.2|PVNH7|RSP5|hNEDD4-2
Cytomap

3q22.1

18q21.31

Type of geneprotein-codingprotein-coding
Descriptionprostatic acid phosphataseTMPaseecto-5'-nucleotidaseprostatic acid phosphotasethiamine monophosphataseE3 ubiquitin-protein ligase NEDD4-likeHECT-type E3 ubiquitin transferase NED4Lubiquitin-protein ligase Rsp5
Modification date2018051920180523
UniProtAcc

P15309

Q96PU5

Ensembl transtripts involved in fusion geneENST00000336375, ENST00000475741, 
ENST00000351273, ENST00000489084, 
ENST00000356462, ENST00000400345, 
ENST00000589054, ENST00000256832, 
ENST00000382850, ENST00000256830, 
ENST00000588516, ENST00000456986, 
ENST00000435432, ENST00000357895, 
ENST00000586263, ENST00000456173, 
ENST00000431212, 
Fusion gene scores* DoF score13 X 6 X 2=15613 X 14 X 6=1092
# samples 1516
** MAII scorelog2(15/156*10)=-0.0565835283663674
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(16/1092*10)=-2.77082904603249
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ACPP [Title/Abstract] AND NEDD4L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Tissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneACPP

GO:0046085

adenosine metabolic process

18940592

HgeneACPP

GO:0051289

protein homotetramerization

10639192

TgeneNEDD4L

GO:0003254

regulation of membrane depolarization

15217910

TgeneNEDD4L

GO:0006511

ubiquitin-dependent protein catabolic process

21463633

TgeneNEDD4L

GO:0010038

response to metal ion

11244092

TgeneNEDD4L

GO:0016567

protein ubiquitination

15217910|25631046

TgeneNEDD4L

GO:0034765

regulation of ion transmembrane transport

17289006

TgeneNEDD4L

GO:0042391

regulation of membrane potential

17289006

TgeneNEDD4L

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

21463633

TgeneNEDD4L

GO:0060306

regulation of membrane repolarization

21463633

TgeneNEDD4L

GO:0070936

protein K48-linked ubiquitination

21463633

TgeneNEDD4L

GO:1901016

regulation of potassium ion transmembrane transporter activity

17289006

TgeneNEDD4L

GO:1901017

negative regulation of potassium ion transmembrane transporter activity

21463633

TgeneNEDD4L

GO:1901380

negative regulation of potassium ion transmembrane transport

21463633

TgeneNEDD4L

GO:1902306

negative regulation of sodium ion transmembrane transport

15217910

TgeneNEDD4L

GO:1903861

positive regulation of dendrite extension

23999003

TgeneNEDD4L

GO:2000009

negative regulation of protein localization to cell surface

21463633

TgeneNEDD4L

GO:2000650

negative regulation of sodium ion transmembrane transporter activity

15217910


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-HC-7210-01AACPPchr3

132056398

+NEDD4Lchr18

55833020

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336375ENST00000356462ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
In-frameENST00000336375ENST00000400345ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-intronENST00000336375ENST00000589054ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000336375ENST00000256832ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000336375ENST00000382850ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000336375ENST00000256830ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-3UTRENST00000336375ENST00000588516ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000336375ENST00000456986ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000336375ENST00000435432ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000336375ENST00000357895ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000336375ENST00000586263ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-intronENST00000336375ENST00000456173ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-intronENST00000336375ENST00000431212ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-3CDSENST00000475741ENST00000356462ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-3CDSENST00000475741ENST00000400345ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-intronENST00000475741ENST00000589054ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000475741ENST00000256832ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000475741ENST00000382850ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000475741ENST00000256830ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-3UTRENST00000475741ENST00000588516ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000475741ENST00000456986ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000475741ENST00000435432ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000475741ENST00000357895ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000475741ENST00000586263ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-intronENST00000475741ENST00000456173ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-intronENST00000475741ENST00000431212ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
In-frameENST00000351273ENST00000356462ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
In-frameENST00000351273ENST00000400345ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-intronENST00000351273ENST00000589054ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000351273ENST00000256832ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000351273ENST00000382850ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000351273ENST00000256830ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-3UTRENST00000351273ENST00000588516ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000351273ENST00000456986ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000351273ENST00000435432ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000351273ENST00000357895ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-5UTRENST00000351273ENST00000586263ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-intronENST00000351273ENST00000456173ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
5CDS-intronENST00000351273ENST00000431212ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-3CDSENST00000489084ENST00000356462ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-3CDSENST00000489084ENST00000400345ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-intronENST00000489084ENST00000589054ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000489084ENST00000256832ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000489084ENST00000382850ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000489084ENST00000256830ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-3UTRENST00000489084ENST00000588516ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000489084ENST00000456986ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000489084ENST00000435432ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000489084ENST00000357895ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-5UTRENST00000489084ENST00000586263ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-intronENST00000489084ENST00000456173ACPPchr3

132056398

+NEDD4Lchr18

55833020

+
intron-intronENST00000489084ENST00000431212ACPPchr3

132056398

+NEDD4Lchr18

55833020

+

Top

FusionProtFeatures for ACPP_NEDD4L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACPP

