FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 455

FusionGeneSummary for ACPP_ARFIP1

check button Fusion gene summary
Fusion gene informationFusion gene name: ACPP_ARFIP1
Fusion gene ID: 455
HgeneTgene
Gene symbol

ACPP

ARFIP1

Gene ID

55

27236

Gene nameacid phosphatase, prostateADP ribosylation factor interacting protein 1
Synonyms5'-NT|ACP-3|ACP3HSU52521
Cytomap

3q22.1

4q31.3

Type of geneprotein-codingprotein-coding
Descriptionprostatic acid phosphataseTMPaseecto-5'-nucleotidaseprostatic acid phosphotasethiamine monophosphatasearfaptin-1
Modification date2018051920180523
UniProtAcc

P15309

P53367

Ensembl transtripts involved in fusion geneENST00000336375, ENST00000475741, 
ENST00000351273, ENST00000489084, 
ENST00000451320, ENST00000429148, 
ENST00000353617, ENST00000405727, 
ENST00000356064, ENST00000511289, 
Fusion gene scores* DoF score13 X 6 X 2=1567 X 6 X 7=294
# samples 1510
** MAII scorelog2(15/156*10)=-0.0565835283663674
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/294*10)=-1.55581615506164
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ACPP [Title/Abstract] AND ARFIP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneACPP

GO:0046085

adenosine metabolic process

18940592

HgeneACPP

GO:0051289

protein homotetramerization

10639192

TgeneARFIP1

GO:0006886

intracellular protein transport

12606037

TgeneARFIP1

GO:0050708

regulation of protein secretion

12606037


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-EJ-A46D-01AACPPchr3

132036420

+ARFIP1chr4

153784758

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336375ENST00000451320ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000336375ENST00000429148ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000336375ENST00000353617ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000336375ENST00000405727ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000336375ENST00000356064ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-3UTRENST00000336375ENST00000511289ACPPchr3

132036420

+ARFIP1chr4

153784758

+
In-frameENST00000475741ENST00000451320ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000475741ENST00000429148ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000475741ENST00000353617ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000475741ENST00000405727ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000475741ENST00000356064ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-3UTRENST00000475741ENST00000511289ACPPchr3

132036420

+ARFIP1chr4

153784758

+
In-frameENST00000351273ENST00000451320ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000351273ENST00000429148ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000351273ENST00000353617ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000351273ENST00000405727ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-intronENST00000351273ENST00000356064ACPPchr3

132036420

+ARFIP1chr4

153784758

+
5CDS-3UTRENST00000351273ENST00000511289ACPPchr3

132036420

+ARFIP1chr4

153784758

+
3UTR-3CDSENST00000489084ENST00000451320ACPPchr3

132036420

+ARFIP1chr4

153784758

+
3UTR-intronENST00000489084ENST00000429148ACPPchr3

132036420

+ARFIP1chr4

153784758

+
3UTR-intronENST00000489084ENST00000353617ACPPchr3

132036420

+ARFIP1chr4

153784758

+
3UTR-intronENST00000489084ENST00000405727ACPPchr3

132036420

+ARFIP1chr4

153784758

+
3UTR-intronENST00000489084ENST00000356064ACPPchr3

132036420

+ARFIP1chr4

153784758

+
3UTR-3UTRENST00000489084ENST00000511289ACPPchr3

132036420

+ARFIP1chr4

153784758

+

Top

FusionProtFeatures for ACPP_ARFIP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACPP

P15309

ARFIP1

P53367

A non-specific tyrosine phosphatase thatdephosphorylates a diverse number of substrates under acidicconditions (pH 4-6) including alkyl, aryl, and acyl orthophosphatemonoesters and phosphorylated proteins. Has lipid phosphataseactivity and inactivates lysophosphatidic acid in seminal plasma. Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons.Generates adenosine from AMP which acts as a pain suppressor. Actsas a tumor suppressor of prostate cancer through dephosphorylationof ERBB2 and deactivation of MAPK-mediated signaling. Putative target protein of ADP-ribosylation factor.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneARFIP1chr3:132036420chr4:153784758ENST00000353617+19153_35331374DomainAH
TgeneARFIP1chr3:132036420chr4:153784758ENST00000356064+18153_35331342DomainAH
TgeneARFIP1chr3:132036420chr4:153784758ENST00000405727+18153_35331342DomainAH
TgeneARFIP1chr3:132036420chr4:153784758ENST00000451320+19153_35331374DomainAH

