FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4553

FusionGeneSummary for BTD_BCAS3

check button Fusion gene summary
Fusion gene informationFusion gene name: BTD_BCAS3
Fusion gene ID: 4553
HgeneTgene
Gene symbol

BTD

BCAS3

Gene ID

686

54828

Gene namebiotinidaseBCAS3, microtubule associated cell migration factor
Synonyms-GAOB1|MAAB
Cytomap

3p25.1

17q23.2

Type of geneprotein-codingprotein-coding
Descriptionbiotinidasebiotinasebreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab1
Modification date2018052320180523
UniProtAcc

P43251

Q9H6U6

Ensembl transtripts involved in fusion geneENST00000449107, ENST00000303498, 
ENST00000437172, ENST00000383778, 
ENST00000482824, 
ENST00000589222, 
ENST00000407086, ENST00000390652, 
ENST00000408905, ENST00000588462, 
ENST00000585744, ENST00000588874, 
ENST00000585812, 
Fusion gene scores* DoF score1 X 1 X 1=126 X 15 X 15=5850
# samples 141
** MAII scorelog2(1/1*10)=3.32192809488736log2(41/5850*10)=-3.83474080985268
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BTD [Title/Abstract] AND BCAS3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

TgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

TgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A1L2-01ABTDchr3

15686438

+BCAS3chr17

59445688

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000449107ENST00000589222BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000449107ENST00000407086BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000449107ENST00000390652BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000449107ENST00000408905BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000449107ENST00000588462BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000449107ENST00000585744BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000449107ENST00000588874BTDchr3

15686438

+BCAS3chr17

59445688

+
5CDS-3UTRENST00000449107ENST00000585812BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000303498ENST00000589222BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000303498ENST00000407086BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000303498ENST00000390652BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000303498ENST00000408905BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000303498ENST00000588462BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000303498ENST00000585744BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000303498ENST00000588874BTDchr3

15686438

+BCAS3chr17

59445688

+
5CDS-3UTRENST00000303498ENST00000585812BTDchr3

15686438

+BCAS3chr17

59445688

+
Frame-shitENST00000437172ENST00000589222BTDchr3

15686438

+BCAS3chr17

59445688

+
Frame-shitENST00000437172ENST00000407086BTDchr3

15686438

+BCAS3chr17

59445688

+
Frame-shitENST00000437172ENST00000390652BTDchr3

15686438

+BCAS3chr17

59445688

+
Frame-shitENST00000437172ENST00000408905BTDchr3

15686438

+BCAS3chr17

59445688

+
Frame-shitENST00000437172ENST00000588462BTDchr3

15686438

+BCAS3chr17

59445688

+
Frame-shitENST00000437172ENST00000585744BTDchr3

15686438

+BCAS3chr17

59445688

+
Frame-shitENST00000437172ENST00000588874BTDchr3

15686438

+BCAS3chr17

59445688

+
5CDS-3UTRENST00000437172ENST00000585812BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000383778ENST00000589222BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000383778ENST00000407086BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000383778ENST00000390652BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000383778ENST00000408905BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000383778ENST00000588462BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000383778ENST00000585744BTDchr3

15686438

+BCAS3chr17

59445688

+
In-frameENST00000383778ENST00000588874BTDchr3

15686438

+BCAS3chr17

59445688

+
5CDS-3UTRENST00000383778ENST00000585812BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3CDSENST00000482824ENST00000589222BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3CDSENST00000482824ENST00000407086BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3CDSENST00000482824ENST00000390652BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3CDSENST00000482824ENST00000408905BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3CDSENST00000482824ENST00000588462BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3CDSENST00000482824ENST00000585744BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3CDSENST00000482824ENST00000588874BTDchr3

15686438

+BCAS3chr17

59445688

+
intron-3UTRENST00000482824ENST00000585812BTDchr3

15686438

+BCAS3chr17

59445688

+

Top

FusionProtFeatures for BTD_BCAS3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BTD

P43251

BCAS3

Q9H6U6

Catalytic release of biotin from biocytin, the productof biotin-dependent carboxylases degradation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBTDchr3:15686438chr17:59445688ENST00000303498+1472_351-37544DomainCN hydrolase