P15309

NEDD4L

Q96PU5

A non-specific tyrosine phosphatase thatdephosphorylates a diverse number of substrates under acidicconditions (pH 4-6) including alkyl, aryl, and acyl orthophosphatemonoesters and phosphorylated proteins. Has lipid phosphataseactivity and inactivates lysophosphatidic acid in seminal plasma. Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons.Generates adenosine from AMP which acts as a pain suppressor. Actsas a tumor suppressor of prostate cancer through dephosphorylationof ERBB2 and deactivation of MAPK-mediated signaling.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000256830+028193_22616872DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000256830+028385_41816872DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000256830+028497_53016872DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000256830+028548_58116872DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000256830+028640_97416872DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000356462+029193_22616912DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000356462+029385_41816912DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000356462+029497_53016912DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000356462+029548_58116912DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000356462+029640_97416912DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000357895+031193_2268968DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000357895+031385_4188968DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000357895+031497_5308968DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000357895+031548_5818968DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000357895+031640_9748968DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000357895+0317_1098968DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000382850+030193_22616956DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000382850+030385_41816956DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000382850+030497_53016956DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000382850+030548_58116956DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000382850+030640_97416956DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000400345+031193_22616976DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000400345+031385_41816976DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000400345+031497_53016976DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000400345+031548_58116976DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000400345+031640_97416976DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000431212+030193_226-155855DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000431212+030385_418-155855DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000431212+030497_530-155855DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000431212+030548_581-155855DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000431212+030640_974-155855DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000431212+0307_109-155855DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000435432+031193_226-131835DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000435432+031385_418-131835DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000435432+031497_530-131835DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000435432+031548_581-131835DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000435432+031640_974-131835DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000435432+0317_109-131835DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456173+029193_226-195835DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456173+029385_418-195835DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456173+029497_530-195835DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456173+029548_581-195835DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456173+029640_974-195835DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456173+0297_109-195835DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456986+031193_226-105855DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456986+031385_418-105855DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456986+031497_530-105855DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456986+031548_581-105855DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456986+031640_974-105855DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000456986+0317_109-105855DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000586263+030193_2268948DomainWW 1
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000586263+030385_4188948DomainWW 2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000586263+030497_5308948DomainWW 3
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000586263+030548_5818948DomainWW 4
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000586263+030640_9748948DomainHECT
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000586263+0307_1098948DomainC2

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000256830+0287_10916872DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000356462+0297_10916912DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000382850+0307_10916956DomainC2
TgeneNEDD4Lchr3:132056398chr18:55833020ENST00000400345+0317_10916976DomainC2


Top

FusionGeneSequence for ACPP_NEDD4L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACPP_ENST00000336375_chr3_132056398_+_NEDD4L_ENST00000356462_chr18_55833020_+_1081aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYR
KFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR
LHPYKGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTR
DDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELP
PPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVN
IAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPLAEDGASGSATNSNNH
LIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTW
EDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIP
NRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNED
HLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGS
EIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWK
AVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD

>In-frame_ACPP_ENST00000336375_chr3_132056398_+_NEDD4L_ENST00000400345_chr18_55833020_+_1145aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYR
KFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR
LHPYKGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTR
DDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELP
PPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVN
IAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPPSAPAGRARSSTVTGG
EEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGA
KDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLP
PGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRP
DVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFF
IRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQ
KQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMN

>In-frame_ACPP_ENST00000351273_chr3_132056398_+_NEDD4L_ENST00000356462_chr18_55833020_+_1081aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYR
KFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR
LHPYKGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTR
DDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELP
PPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVN
IAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPLAEDGASGSATNSNNH
LIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTW
EDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIP
NRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNED
HLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGS
EIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWK
AVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD

>In-frame_ACPP_ENST00000351273_chr3_132056398_+_NEDD4L_ENST00000400345_chr18_55833020_+_1145aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYR
KFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR
LHPYKGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTR
DDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELP
PPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVN
IAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPPSAPAGRARSSTVTGG
EEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGA
KDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLP
PGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRP
DVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFF
IRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQ
KQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACPP_ENST00000336375_chr3_132056398_+_NEDD4L_ENST00000356462_chr18_55833020_+_3243nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGCATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAA
TCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGA
AAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATATTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTG
GCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATCCTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAA
GATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGG
CTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAAAAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGT
GATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGAATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAAC
CCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCATCTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGA
GACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACCTTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTT
CTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGATTTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAA
GAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGGAAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCT
CCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGG
CACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACAATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCC
CGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGGAGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAAT
ATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCACCGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTA
AGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAACAGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGC
AGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCACCGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAACAGTAACAACCAT
CTAATCGAGCCTCAGATCCGCCGGCCTCGTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCCAAGGACTCACCC
GTACGTCGGGCTGTGAAAGACACCCTTTCCAACCCACAGTCCCCACAGCCATCACCTTACAACTCCCCCAAACCACAACACAAAGTCACA
CAGAGCTTCTTGCCACCCGGCTGGGAAATGAGGATAGCGCCAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAGACTACAACCTGG
GAAGATCCACGTTTGAAATTTCCAGTACATATGCGGTCAAAGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCTCCTGGCTGGGAA
GAAAGAATTCACTTGGATGGCCGAACGTTTTATATTGATCATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTGCAGAACCCAGCT
ATTACTGGTCCGGCTGTCCCTTACTCCAGAGAATTTAAGCAGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCTGCTGATATCCCC
AATAGGTTTGAAATGAAACTTCACAGAAATAACATATTTGAAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCAGATGTCCTAAAA
GCTAGACTGTGGATTGAGTTTGAATCAGAGAAAGGTCTTGACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATG
TTCAACCCCTACTACGGCCTCTTTGAGTACTCTGCCACGGACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTCTGTAATGAGGAT
CATTTGTCCTACTTCACTTTTATTGGAAGAGTTGCTGGTCTGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTCATTAGACCATTT
TACAAGATGATGTTGGGAAAGCAGATAACCCTGAATGACATGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAATGGATCCTGGAG
AATGACCCTACTGAGCTGGACCTCATGTTCTGCATAGACGAAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAGCCCAATGGGTCA
GAAATAATGGTCACAAATGAAAACAAAAGGGAATATATCGACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAGAAGCAGATGAAC
GCCTTCTTGGAGGGATTCACAGAACTACTTCCTATTGATTTGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTCATGTGCGGCCTC
GGTGATGTGGATGTGAATGACTGGAGACAGCATTCTATTTACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAGTGGTTCTGGAAG
GCTGTGCTACTCATGGACGCCGAAAAGCGTATCCGGTTACTGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAATGGATTTGCCGAA
CTTTATGGTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACATGCTTTAATCGC
CTTGACTTACCTCCATATGAAACCTTTGAAGATTTACGAGAGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTTGAAGGGGTGGAT

>In-frame_ACPP_ENST00000336375_chr3_132056398_+_NEDD4L_ENST00000400345_chr18_55833020_+_3435nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGCATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAA
TCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGA
AAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATATTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTG
GCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATCCTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAA
GATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGG
CTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAAAAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGT
GATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGAATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAAC
CCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCATCTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGA
GACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACCTTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTT
CTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGATTTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAA
GAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGGAAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCT
CCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGG
CACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACAATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCC
CGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGGAGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAAT
ATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCACCGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTA
AGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAACAGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGC
AGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCACCGCCCAGTGCCCCAGCTGGGAGAGCGCGTTCATCAACTGTCACGGGTGGT
GAGGAACCAACGCCATCAGTGGCCTATGTACATACCACGCCGGGTCTGCCTTCAGGCTGGGAAGAAAGAAAAGATGCTAAGGGGCGCACA
TACTATGTCAATCATAACAATCGAACCACAACTTGGACTCGACCTATCATGCAGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAAC
AGTAACAACCATCTAATCGAGCCTCAGATCCGCCGGCCTCGTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCC
AAGGACTCACCCGTACGTCGGGCTGTGAAAGACACCCTTTCCAACCCACAGTCCCCACAGCCATCACCTTACAACTCCCCCAAACCACAA
CACAAAGTCACACAGAGCTTCTTGCCACCCGGCTGGGAAATGAGGATAGCGCCAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAG
ACTACAACCTGGGAAGATCCACGTTTGAAATTTCCAGTACATATGCGGTCAAAGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCT
CCTGGCTGGGAAGAAAGAATTCACTTGGATGGCCGAACGTTTTATATTGATCATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTG
CAGAACCCAGCTATTACTGGTCCGGCTGTCCCTTACTCCAGAGAATTTAAGCAGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCT
GCTGATATCCCCAATAGGTTTGAAATGAAACTTCACAGAAATAACATATTTGAAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCA
GATGTCCTAAAAGCTAGACTGTGGATTGAGTTTGAATCAGAGAAAGGTCTTGACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTG
TCCAAAGAGATGTTCAACCCCTACTACGGCCTCTTTGAGTACTCTGCCACGGACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTC
TGTAATGAGGATCATTTGTCCTACTTCACTTTTATTGGAAGAGTTGCTGGTCTGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTC
ATTAGACCATTTTACAAGATGATGTTGGGAAAGCAGATAACCCTGAATGACATGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAA
TGGATCCTGGAGAATGACCCTACTGAGCTGGACCTCATGTTCTGCATAGACGAAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAG
CCCAATGGGTCAGAAATAATGGTCACAAATGAAAACAAAAGGGAATATATCGACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAG
AAGCAGATGAACGCCTTCTTGGAGGGATTCACAGAACTACTTCCTATTGATTTGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTC
ATGTGCGGCCTCGGTGATGTGGATGTGAATGACTGGAGACAGCATTCTATTTACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAG
TGGTTCTGGAAGGCTGTGCTACTCATGGACGCCGAAAAGCGTATCCGGTTACTGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAAT
GGATTTGCCGAACTTTATGGTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACA
TGCTTTAATCGCCTTGACTTACCTCCATATGAAACCTTTGAAGATTTACGAGAGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTT

>In-frame_ACPP_ENST00000351273_chr3_132056398_+_NEDD4L_ENST00000356462_chr18_55833020_+_3243nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGCATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAA
TCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGA
AAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATATTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTG
GCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATCCTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAA
GATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGG
CTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAAAAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGT
GATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGAATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAAC
CCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCATCTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGA
GACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACCTTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTT
CTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGATTTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAA
GAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGGAAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCT
CCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGG
CACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACAATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCC
CGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGGAGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAAT
ATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCACCGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTA
AGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAACAGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGC
AGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCACCGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAACAGTAACAACCAT
CTAATCGAGCCTCAGATCCGCCGGCCTCGTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCCAAGGACTCACCC
GTACGTCGGGCTGTGAAAGACACCCTTTCCAACCCACAGTCCCCACAGCCATCACCTTACAACTCCCCCAAACCACAACACAAAGTCACA
CAGAGCTTCTTGCCACCCGGCTGGGAAATGAGGATAGCGCCAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAGACTACAACCTGG
GAAGATCCACGTTTGAAATTTCCAGTACATATGCGGTCAAAGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCTCCTGGCTGGGAA
GAAAGAATTCACTTGGATGGCCGAACGTTTTATATTGATCATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTGCAGAACCCAGCT
ATTACTGGTCCGGCTGTCCCTTACTCCAGAGAATTTAAGCAGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCTGCTGATATCCCC
AATAGGTTTGAAATGAAACTTCACAGAAATAACATATTTGAAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCAGATGTCCTAAAA
GCTAGACTGTGGATTGAGTTTGAATCAGAGAAAGGTCTTGACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATG
TTCAACCCCTACTACGGCCTCTTTGAGTACTCTGCCACGGACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTCTGTAATGAGGAT
CATTTGTCCTACTTCACTTTTATTGGAAGAGTTGCTGGTCTGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTCATTAGACCATTT
TACAAGATGATGTTGGGAAAGCAGATAACCCTGAATGACATGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAATGGATCCTGGAG
AATGACCCTACTGAGCTGGACCTCATGTTCTGCATAGACGAAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAGCCCAATGGGTCA
GAAATAATGGTCACAAATGAAAACAAAAGGGAATATATCGACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAGAAGCAGATGAAC
GCCTTCTTGGAGGGATTCACAGAACTACTTCCTATTGATTTGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTCATGTGCGGCCTC
GGTGATGTGGATGTGAATGACTGGAGACAGCATTCTATTTACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAGTGGTTCTGGAAG
GCTGTGCTACTCATGGACGCCGAAAAGCGTATCCGGTTACTGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAATGGATTTGCCGAA
CTTTATGGTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACATGCTTTAATCGC
CTTGACTTACCTCCATATGAAACCTTTGAAGATTTACGAGAGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTTGAAGGGGTGGAT