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ACPP_ARFIP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACPP_ENST00000336375_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_383aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPS
RVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKK
YENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYE
SARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQT

>In-frame_ACPP_ENST00000475741_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_383aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPS
RVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKK
YENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYE
SARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQT

>In-frame_ACPP_ENST00000351273_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_383aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPS
RVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKK
YENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYE
SARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACPP_ENST00000336375_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_1149nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGATTTGAAGCATTCATTACCATCTGGACTTGGTCTCTCAGAAACCCAAATTACATCTCAT
GGCTTTGACAATACCAAAGAGGGTGTTATTGAAGCAGGAGCATTTCAAGGTTCCCCAGCACCGCCACTGCCATCTGTTATGTCTCCTAGC
AGGGTTGCAGCTAGTCGACTGGCTCAGCAAGGAAGTGATTTAATTGTTCCTGCAGGTGGCCAGAGAACACAGACAAAAAGTGGACCAGTT
ATTCTAGCAGATGAAATTAAAAATCCTGCAATGGAAAAGTTAGAACTTGTTAGAAAATGGAGTCTAAACACCTATAAGTGTACTCGACAG
ATTATCTCTGAGAAGCTAGGCCGTGGCTCAAGAACTGTGGACCTTGAACTTGAAGCTCAGATTGATATATTAAGGGATAACAAGAAAAAA
TATGAAAATATTTTAAAACTGGCTCAAACATTGTCGACCCAGCTTTTCCAGATGGTACATACCCAAAGGCAACTTGGAGATGCATTTGCT
GACCTGAGTTTGAAGTCACTAGAACTTCATGAAGAATTTGGCTATAATGCCGATACCCAGAAACTGCTGGCTAAAAATGGAGAGACTCTT
CTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACTTTGGTGAATAAAACCATTGAAGATACATTAATGACTGTGAAACAGTATGAA
AGTGCCAGGATTGAATATGATGCATATCGCACTGATTTGGAAGAACTGAATCTTGGACCACGTGACGCAAACACTCTGCCAAAGATTGAG
CAGTCACAGCATCTCTTCCAAGCACATAAGGAAAAATATGATAAAATGCGCAATGATGTTTCTGTCAAATTGAAATTTCTAGAAGAAAAT
AAGGTTAAAGTATTGCACAATCAGCTGGTCCTTTTCCACAATGCCATTGCCGCTTACTTTGCTGGGAATCAGAAGCAGCTTGAACAGACA

>In-frame_ACPP_ENST00000475741_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_1149nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGATTTGAAGCATTCATTACCATCTGGACTTGGTCTCTCAGAAACCCAAATTACATCTCAT
GGCTTTGACAATACCAAAGAGGGTGTTATTGAAGCAGGAGCATTTCAAGGTTCCCCAGCACCGCCACTGCCATCTGTTATGTCTCCTAGC
AGGGTTGCAGCTAGTCGACTGGCTCAGCAAGGAAGTGATTTAATTGTTCCTGCAGGTGGCCAGAGAACACAGACAAAAAGTGGACCAGTT
ATTCTAGCAGATGAAATTAAAAATCCTGCAATGGAAAAGTTAGAACTTGTTAGAAAATGGAGTCTAAACACCTATAAGTGTACTCGACAG
ATTATCTCTGAGAAGCTAGGCCGTGGCTCAAGAACTGTGGACCTTGAACTTGAAGCTCAGATTGATATATTAAGGGATAACAAGAAAAAA
TATGAAAATATTTTAAAACTGGCTCAAACATTGTCGACCCAGCTTTTCCAGATGGTACATACCCAAAGGCAACTTGGAGATGCATTTGCT
GACCTGAGTTTGAAGTCACTAGAACTTCATGAAGAATTTGGCTATAATGCCGATACCCAGAAACTGCTGGCTAAAAATGGAGAGACTCTT
CTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACTTTGGTGAATAAAACCATTGAAGATACATTAATGACTGTGAAACAGTATGAA
AGTGCCAGGATTGAATATGATGCATATCGCACTGATTTGGAAGAACTGAATCTTGGACCACGTGACGCAAACACTCTGCCAAAGATTGAG
CAGTCACAGCATCTCTTCCAAGCACATAAGGAAAAATATGATAAAATGCGCAATGATGTTTCTGTCAAATTGAAATTTCTAGAAGAAAAT
AAGGTTAAAGTATTGCACAATCAGCTGGTCCTTTTCCACAATGCCATTGCCGCTTACTTTGCTGGGAATCAGAAGCAGCTTGAACAGACA