Top

FusionGeneSequence for BTD_BCAS3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_698aa
MPEGGGTSRRLLPMQSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQ
NLDITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEP
CHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVY
PTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSH
SKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHT
VHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGR
LTERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLPCTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_683aa
MPEGGGTSRRLLPMQSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQ
NLDITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEP
CHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVY
PTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSH
SKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHT
VHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGR
LTERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLPCTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_683aa
MPEGGGTSRRLLPMQSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQ
NLDITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEP
CHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVY
PTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSH
SKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHT
VHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGR
LTERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLPCTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_705aa
MPEGGGTSRRLLPMQSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQ
NLDITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEP
CHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVY
PTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSH
SKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHT
VHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGR
LTERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLPCTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_705aa
MPEGGGTSRRLLPMQSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQ
NLDITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEP
CHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVY
PTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSH
SKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHT
VHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGR
LTERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLPCTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_683aa
MPEGGGTSRRLLPMQSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQ
NLDITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEP
CHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVY
PTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSH
SKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHT
VHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGR
LTERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLPCTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_683aa
MPEGGGTSRRLLPMQSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQ
NLDITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEP
CHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVY
PTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSH
SKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHT
VHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGR
LTERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLPCTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVG

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_776aa
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNL
DITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT
AWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVH
GTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLT
ERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDIRGTFLFTFIFFKPHLPL
TNLSVCDWSQAKTKINVSLTFTHPQSTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALDVAVK

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_761aa
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNL
DITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT
AWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVH
GTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLT
ERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDIRGTFLFTFIFFKPHLPL
TNLSVCDWSQAKTKINVSLTFTHPQSTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIE

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_761aa
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNL
DITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT
AWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVH
GTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLT
ERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDIRGTFLFTFIFFKPHLPL
TNLSVCDWSQAKTKINVSLTFTHPQSTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIE

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_783aa
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNL
DITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT
AWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVH
GTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLT
ERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDIRGTFLFTFIFFKPHLPL
TNLSVCDWSQAKTKINVSLTFTHPQSTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALDVAVK

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_783aa
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNL
DITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT
AWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVH
GTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLT
ERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDIRGTFLFTFIFFKPHLPL
TNLSVCDWSQAKTKINVSLTFTHPQSTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALDVAVK

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_761aa
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNL
DITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT
AWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVH
GTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLT
ERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDIRGTFLFTFIFFKPHLPL
TNLSVCDWSQAKTKINVSLTFTHPQSTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIE

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_761aa
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNL
DITEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPT
AWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVH
GTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLT
ERD_EKCVVCGADSGHHVDSLALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDIRGTFLFTFIFFKPHLPL
TNLSVCDWSQAKTKINVSLTFTHPQSTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIE

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_714aa
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNLDITEQQVMTAAQKDVQIIVF
PEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAV
AFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVHGTYYIQVCALVRCGGLGFDT
CGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLTERD_EKCVVCGADSGHHVDS
LALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDISTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRE

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_699aa
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNLDITEQQVMTAAQKDVQIIVF
PEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAV
AFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVHGTYYIQVCALVRCGGLGFDT
CGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLTERD_EKCVVCGADSGHHVDS
LALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDISTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRE

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_699aa
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNLDITEQQVMTAAQKDVQIIVF
PEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAV
AFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVHGTYYIQVCALVRCGGLGFDT
CGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLTERD_EKCVVCGADSGHHVDS
LALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDISTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRE

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_721aa
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNLDITEQQVMTAAQKDVQIIVF
PEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAV
AFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVHGTYYIQVCALVRCGGLGFDT
CGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLTERD_EKCVVCGADSGHHVDS
LALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDISTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRE
RLADAMAESPSRDVVGSGTDTALDVAVKTFPPERHVAVKCFELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_721aa
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNLDITEQQVMTAAQKDVQIIVF
PEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAV
AFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVHGTYYIQVCALVRCGGLGFDT
CGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLTERD_EKCVVCGADSGHHVDS
LALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDISTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRE
RLADAMAESPSRDVVGSGTDTALDVAVKTFPPERHVAVKCFELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_699aa
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNLDITEQQVMTAAQKDVQIIVF
PEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAV
AFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVHGTYYIQVCALVRCGGLGFDT
CGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLTERD_EKCVVCGADSGHHVDS
LALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDISTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRE

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_699aa
MSGARSKLALFLCGCYVVALGAHTGEESVADHHEAETTVAAVTEHPSILSLNPLALISRQEALELMNQNLDITEQQVMTAAQKDVQIIVF
PEDGIHGFNFTRTSITPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVF
SNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAV
AFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHC
DEATKWNVNAPPTFHSEMMTDNFTLVPVWGKEGTLHVCSNGLCCTLLYERPTLSKELTALGVFDGLHTVHGTYYIQVCALVRCGGLGFDT
CGQEITEATGIFEFHLWGNFSTSTIFPLFLTSGMTLEVPDQLGWENDHTFLRKSRLSSGLVTAALTGRLTERD_EKCVVCGADSGHHVDS
LALPQATSPGTIFLP_GQEPTSVAPDSTLGTVEKVGEADSLSVFLLNLNHRDISTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_2094nt
ATGCCAGAGGGAGGCGGGACTAGCAGGAGATTGCTGCCTATGCAAAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTT
GCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTAT
GTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAG
AACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTC
AACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGC
TTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCT
TGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGAC
CGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGC
AGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTAC
CCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCA
GCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCC
AAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCAT
AGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTG
AATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGT
TCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACA
GTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCC
ACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTC
CCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGC
TTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGC
CCTGGGACCATCTTTCTGCCTTGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGA
AAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGA

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_2049nt
ATGCCAGAGGGAGGCGGGACTAGCAGGAGATTGCTGCCTATGCAAAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTT
GCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTAT
GTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAG
AACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTC
AACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGC
TTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCT
TGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGAC
CGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGC
AGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTAC
CCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCA
GCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCC
AAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCAT
AGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTG
AATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGT
TCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACA
GTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCC
ACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTC
CCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGC
TTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGC
CCTGGGACCATCTTTCTGCCTTGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_2049nt
ATGCCAGAGGGAGGCGGGACTAGCAGGAGATTGCTGCCTATGCAAAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTT
GCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTAT
GTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAG
AACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTC
AACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGC
TTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCT
TGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGAC
CGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGC
AGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTAC
CCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCA
GCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCC
AAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCAT
AGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTG
AATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGT
TCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACA
GTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCC
ACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTC
CCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGC
TTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGC
CCTGGGACCATCTTTCTGCCTTGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_2115nt
ATGCCAGAGGGAGGCGGGACTAGCAGGAGATTGCTGCCTATGCAAAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTT
GCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTAT
GTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAG
AACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTC
AACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGC
TTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCT
TGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGAC
CGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGC
AGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTAC
CCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCA
GCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCC
AAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCAT
AGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTG
AATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGT
TCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACA
GTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCC
ACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTC
CCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGC
TTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGC
CCTGGGACCATCTTTCTGCCTTGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_2115nt
ATGCCAGAGGGAGGCGGGACTAGCAGGAGATTGCTGCCTATGCAAAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTT
GCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTAT
GTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAG
AACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTC
AACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGC
TTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCT
TGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGAC
CGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGC
AGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTAC
CCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCA
GCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCC
AAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCAT
AGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTG
AATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGT
TCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACA
GTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCC
ACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTC
CCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGC
TTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGC
CCTGGGACCATCTTTCTGCCTTGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_2049nt
ATGCCAGAGGGAGGCGGGACTAGCAGGAGATTGCTGCCTATGCAAAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTT
GCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTAT
GTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAG
AACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTC
AACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGC
TTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCT
TGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGAC
CGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGC
AGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTAC
CCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCA
GCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCC
AAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCAT
AGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTG
AATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGT
TCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACA
GTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCC
ACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTC
CCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGC
TTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGC
CCTGGGACCATCTTTCTGCCTTGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_2049nt
ATGCCAGAGGGAGGCGGGACTAGCAGGAGATTGCTGCCTATGCAAAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTT
GCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTAT
GTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAG
AACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTC
AACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGC
TTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCT
TGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGAC
CGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGC
AGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTAC
CCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCA
GCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCC
AAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCAT
AGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTG
AATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGT
TCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACA
GTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCC
ACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTC
CCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGC
TTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGC
CCTGGGACCATCTTTCTGCCTTGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_2328nt
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTT
TTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTT
GACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAAT
GACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACT
GCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGT
CACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCT
CCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACAT
GGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGAC
CAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGG
ACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCC
CTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTA
ACAAATCTCTCAGTATGCGATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGG
AGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTC
CGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAA
ACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAG

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_2283nt
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTT
TTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTT
GACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAAT
GACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACT
GCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGT
CACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCT
CCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACAT
GGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGAC
CAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGG
ACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCC
CTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTA
ACAAATCTCTCAGTATGCGATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGG
AGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTC
CGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAG
ACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAG

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_2283nt
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTT
TTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTT
GACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAAT
GACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACT
GCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGT
CACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCT
CCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACAT
GGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGAC
CAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGG
ACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCC
CTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTA
ACAAATCTCTCAGTATGCGATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGG
AGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTC
CGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAG
ACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAG

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_2349nt
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTT
TTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTT
GACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAAT
GACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACT
GCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGT
CACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCT
CCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACAT
GGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGAC
CAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGG
ACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCC
CTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTA
ACAAATCTCTCAGTATGCGATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGG
AGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTC
CGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAA
ACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCC
ACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGC

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_2349nt
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTT
TTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTT
GACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAAT
GACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACT
GCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGT
CACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCT
CCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACAT
GGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGAC
CAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGG
ACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCC
CTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTA
ACAAATCTCTCAGTATGCGATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGG
AGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTC
CGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAA
ACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCC
ACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGC

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_2283nt
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTT
TTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTT
GACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAAT
GACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACT
GCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGT
CACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCT
CCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACAT
GGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGAC
CAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGG
ACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCC
CTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTA
ACAAATCTCTCAGTATGCGATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGG
AGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTC
CGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAG
ACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAG

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_2283nt
ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTT
TTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCT
GCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTT
GACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTT
ACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAAT
GACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCAT
AGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTT
GGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACT
GCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAAT
GTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGT
CACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAG
TTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCT
CCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACAT
GGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGG
ATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGAC
CAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTAT
GAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGG
ACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCC
CTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTA
ACAAATCTCTCAGTATGCGATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGG
AGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTC
CGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAG
ACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAG

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_2142nt
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCT
GACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTT
CCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTG
GCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATC
ACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTT
GCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGA
AAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACC
TGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTG
GTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGC
CTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGA
ACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTG
ACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAG
CGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTC
CCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCC

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_2097nt
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCT
GACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTT
CCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTG
GCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATC
ACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTT
GCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGA
AAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACC
TGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTG
GTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGC
CTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGA
ACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTG
ACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAG
CGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTG
AGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTC

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_2097nt
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCT
GACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTT
CCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTG
GCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATC
ACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTT
GCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGA
AAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACC
TGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTG
GTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGC
CTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGA
ACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTG
ACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAG
CGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTG
AGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTC

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_2163nt
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCT
GACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTT
CCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTG
GCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATC
ACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTT
GCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGA
AAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACC
TGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTG
GTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGC
CTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGA
ACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTG
ACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAG
CGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTC
CCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGC
GGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCG

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_2163nt
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCT
GACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTT
CCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTG
GCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATC
ACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTT
GCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGA
AAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACC
TGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTG
GTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGC
CTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGA
ACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTG
ACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAG
CGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTC
CCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGC
GGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCG

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_2097nt
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCT
GACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTT
CCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTG
GCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATC
ACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTT
GCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGA
AAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACC
TGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTG
GTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGC
CTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGA
ACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTG
ACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAG
CGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTG
AGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTC

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_2097nt
ATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCT
GACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAA
GAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTT
CCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTG
GCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTC
AGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATC
ACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGAC
TACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTT
GCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTT
TGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGT
GATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGA
AAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTG
GGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACC
TGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTG
ACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTG
GTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAGTGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGC
CTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAAGGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGA
ACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTAAACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTG
ACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAG
CGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTG
AGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_2978nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGAC
GTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCC
AGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAA
CAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCT
CTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTG
GTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGA
GACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCC
TGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAA
CAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTC
ATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAG
GAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTAC
CCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGTT

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_2821nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC
AATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGG
AGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGC
CCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGG
AGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTG
GGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGA
GTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAAC
GGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCT
TTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTT

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_2828nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC
AATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGG
AGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGC
CCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGG
AGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTG
GGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGA
GTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAAC
GGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCT
TTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTT

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_2887nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGAC
GTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAAC
AGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTC
TTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGG
TCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAG
ACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCT
GTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAAC
AGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCA
TGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGG
AGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACC
CTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGTTG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_2887nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGAC
GTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAAC
AGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTC
TTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGG
TCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAG
ACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCT
GTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAAC
AGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCA
TGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGG
AGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACC
CTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGTTG

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_2115nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC

>In-frame_BTD_ENST00000449107_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_2820nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC
AATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGG
AGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGC
CCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGG
AGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTG
GGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGA
GTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAAC
GGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCT
TTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTT

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_3218nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTAACAAATCTCTCAGTATGC
GATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGA
CACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAA
GCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACC
AAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGC
AACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTC
ATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTG
CCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATT
GGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGG
ACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAG
CTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTC
CTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAAC

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_3061nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTAACAAATCTCTCAGTATGC
GATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCA
GGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCG
ACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTAC
CCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTT
CTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTAT
GTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGAC
CAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTG
GCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAG
GGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTC
CTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGTTGGTGTCC

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_3068nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTAACAAATCTCTCAGTATGC
GATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCA
GGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCG
ACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTAC
CCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTT
CTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTAT
GTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGAC
CAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTG
GCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAG
GGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTC
CTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGTTGGTGTCC

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_3127nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTAACAAATCTCTCAGTATGC
GATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGA
CACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCA
AGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCA
ACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCA
TCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGC
CCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTG
GATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGA
CAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGC
TTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCC
TTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACC

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_3127nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTAACAAATCTCTCAGTATGC
GATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGA
CACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCA
AGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCA
ACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCA
TCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGC
CCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTG
GATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGA
CAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGC
TTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCC
TTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACC

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_2355nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTAACAAATCTCTCAGTATGC
GATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCA
GGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCG

>In-frame_BTD_ENST00000303498_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_3060nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGGGGGTATTTTCTGTTCACATTTATCTTTTTCAAGCCACATCTTCCTCTAACAAATCTCTCAGTATGC
GATTGGTCTCAAGCTAAAACAAAAATAAATGTCAGTTTATATTTTACACATCCACAAAGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCA
GGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCG
ACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTAC
CCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTT
CTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTAT
GTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGAC
CAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTG
GCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAG
GGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTC
CTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGTTGGTGTCC

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000589222_chr17_59445688_+_3092nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGA
AAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGA
GGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCAC
CAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTG
GAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCG
CCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAG
GAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGT
GGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTG
AGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAA
CGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTC
TTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCT

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000407086_chr17_59445688_+_2935nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT
GGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGA
CTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTC
CCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACAC
CTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTG
TATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCG
TCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCA
GCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCA
TCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAG

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000390652_chr17_59445688_+_2942nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT
GGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGA
CTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTC
CCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACAC
CTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTG
TATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCG
TCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCA
GCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCA
TCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAG

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000408905_chr17_59445688_+_3001nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC
AATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGG
AGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGC
CCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGG
AGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTG
GGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGA
GTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAAC
GGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCT
TTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTT

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000588462_chr17_59445688_+_3001nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC
AATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGG
AGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGC
CCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGG
AGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTG
GGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGA
GTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAAC
GGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCT
TTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTT

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000585744_chr17_59445688_+_2229nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT

>In-frame_BTD_ENST00000383778_chr3_15686438_+_BCAS3_ENST00000588874_chr17_59445688_+_2934nt
GGGTGTGTGTGGAGGGGACCCTGTGGTTAGCAGCAGCTATCGCAGCGTCGGATGTTCAGAGCAGCAGAAGCCGGCGTCGTCGGATGTTGT
GTTGCCCGCCACCATGAGCTACACAGATTTGTGGTCTGCATTATGTCTGGAGCCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTAC
GTGGTTGCCCTGGGAGCCCACACCGGGGAGGAGAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCA
TCCATCCTGAGTCTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATGAACAGCAA
GTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGGATTCAACTTTACAAGAACATCCATTTAT
CCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGGAACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAG
CGCCTGAGTTGTATGGCCATCAGGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGC
CCAAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTACCGTAAACACAACCTCTAC
TTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATACCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTT
GATATATTGTTCTTTGACCCTGCCATCAGAGTCCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTC
CCACTCTTGGCAGCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACCCAGTTCTG
GGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAATCCCAAAAGTCACCTTATAATTGCCCAG
GTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCAACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCA
GGCGATCCGTACTGTGAGAAGGATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCT
GAGATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAATGGCCTCTGCTGTTATTTA
CTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTGATGGGCTTCACACAGTACATGGCACTTACTACATCCAA
GTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGGCTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTG
TGGGGCAACTTCAGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCTGGGAGAAT
GACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGGGCGCTTGTATGAGAGGGACTAGGAAAAG
TGTGTGGTCTGTGGGGCGGACTCTGGCCATCATGTTGACAGCCTTGCACTTCCACAGGCTACAAGCCCTGGGACCATCTTTCTGCCTTAA
GGGCAGGAGCCCACTTCTGTGGCACCAGATTCCACCCTGGGAACTGTGGAAAAAGTAGGAGAGGCAGATTCCCTCAGTGTCTTCCTCTTA
AACCTCAATCATCGAGACATTAGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGG
CACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGA
TCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT
GGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGA
CTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTC
CCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACAC
CTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTG
TATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCG
TCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCA
GCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCA
TCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAG


Top

FusionGenePPI for BTD_BCAS3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BTDUBC, SERPINC1, TAZ, FBXO6, TMEM25, PTPRK, GPHA2, CCND1, KIF21B, SIKE1, CDCA5, MYO1D, ERP44BCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BTD_BCAS3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BTD_BCAS3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBTDC0220754Biotinidase Deficiency2CTD_human;ORPHANET;UNIPROT
HgeneBTDC0004352Autistic Disorder1CTD_human
HgeneBTDC4277682Chemical and Drug Induced Liver Injury1CTD_human