>In-frame_ACPP_ENST00000351273_chr3_132056398_+_NEDD4L_ENST00000400345_chr18_55833020_+_3435nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGCATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAA
TCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGA
AAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATATTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTG
GCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATCCTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAA
GATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGG
CTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAAAAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGT
GATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGAATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAAC
CCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCATCTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGA
GACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACCTTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTT
CTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGATTTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAA
GAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGGAAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCT
CCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGG
CACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACAATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCC
CGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGGAGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAAT
ATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCACCGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTA
AGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAACAGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGC
AGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCACCGCCCAGTGCCCCAGCTGGGAGAGCGCGTTCATCAACTGTCACGGGTGGT
GAGGAACCAACGCCATCAGTGGCCTATGTACATACCACGCCGGGTCTGCCTTCAGGCTGGGAAGAAAGAAAAGATGCTAAGGGGCGCACA
TACTATGTCAATCATAACAATCGAACCACAACTTGGACTCGACCTATCATGCAGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAAC
AGTAACAACCATCTAATCGAGCCTCAGATCCGCCGGCCTCGTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCC
AAGGACTCACCCGTACGTCGGGCTGTGAAAGACACCCTTTCCAACCCACAGTCCCCACAGCCATCACCTTACAACTCCCCCAAACCACAA
CACAAAGTCACACAGAGCTTCTTGCCACCCGGCTGGGAAATGAGGATAGCGCCAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAG
ACTACAACCTGGGAAGATCCACGTTTGAAATTTCCAGTACATATGCGGTCAAAGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCT
CCTGGCTGGGAAGAAAGAATTCACTTGGATGGCCGAACGTTTTATATTGATCATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTG
CAGAACCCAGCTATTACTGGTCCGGCTGTCCCTTACTCCAGAGAATTTAAGCAGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCT
GCTGATATCCCCAATAGGTTTGAAATGAAACTTCACAGAAATAACATATTTGAAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCA
GATGTCCTAAAAGCTAGACTGTGGATTGAGTTTGAATCAGAGAAAGGTCTTGACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTG
TCCAAAGAGATGTTCAACCCCTACTACGGCCTCTTTGAGTACTCTGCCACGGACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTC
TGTAATGAGGATCATTTGTCCTACTTCACTTTTATTGGAAGAGTTGCTGGTCTGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTC
ATTAGACCATTTTACAAGATGATGTTGGGAAAGCAGATAACCCTGAATGACATGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAA
TGGATCCTGGAGAATGACCCTACTGAGCTGGACCTCATGTTCTGCATAGACGAAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAG
CCCAATGGGTCAGAAATAATGGTCACAAATGAAAACAAAAGGGAATATATCGACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAG
AAGCAGATGAACGCCTTCTTGGAGGGATTCACAGAACTACTTCCTATTGATTTGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTC
ATGTGCGGCCTCGGTGATGTGGATGTGAATGACTGGAGACAGCATTCTATTTACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAG
TGGTTCTGGAAGGCTGTGCTACTCATGGACGCCGAAAAGCGTATCCGGTTACTGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAAT
GGATTTGCCGAACTTTATGGTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACA
TGCTTTAATCGCCTTGACTTACCTCCATATGAAACCTTTGAAGATTTACGAGAGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACPP_ENST00000336375_chr3_132056398_+_NEDD4L_ENST00000356462_chr18_55833020_+_3638nt
TCAATCCCTTAATTAAATAGCTTCCCCTCTACAGGCTTTTGAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAAC
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGCATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAA
TCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGA
AAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATATTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTG
GCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATCCTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAA
GATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGG
CTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAAAAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGT
GATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGAATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAAC
CCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCATCTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGA
GACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACCTTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTT
CTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGATTTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAA
GAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGGAAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCT
CCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGG
CACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACAATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCC
CGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGGAGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAAT
ATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCACCGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTA
AGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAACAGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGC
AGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCACCGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAACAGTAACAACCAT
CTAATCGAGCCTCAGATCCGCCGGCCTCGTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCCAAGGACTCACCC
GTACGTCGGGCTGTGAAAGACACCCTTTCCAACCCACAGTCCCCACAGCCATCACCTTACAACTCCCCCAAACCACAACACAAAGTCACA
CAGAGCTTCTTGCCACCCGGCTGGGAAATGAGGATAGCGCCAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAGACTACAACCTGG
GAAGATCCACGTTTGAAATTTCCAGTACATATGCGGTCAAAGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCTCCTGGCTGGGAA
GAAAGAATTCACTTGGATGGCCGAACGTTTTATATTGATCATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTGCAGAACCCAGCT
ATTACTGGTCCGGCTGTCCCTTACTCCAGAGAATTTAAGCAGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCTGCTGATATCCCC
AATAGGTTTGAAATGAAACTTCACAGAAATAACATATTTGAAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCAGATGTCCTAAAA
GCTAGACTGTGGATTGAGTTTGAATCAGAGAAAGGTCTTGACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATG
TTCAACCCCTACTACGGCCTCTTTGAGTACTCTGCCACGGACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTCTGTAATGAGGAT
CATTTGTCCTACTTCACTTTTATTGGAAGAGTTGCTGGTCTGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTCATTAGACCATTT
TACAAGATGATGTTGGGAAAGCAGATAACCCTGAATGACATGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAATGGATCCTGGAG
AATGACCCTACTGAGCTGGACCTCATGTTCTGCATAGACGAAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAGCCCAATGGGTCA
GAAATAATGGTCACAAATGAAAACAAAAGGGAATATATCGACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAGAAGCAGATGAAC
GCCTTCTTGGAGGGATTCACAGAACTACTTCCTATTGATTTGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTCATGTGCGGCCTC
GGTGATGTGGATGTGAATGACTGGAGACAGCATTCTATTTACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAGTGGTTCTGGAAG
GCTGTGCTACTCATGGACGCCGAAAAGCGTATCCGGTTACTGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAATGGATTTGCCGAA
CTTTATGGTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACATGCTTTAATCGC
CTTGACTTACCTCCATATGAAACCTTTGAAGATTTACGAGAGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTTGAAGGGGTGGAT
TAAGCACCCTGTGCCTCGGGGGTGGTTGTTCTTCAAGCAAGTTCTGCTTGCACTTTTGCATTTGCCTAACAGACTTTTGCAGAGGCGATG
GCAGAGAGCAGCTGCAGGCATGGTCCCTGGAGCCGAGCCTTCACCACGCACTCGTCCAAGTTCGGATGCGGGAACCTGGTCCCAGCTTGA
GTTCCTGCCTTTCCCACCACAAATTATCAACTGGTTGATGTGTACACTAATTACATTTCAGGAGGACTTAATGCTATTTATGTTGTGCCT