>In-frame_ACPP_ENST00000351273_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_1149nt
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGATTTGAAGCATTCATTACCATCTGGACTTGGTCTCTCAGAAACCCAAATTACATCTCAT
GGCTTTGACAATACCAAAGAGGGTGTTATTGAAGCAGGAGCATTTCAAGGTTCCCCAGCACCGCCACTGCCATCTGTTATGTCTCCTAGC
AGGGTTGCAGCTAGTCGACTGGCTCAGCAAGGAAGTGATTTAATTGTTCCTGCAGGTGGCCAGAGAACACAGACAAAAAGTGGACCAGTT
ATTCTAGCAGATGAAATTAAAAATCCTGCAATGGAAAAGTTAGAACTTGTTAGAAAATGGAGTCTAAACACCTATAAGTGTACTCGACAG
ATTATCTCTGAGAAGCTAGGCCGTGGCTCAAGAACTGTGGACCTTGAACTTGAAGCTCAGATTGATATATTAAGGGATAACAAGAAAAAA
TATGAAAATATTTTAAAACTGGCTCAAACATTGTCGACCCAGCTTTTCCAGATGGTACATACCCAAAGGCAACTTGGAGATGCATTTGCT
GACCTGAGTTTGAAGTCACTAGAACTTCATGAAGAATTTGGCTATAATGCCGATACCCAGAAACTGCTGGCTAAAAATGGAGAGACTCTT
CTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACTTTGGTGAATAAAACCATTGAAGATACATTAATGACTGTGAAACAGTATGAA
AGTGCCAGGATTGAATATGATGCATATCGCACTGATTTGGAAGAACTGAATCTTGGACCACGTGACGCAAACACTCTGCCAAAGATTGAG
CAGTCACAGCATCTCTTCCAAGCACATAAGGAAAAATATGATAAAATGCGCAATGATGTTTCTGTCAAATTGAAATTTCTAGAAGAAAAT
AAGGTTAAAGTATTGCACAATCAGCTGGTCCTTTTCCACAATGCCATTGCCGCTTACTTTGCTGGGAATCAGAAGCAGCTTGAACAGACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACPP_ENST00000336375_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_3377nt
TCAATCCCTTAATTAAATAGCTTCCCCTCTACAGGCTTTTGAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAAC
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTA
CTAGCCAAGGAGTTGAAGTTTGTGACTTTGGATTTGAAGCATTCATTACCATCTGGACTTGGTCTCTCAGAAACCCAAATTACATCTCAT
GGCTTTGACAATACCAAAGAGGGTGTTATTGAAGCAGGAGCATTTCAAGGTTCCCCAGCACCGCCACTGCCATCTGTTATGTCTCCTAGC
AGGGTTGCAGCTAGTCGACTGGCTCAGCAAGGAAGTGATTTAATTGTTCCTGCAGGTGGCCAGAGAACACAGACAAAAAGTGGACCAGTT
ATTCTAGCAGATGAAATTAAAAATCCTGCAATGGAAAAGTTAGAACTTGTTAGAAAATGGAGTCTAAACACCTATAAGTGTACTCGACAG
ATTATCTCTGAGAAGCTAGGCCGTGGCTCAAGAACTGTGGACCTTGAACTTGAAGCTCAGATTGATATATTAAGGGATAACAAGAAAAAA
TATGAAAATATTTTAAAACTGGCTCAAACATTGTCGACCCAGCTTTTCCAGATGGTACATACCCAAAGGCAACTTGGAGATGCATTTGCT
GACCTGAGTTTGAAGTCACTAGAACTTCATGAAGAATTTGGCTATAATGCCGATACCCAGAAACTGCTGGCTAAAAATGGAGAGACTCTT
CTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACTTTGGTGAATAAAACCATTGAAGATACATTAATGACTGTGAAACAGTATGAA
AGTGCCAGGATTGAATATGATGCATATCGCACTGATTTGGAAGAACTGAATCTTGGACCACGTGACGCAAACACTCTGCCAAAGATTGAG
CAGTCACAGCATCTCTTCCAAGCACATAAGGAAAAATATGATAAAATGCGCAATGATGTTTCTGTCAAATTGAAATTTCTAGAAGAAAAT