>In-frame_ACPP_ENST00000336375_chr3_132056398_+_NEDD4L_ENST00000400345_chr18_55833020_+_3961nt
TCAATCCCTTAATTAAATAGCTTCCCCTCTACAGGCTTTTGAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAAC
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGCATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAA
TCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGA
AAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATATTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTG
GCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATCCTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAA
GATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGG
CTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAAAAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGT
GATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGAATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAAC
CCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCATCTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGA
GACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACCTTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTT
CTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGATTTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAA
GAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGGAAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCT
CCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACAATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGG
CACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACAATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCC
CGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGGAGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAAT
ATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCACCGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTA
AGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAACAGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGC
AGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCACCGCCCAGTGCCCCAGCTGGGAGAGCGCGTTCATCAACTGTCACGGGTGGT
GAGGAACCAACGCCATCAGTGGCCTATGTACATACCACGCCGGGTCTGCCTTCAGGCTGGGAAGAAAGAAAAGATGCTAAGGGGCGCACA
TACTATGTCAATCATAACAATCGAACCACAACTTGGACTCGACCTATCATGCAGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAAC
AGTAACAACCATCTAATCGAGCCTCAGATCCGCCGGCCTCGTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCC
AAGGACTCACCCGTACGTCGGGCTGTGAAAGACACCCTTTCCAACCCACAGTCCCCACAGCCATCACCTTACAACTCCCCCAAACCACAA
CACAAAGTCACACAGAGCTTCTTGCCACCCGGCTGGGAAATGAGGATAGCGCCAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAG
ACTACAACCTGGGAAGATCCACGTTTGAAATTTCCAGTACATATGCGGTCAAAGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCT
CCTGGCTGGGAAGAAAGAATTCACTTGGATGGCCGAACGTTTTATATTGATCATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTG
CAGAACCCAGCTATTACTGGTCCGGCTGTCCCTTACTCCAGAGAATTTAAGCAGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCT
GCTGATATCCCCAATAGGTTTGAAATGAAACTTCACAGAAATAACATATTTGAAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCA
GATGTCCTAAAAGCTAGACTGTGGATTGAGTTTGAATCAGAGAAAGGTCTTGACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTG
TCCAAAGAGATGTTCAACCCCTACTACGGCCTCTTTGAGTACTCTGCCACGGACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTC
TGTAATGAGGATCATTTGTCCTACTTCACTTTTATTGGAAGAGTTGCTGGTCTGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTC
ATTAGACCATTTTACAAGATGATGTTGGGAAAGCAGATAACCCTGAATGACATGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAA
TGGATCCTGGAGAATGACCCTACTGAGCTGGACCTCATGTTCTGCATAGACGAAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAG
CCCAATGGGTCAGAAATAATGGTCACAAATGAAAACAAAAGGGAATATATCGACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAG
AAGCAGATGAACGCCTTCTTGGAGGGATTCACAGAACTACTTCCTATTGATTTGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTC
ATGTGCGGCCTCGGTGATGTGGATGTGAATGACTGGAGACAGCATTCTATTTACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAG
TGGTTCTGGAAGGCTGTGCTACTCATGGACGCCGAAAAGCGTATCCGGTTACTGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAAT
GGATTTGCCGAACTTTATGGTTCCAATGGTCCTCAGCTGTTTACAATAGAGCAATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACA
TGCTTTAATCGCCTTGACTTACCTCCATATGAAACCTTTGAAGATTTACGAGAGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTT
GAAGGGGTGGATTAAGCACCCTGTGCCTCGGGGGTGGTTGTTCTTCAAGCAAGTTCTGCTTGCACTTTTGCATTTGCCTAACAGACTTTT
GCAGAGGCGATGGCAGAGAGCAGCTGCAGGCATGGTCCCTGGAGCCGAGCCTTCACCACGCACTCGTCCAAGTTCGGATGCGGGAACCTG
GTCCCAGCTTGAGTTCCTGCCTTTCCCACCACAAATTATCAACTGGTTGATGTGTACACTAATTACATTTCAGGAGGACTTAATGCTATT
TATGTTGTGCCTCTGCAGGCAAAGCCCTTAATAAATATTTTACATCCTTTCTAATGACAATGAATGGAATTAATCACTCAACAGGTATAG
TATTACGACTCATGTTTACTTTTTAAAATGATTTAGACCGATTTTCAGATTTTATTTCGTTATGATTAAAGATGTCTCATGTACTTGGAA

>In-frame_ACPP_ENST00000351273_chr3_132056398_+_NEDD4L_ENST00000356462_chr18_55833020_+_3598nt
GAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAACATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCC
TTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGC
ATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAATCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGG
GCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGAAAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATA
TTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTGGCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATC
CTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAAGATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTT
TTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGGCTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAA
AAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGTGATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGA
ATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAACCCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCAT
CTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGAGACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACC
TTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTTCTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGAT
TTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAAGAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGG
AAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCTCCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACA
ATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGGCACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACA
ATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCCCGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGG
AGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAATATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCAC
CGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTAAGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAAC
AGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGCAGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCAC
CGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAACAGTAACAACCATCTAATCGAGCCTCAGATCCGCCGGCCTCGTAGCCTCAGCT
CGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCCAAGGACTCACCCGTACGTCGGGCTGTGAAAGACACCCTTTCCAACCCACAGT
CCCCACAGCCATCACCTTACAACTCCCCCAAACCACAACACAAAGTCACACAGAGCTTCTTGCCACCCGGCTGGGAAATGAGGATAGCGC
CAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAGACTACAACCTGGGAAGATCCACGTTTGAAATTTCCAGTACATATGCGGTCAA
AGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCTCCTGGCTGGGAAGAAAGAATTCACTTGGATGGCCGAACGTTTTATATTGATC
ATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTGCAGAACCCAGCTATTACTGGTCCGGCTGTCCCTTACTCCAGAGAATTTAAGC
AGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCTGCTGATATCCCCAATAGGTTTGAAATGAAACTTCACAGAAATAACATATTTG
AAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCAGATGTCCTAAAAGCTAGACTGTGGATTGAGTTTGAATCAGAGAAAGGTCTTG
ACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATGTTCAACCCCTACTACGGCCTCTTTGAGTACTCTGCCACGG
ACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTCTGTAATGAGGATCATTTGTCCTACTTCACTTTTATTGGAAGAGTTGCTGGTC
TGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTCATTAGACCATTTTACAAGATGATGTTGGGAAAGCAGATAACCCTGAATGACA
TGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAATGGATCCTGGAGAATGACCCTACTGAGCTGGACCTCATGTTCTGCATAGACG
AAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAGCCCAATGGGTCAGAAATAATGGTCACAAATGAAAACAAAAGGGAATATATCG
ACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAGAAGCAGATGAACGCCTTCTTGGAGGGATTCACAGAACTACTTCCTATTGATT
TGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTCATGTGCGGCCTCGGTGATGTGGATGTGAATGACTGGAGACAGCATTCTATTT
ACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAGTGGTTCTGGAAGGCTGTGCTACTCATGGACGCCGAAAAGCGTATCCGGTTAC
TGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAATGGATTTGCCGAACTTTATGGTTCCAATGGTCCTCAGCTGTTTACAATAGAGC
AATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACATGCTTTAATCGCCTTGACTTACCTCCATATGAAACCTTTGAAGATTTACGAG
AGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTTGAAGGGGTGGATTAAGCACCCTGTGCCTCGGGGGTGGTTGTTCTTCAAGCAA
GTTCTGCTTGCACTTTTGCATTTGCCTAACAGACTTTTGCAGAGGCGATGGCAGAGAGCAGCTGCAGGCATGGTCCCTGGAGCCGAGCCT
TCACCACGCACTCGTCCAAGTTCGGATGCGGGAACCTGGTCCCAGCTTGAGTTCCTGCCTTTCCCACCACAAATTATCAACTGGTTGATG