AAGGTTAAAGTATTGCACAATCAGCTGGTCCTTTTCCACAATGCCATTGCCGCTTACTTTGCTGGGAATCAGAAGCAGCTTGAACAGACA
CTTAAACAGTTCCATATCAAATTGAAAACCCCTGGAGTGGATGCCCCATCTTGGCTTGAAGAACAGTAAAATCACAGCGGAAAATAAAAA
GAAAGTCGCGTTGTTATATTTCTAAACCAACCTAACAAGAATTAAGCAGAGTTGGGGGAAGTGGGAGGGGTGACAAGCATTATAGTGATT
CTTGCACAAACAGCTTTAATTTTTCCCTTTTTCATACTTTAACAATTGAACTGTTAAGGGTGGTTTTAATGTAAACATAGTTTCTATAAT
CTGAACACAATAATTTTCCTTTTTGAGAAATCCTTTTGTATTGTGAGGGTTGATGGCTATTTCTGTAGTTTGAAAACATCTAATAGAGAT
TTGCACTGACAAGATAAAAATTCAAGGTTTTTGGTCCTGGAAATGAGGGCCGATTGTAACTTTTCCAAAGGGAGGTTTACATGATTTGTA
TCAACATCAGATATTTTATATGTGAATATATTAAACATCTTTAAGAGATTCATTTTCATGTATTAAAGAAAAAAGAAACTATTTTGCAGA
GTAAAGTTATATGGTGTTCCTGCAGCGTCCACACAGAGGCAGCAGCTCTAATGAATGATTAGCTTGTGGAGTTGTGGCAAATACCTTTTT
AAAAATGAATCTGTACCACTGTAATTTTATTTAGACTTTTTTTTAAAGACACAGAAATCACACTGTCATTTCTGTGAGGCTTTTAAGCTT
ATGAATTTGCTTCACCCGAAGTCATTGGACAGTTACATTTGCAATTTCTTTTGGTTCATAACAAAACCTGCTTAAGAGAATTTTTTTTTT
TGACAGGTGGACGTGGGAATGGAAATTCTTAATGGTTTCTGGAGTAGAAATCTGTACTTAGAAAACTAGTTTTTGGGTCAGTTCCATTTT
GATAGAAGTGAATACATAGACAGCTTTTATTGACTTCCATATGTAACAATACCGTTTAAGCCTTAAATCACAGATATGTGCCTTCTCAGA
TACAGTAATTCTTGTTCAACCAATGTACAAAATCCATAAAGAAACCCCTGTTGGATAATGTTTGATGTGTCTATTCCTTCCATGGAATGG
AGCACTATGTATGAATGTTGGGTTTCTTTGTACTTGTTAAGCCACATTTGAGGTTTATGGTAAAAATCATCTTTTGAGTTTGCTCTTTGG
TTTTTCTTCATTCCTTTTGAGGATTGGGAAAACAGAAAGATTCTTTGATTTGGGTAATGAAGAGGTAATTTGGGACAGTGTGGTGGTACC
AGGAAGAAAGAGGATTGGAAAGGCCAGTACTGTTTTAGTTGCTCGGCACTGTTGGTTTTGTTTTAATGTGGTTGCCCTGTCCACTACATG
GTTCTATCAGTAGTGTAATCCATTTTCAATGTAAAGCTCTTTTAGTTTTTGTCATAGACATAAATTAATATTTTGAGAGGCATCCCTCAC
CTGTTCATTTCTTCTGTGTTGAAATGAAGTACTTAAAATTACCGTTATACATGAACTTTGTGGACTGTAAGATTTGTTATATATGTTCAA
ATGCCTTTTAGCTGGCTTTTTAATTAATATGCCTGTTTTGAGTGCTTAATACAATGTAATGTGATTGTAAATCATACCTATTTTAAATCA
TTCCTTCCTGTATATTTGTACTCAGAGAGCCTTATTTTATTCTTCCAGCAGAATTACTACTTGTGATAGTTCATTTACATTCCCCAGAAT
GTGCCTCTAGTGTGAATTTTGTATTCTTATTAAACGTGTTTGCTGCAGTAAATCGTTTCTCTGGACCTTCATAGTTTAAGAAGTAACTAT
TTGGAAATTCTGAAGACACATAATTTGCGTTTTCTGAACCTTAAAAAAAAAGGTACTTCTGTCACTTATAATTGTTTTAGCTCAGTAAGC
TATTTTTTTTCAATGTGAATCTCTTTTGAGAGCTGAACATGTCCATTCTTAACCACATTTCAATAACAGTTACTGTAGCTAAGGAGCTAA
ATAGTTTCATGGATTAATTTTTTTCAGAATAAATTTAAAATATCCATGATTCTGATAGTGGGCACATGACCAAAAGAAAAAAGTAAATCA
ATATATTTAGCCAATGGTACATTTACTTTGTTAGGAATGTAATTTATGTTCATTATAGAAAAGAATTAGAAGAAAATTTCAAGTAATAGA