>In-frame_ACPP_ENST00000351273_chr3_132056398_+_NEDD4L_ENST00000400345_chr18_55833020_+_3921nt
GAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAACATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCC
TTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGGAGTTGAAGTTTGTGACTTTGGTGTTTCGGC
ATGGAGACCGAAGTCCCATTGACACCTTTCCCACTGACCCCATAAAGGAATCCTCATGGCCACAAGGATTTGGCCAACTCACCCAGCTGG
GCATGGAGCAGCATTATGAACTTGGAGAGTATATAAGAAAGAGATATAGAAAATTCTTGAATGAGTCCTATAAACATGAACAGGTTTATA
TTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTATGACAAACCTGGCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATC
CTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAAGATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTT
TTCAAGAACTTGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGGCTGCACCCTTATAAGGGAGAGTCCCGTATTCTCAGAGTAA
AAGTTGTTTCTGGAATTGATCTCGCCAAAAAGGACATCTTTGGAGCCAGTGATCCGTATGTGAAACTTTCATTGTACGTAGCGGATGAGA
ATAGAGAACTTGCTTTGGTCCAGACAAAAACAATTAAAAAGACACTGAACCCAAAATGGAATGAAGAATTTTATTTCAGGGTAAACCCAT
CTAATCACAGACTCCTATTTGAAGTATTTGACGAAAATAGACTGACACGAGACGACTTCCTGGGCCAGGTGGACGTGCCCCTTAGTCACC
TTCCGACAGAAGATCCAACCATGGAGCGACCCTATACATTTAAGGACTTTCTCCTCAGACCAAGAAGTCATAAGTCTCGAGTTAAGGGAT
TTTTGCGATTGAAAATGGCCTATATGCCAAAAAATGGAGGTCAAGATGAAGAAAACAGTGACCAGAGGGATGACATGGAGCATGGATGGG
AAGTTGTTGACTCAAATGACTCGGCTTCTCAGCACCAAGAGGAACTTCCTCCTCCTCCTCTGCCTCCCGGGTGGGAAGAAAAAGTGGACA
ATTTAGGCCGAACTTACTATGTCAACCACAACAACCGGACCACTCAGTGGCACAGACCAAGCCTGATGGACGTGTCCTCGGAGTCGGACA
ATAACATCAGACAGATCAACCAGGAGGCAGCACACCGGCGCTTCCGCTCCCGCAGGCACATCAGCGAAGACTTGGAGCCCGAGCCCTCGG
AGGGCGGGGATGTCCCCGAGCCTTGGGAGACCATTTCAGAGGAAGTGAATATCGCTGGAGACTCTCTCGGTCTGGCTCTGCCCCCACCAC
CGGCCTCCCCAGGATCTCGGACCAGCCCTCAGGAGCTGTCAGAGGAACTAAGCAGAAGGCTTCAGATCACTCCAGACTCCAATGGGGAAC
AGTTCAGCTCTTTGATTCAAAGAGAACCCTCCTCAAGGTTGAGGTCATGCAGTGTCACCGACGCAGTTGCAGAACAGGGCCATCTACCAC
CGCCCAGTGCCCCAGCTGGGAGAGCGCGTTCATCAACTGTCACGGGTGGTGAGGAACCAACGCCATCAGTGGCCTATGTACATACCACGC
CGGGTCTGCCTTCAGGCTGGGAAGAAAGAAAAGATGCTAAGGGGCGCACATACTATGTCAATCATAACAATCGAACCACAACTTGGACTC
GACCTATCATGCAGCTTGCAGAAGATGGTGCGTCCGGATCAGCCACAAACAGTAACAACCATCTAATCGAGCCTCAGATCCGCCGGCCTC
GTAGCCTCAGCTCGCCAACAGTAACTTTATCTGCCCCGCTGGAGGGTGCCAAGGACTCACCCGTACGTCGGGCTGTGAAAGACACCCTTT
CCAACCCACAGTCCCCACAGCCATCACCTTACAACTCCCCCAAACCACAACACAAAGTCACACAGAGCTTCTTGCCACCCGGCTGGGAAA
TGAGGATAGCGCCAAACGGCCGGCCCTTCTTCATTGATCATAACACAAAGACTACAACCTGGGAAGATCCACGTTTGAAATTTCCAGTAC
ATATGCGGTCAAAGACATCTTTAAACCCCAATGACCTTGGCCCCCTTCCTCCTGGCTGGGAAGAAAGAATTCACTTGGATGGCCGAACGT
TTTATATTGATCATAATAGCAAAATTACTCAGTGGGAAGACCCAAGACTGCAGAACCCAGCTATTACTGGTCCGGCTGTCCCTTACTCCA
GAGAATTTAAGCAGAAATATGACTACTTCAGGAAGAAATTAAAGAAACCTGCTGATATCCCCAATAGGTTTGAAATGAAACTTCACAGAA
ATAACATATTTGAAGAGTCCTATCGGAGAATTATGTCCGTGAAAAGACCAGATGTCCTAAAAGCTAGACTGTGGATTGAGTTTGAATCAG
AGAAAGGTCTTGACTATGGGGGTGTGGCCAGAGAATGGTTCTTCTTACTGTCCAAAGAGATGTTCAACCCCTACTACGGCCTCTTTGAGT
ACTCTGCCACGGACAACTACACCCTTCAGATCAACCCTAATTCAGGCCTCTGTAATGAGGATCATTTGTCCTACTTCACTTTTATTGGAA
GAGTTGCTGGTCTGGCCGTATTTCATGGGAAGCTCTTAGATGGTTTCTTCATTAGACCATTTTACAAGATGATGTTGGGAAAGCAGATAA
CCCTGAATGACATGGAATCTGTGGATAGTGAATATTACAACTCTTTGAAATGGATCCTGGAGAATGACCCTACTGAGCTGGACCTCATGT
TCTGCATAGACGAAGAAAACTTTGGACAGACATATCAAGTGGATTTGAAGCCCAATGGGTCAGAAATAATGGTCACAAATGAAAACAAAA
GGGAATATATCGACTTAGTCATCCAGTGGAGATTTGTGAACAGGGTCCAGAAGCAGATGAACGCCTTCTTGGAGGGATTCACAGAACTAC
TTCCTATTGATTTGATTAAAATTTTTGATGAAAATGAGCTGGAGTTGCTCATGTGCGGCCTCGGTGATGTGGATGTGAATGACTGGAGAC
AGCATTCTATTTACAAGAACGGCTACTGCCCAAACCACCCCGTCATTCAGTGGTTCTGGAAGGCTGTGCTACTCATGGACGCCGAAAAGC
GTATCCGGTTACTGCAGTTTGTCACAGGGACATCGCGAGTACCTATGAATGGATTTGCCGAACTTTATGGTTCCAATGGTCCTCAGCTGT
TTACAATAGAGCAATGGGGCAGTCCTGAGAAACTGCCCAGAGCTCACACATGCTTTAATCGCCTTGACTTACCTCCATATGAAACCTTTG
AAGATTTACGAGAGAAACTTCTCATGGCCGTGGAAAATGCTCAAGGATTTGAAGGGGTGGATTAAGCACCCTGTGCCTCGGGGGTGGTTG
TTCTTCAAGCAAGTTCTGCTTGCACTTTTGCATTTGCCTAACAGACTTTTGCAGAGGCGATGGCAGAGAGCAGCTGCAGGCATGGTCCCT
GGAGCCGAGCCTTCACCACGCACTCGTCCAAGTTCGGATGCGGGAACCTGGTCCCAGCTTGAGTTCCTGCCTTTCCCACCACAAATTATC
AACTGGTTGATGTGTACACTAATTACATTTCAGGAGGACTTAATGCTATTTATGTTGTGCCTCTGCAGGCAAAGCCCTTAATAAATATTT
TACATCCTTTCTAATGACAATGAATGGAATTAATCACTCAACAGGTATAGTATTACGACTCATGTTTACTTTTTAAAATGATTTAGACCG