>In-frame_ACPP_ENST00000475741_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_3338nt
TGAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAACATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGC
CTTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGGAGTTGAAGTTTGTGACTTTGGATTTGAAG
CATTCATTACCATCTGGACTTGGTCTCTCAGAAACCCAAATTACATCTCATGGCTTTGACAATACCAAAGAGGGTGTTATTGAAGCAGGA
GCATTTCAAGGTTCCCCAGCACCGCCACTGCCATCTGTTATGTCTCCTAGCAGGGTTGCAGCTAGTCGACTGGCTCAGCAAGGAAGTGAT
TTAATTGTTCCTGCAGGTGGCCAGAGAACACAGACAAAAAGTGGACCAGTTATTCTAGCAGATGAAATTAAAAATCCTGCAATGGAAAAG
TTAGAACTTGTTAGAAAATGGAGTCTAAACACCTATAAGTGTACTCGACAGATTATCTCTGAGAAGCTAGGCCGTGGCTCAAGAACTGTG
GACCTTGAACTTGAAGCTCAGATTGATATATTAAGGGATAACAAGAAAAAATATGAAAATATTTTAAAACTGGCTCAAACATTGTCGACC
CAGCTTTTCCAGATGGTACATACCCAAAGGCAACTTGGAGATGCATTTGCTGACCTGAGTTTGAAGTCACTAGAACTTCATGAAGAATTT
GGCTATAATGCCGATACCCAGAAACTGCTGGCTAAAAATGGAGAGACTCTTCTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACT
TTGGTGAATAAAACCATTGAAGATACATTAATGACTGTGAAACAGTATGAAAGTGCCAGGATTGAATATGATGCATATCGCACTGATTTG
GAAGAACTGAATCTTGGACCACGTGACGCAAACACTCTGCCAAAGATTGAGCAGTCACAGCATCTCTTCCAAGCACATAAGGAAAAATAT
GATAAAATGCGCAATGATGTTTCTGTCAAATTGAAATTTCTAGAAGAAAATAAGGTTAAAGTATTGCACAATCAGCTGGTCCTTTTCCAC
AATGCCATTGCCGCTTACTTTGCTGGGAATCAGAAGCAGCTTGAACAGACACTTAAACAGTTCCATATCAAATTGAAAACCCCTGGAGTG
GATGCCCCATCTTGGCTTGAAGAACAGTAAAATCACAGCGGAAAATAAAAAGAAAGTCGCGTTGTTATATTTCTAAACCAACCTAACAAG
AATTAAGCAGAGTTGGGGGAAGTGGGAGGGGTGACAAGCATTATAGTGATTCTTGCACAAACAGCTTTAATTTTTCCCTTTTTCATACTT
TAACAATTGAACTGTTAAGGGTGGTTTTAATGTAAACATAGTTTCTATAATCTGAACACAATAATTTTCCTTTTTGAGAAATCCTTTTGT
ATTGTGAGGGTTGATGGCTATTTCTGTAGTTTGAAAACATCTAATAGAGATTTGCACTGACAAGATAAAAATTCAAGGTTTTTGGTCCTG
GAAATGAGGGCCGATTGTAACTTTTCCAAAGGGAGGTTTACATGATTTGTATCAACATCAGATATTTTATATGTGAATATATTAAACATC
TTTAAGAGATTCATTTTCATGTATTAAAGAAAAAAGAAACTATTTTGCAGAGTAAAGTTATATGGTGTTCCTGCAGCGTCCACACAGAGG
CAGCAGCTCTAATGAATGATTAGCTTGTGGAGTTGTGGCAAATACCTTTTTAAAAATGAATCTGTACCACTGTAATTTTATTTAGACTTT
TTTTTAAAGACACAGAAATCACACTGTCATTTCTGTGAGGCTTTTAAGCTTATGAATTTGCTTCACCCGAAGTCATTGGACAGTTACATT
TGCAATTTCTTTTGGTTCATAACAAAACCTGCTTAAGAGAATTTTTTTTTTTGACAGGTGGACGTGGGAATGGAAATTCTTAATGGTTTC
TGGAGTAGAAATCTGTACTTAGAAAACTAGTTTTTGGGTCAGTTCCATTTTGATAGAAGTGAATACATAGACAGCTTTTATTGACTTCCA
TATGTAACAATACCGTTTAAGCCTTAAATCACAGATATGTGCCTTCTCAGATACAGTAATTCTTGTTCAACCAATGTACAAAATCCATAA
AGAAACCCCTGTTGGATAATGTTTGATGTGTCTATTCCTTCCATGGAATGGAGCACTATGTATGAATGTTGGGTTTCTTTGTACTTGTTA
AGCCACATTTGAGGTTTATGGTAAAAATCATCTTTTGAGTTTGCTCTTTGGTTTTTCTTCATTCCTTTTGAGGATTGGGAAAACAGAAAG
ATTCTTTGATTTGGGTAATGAAGAGGTAATTTGGGACAGTGTGGTGGTACCAGGAAGAAAGAGGATTGGAAAGGCCAGTACTGTTTTAGT
TGCTCGGCACTGTTGGTTTTGTTTTAATGTGGTTGCCCTGTCCACTACATGGTTCTATCAGTAGTGTAATCCATTTTCAATGTAAAGCTC
TTTTAGTTTTTGTCATAGACATAAATTAATATTTTGAGAGGCATCCCTCACCTGTTCATTTCTTCTGTGTTGAAATGAAGTACTTAAAAT
TACCGTTATACATGAACTTTGTGGACTGTAAGATTTGTTATATATGTTCAAATGCCTTTTAGCTGGCTTTTTAATTAATATGCCTGTTTT
GAGTGCTTAATACAATGTAATGTGATTGTAAATCATACCTATTTTAAATCATTCCTTCCTGTATATTTGTACTCAGAGAGCCTTATTTTA
TTCTTCCAGCAGAATTACTACTTGTGATAGTTCATTTACATTCCCCAGAATGTGCCTCTAGTGTGAATTTTGTATTCTTATTAAACGTGT
TTGCTGCAGTAAATCGTTTCTCTGGACCTTCATAGTTTAAGAAGTAACTATTTGGAAATTCTGAAGACACATAATTTGCGTTTTCTGAAC
CTTAAAAAAAAAGGTACTTCTGTCACTTATAATTGTTTTAGCTCAGTAAGCTATTTTTTTTCAATGTGAATCTCTTTTGAGAGCTGAACA
TGTCCATTCTTAACCACATTTCAATAACAGTTACTGTAGCTAAGGAGCTAAATAGTTTCATGGATTAATTTTTTTCAGAATAAATTTAAA
ATATCCATGATTCTGATAGTGGGCACATGACCAAAAGAAAAAAGTAAATCAATATATTTAGCCAATGGTACATTTACTTTGTTAGGAATG
TAATTTATGTTCATTATAGAAAAGAATTAGAAGAAAATTTCAAGTAATAGAAGATAAGTACCTTCCCAAGTGAATAAATACTGCATGGAA