Top

FusionGenePPI for ACPP_NEDD4L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACPPACPP, UBC, SHBG, MMRN1, DDX19B, RPS6KB2, TBC1D22B, FTH1, CDK15, CCDC103, CPLX3, FBXL4, AIRE, ZIC1, DUSP21, IL31RA, FCRL5, KIF3A, NPPA, HSF2, FCF1, LACC1, L2HGDHNEDD4LSFN, NR3C1, ARHGDIA, SCNN1A, SCNN1B, SCNN1G, NEDD4L, AMOT, YWHAG, YWHAZ, PSMD4, YWHAB, TNK2, OCLN, APBB1, TOLLIP, NDFIP1, KCNB1, MAPKAPK3, CLIC2, EFEMP2, HGS, NDFIP2, MAP3K3, VDAC2, ZDHHC3, CAMK1D, RANBP10, CDK5, ABL1, MAGEB1, DMTN, AICDA, MARK2, KCNAB1, FKBP3, DAPK3, BRAF, MAP3K5, DDX54, ZAK, KCNAB3, NTRK1, CUEDC1, RPS6KB2, ABL2, CACNB1, YY1, MAP3K2, BBX, PRKX, ACVR1B, ADAP2, BMPR1A, AKT3, MINK1, AURKC, NSRP1, WIBG, SGK2, UBAC1, RPL30, MERTK, SRMS, SERPINF1, DYRK3, IFRD2, SCD, ROBO3, TRIM41, TMA16, TAF1B, SPAG8, STAC, H1F0, PRR16, KIFC3, RASL10B, PRRG1, CDK3, KCNAB2, FGF12, RNF7, APEX2, MRPL19, TGFB1I1, TBC1D7, NHP2, TMEM55A, CYP26B1, DECR2, SENP2, SIVA1, RASL11B, MAP2, STK40, NUDT16L1, C7orf50, TCEAL2, ZC3HAV1L, MOB3A, TARBP2, ZADH2, WBP2, ELAVL1, YWHAH, SGK1, RAF1, TSC22D3, WNK4, WNK1, IKBKB, SMAD7, AMOTL1, UBE2D2, UBC, SMAD2, SMAD3, YWHAQ, NPC2, MT2A, ATP1B1, CYBRD1, SLC7A7, PBX1, ACY3, HAX1, KIF3B, KCNH2, CAV3, UBE2L3, UBE2K, UBE2D1, UBE2E3, UBE2J2, CDC34, ARRDC3, ARRDC4, MED28, FBXL15, LAPTM5, RNF11, KCNQ1, SGK3, UBE2D3, NOTCH1, AATF, GORAB, UBE2N, HCN1, SMAD6, SLC9A3, SNCA, WNK3, PTCH1, DAZAP2, MOV10, CCDC8, FAM189B, PRRG3, TMEM51, TMEM171, SUSD6, FAM189A2, WBP1, ARRDC1, TMEM92, TMEM52B, LDLRAD4, XPO1, LITAF, SLC22A11, SLC22A8, RHOB, CRYAB, GRB10, KCNA3, ULK1, ERBB3, PTK2B, GRIA1, ILDR1, TNFAIP3, TNFRSF19, LPAR1, EDEM3, TRIM25, SCN5A, UBE2E1, UBE2E2, UBE2L6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACPP_NEDD4L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneACPPP15309DB06688Sipuleucel-TProstatic acid phosphatasebiotechapproved|investigational

Top

RelatedDiseases for ACPP_NEDD4L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACPPC3495559Juvenile arthritis1CTD_human
TgeneNEDD4LC0020538Hypertensive disease2CTD_human
TgeneNEDD4LC0008925Cleft Palate1CTD_human
TgeneNEDD4LC0014175Endometriosis1CTD_human
TgeneNEDD4LC0039075Syndactyly1CTD_human
TgeneNEDD4LC1868720Periventricular Nodular Heterotopia1CTD_human;ORPHANET