>In-frame_ACPP_ENST00000351273_chr3_132036420_+_ARFIP1_ENST00000451320_chr4_153784758_+_3337nt
GAAGTGGTAGCAGTTCCTCCTAACTCCTGCCAGAAACAGCTCTCCTCAACATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCC
TTAGCCTTGGCTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGGAGTTGAAGTTTGTGACTTTGGATTTGAAGC
ATTCATTACCATCTGGACTTGGTCTCTCAGAAACCCAAATTACATCTCATGGCTTTGACAATACCAAAGAGGGTGTTATTGAAGCAGGAG
CATTTCAAGGTTCCCCAGCACCGCCACTGCCATCTGTTATGTCTCCTAGCAGGGTTGCAGCTAGTCGACTGGCTCAGCAAGGAAGTGATT
TAATTGTTCCTGCAGGTGGCCAGAGAACACAGACAAAAAGTGGACCAGTTATTCTAGCAGATGAAATTAAAAATCCTGCAATGGAAAAGT
TAGAACTTGTTAGAAAATGGAGTCTAAACACCTATAAGTGTACTCGACAGATTATCTCTGAGAAGCTAGGCCGTGGCTCAAGAACTGTGG
ACCTTGAACTTGAAGCTCAGATTGATATATTAAGGGATAACAAGAAAAAATATGAAAATATTTTAAAACTGGCTCAAACATTGTCGACCC
AGCTTTTCCAGATGGTACATACCCAAAGGCAACTTGGAGATGCATTTGCTGACCTGAGTTTGAAGTCACTAGAACTTCATGAAGAATTTG
GCTATAATGCCGATACCCAGAAACTGCTGGCTAAAAATGGAGAGACTCTTCTTGGGGCCATTAATTTTTTCATTGCTAGTGTGAACACTT
TGGTGAATAAAACCATTGAAGATACATTAATGACTGTGAAACAGTATGAAAGTGCCAGGATTGAATATGATGCATATCGCACTGATTTGG
AAGAACTGAATCTTGGACCACGTGACGCAAACACTCTGCCAAAGATTGAGCAGTCACAGCATCTCTTCCAAGCACATAAGGAAAAATATG
ATAAAATGCGCAATGATGTTTCTGTCAAATTGAAATTTCTAGAAGAAAATAAGGTTAAAGTATTGCACAATCAGCTGGTCCTTTTCCACA
ATGCCATTGCCGCTTACTTTGCTGGGAATCAGAAGCAGCTTGAACAGACACTTAAACAGTTCCATATCAAATTGAAAACCCCTGGAGTGG
ATGCCCCATCTTGGCTTGAAGAACAGTAAAATCACAGCGGAAAATAAAAAGAAAGTCGCGTTGTTATATTTCTAAACCAACCTAACAAGA
ATTAAGCAGAGTTGGGGGAAGTGGGAGGGGTGACAAGCATTATAGTGATTCTTGCACAAACAGCTTTAATTTTTCCCTTTTTCATACTTT
AACAATTGAACTGTTAAGGGTGGTTTTAATGTAAACATAGTTTCTATAATCTGAACACAATAATTTTCCTTTTTGAGAAATCCTTTTGTA
TTGTGAGGGTTGATGGCTATTTCTGTAGTTTGAAAACATCTAATAGAGATTTGCACTGACAAGATAAAAATTCAAGGTTTTTGGTCCTGG
AAATGAGGGCCGATTGTAACTTTTCCAAAGGGAGGTTTACATGATTTGTATCAACATCAGATATTTTATATGTGAATATATTAAACATCT
TTAAGAGATTCATTTTCATGTATTAAAGAAAAAAGAAACTATTTTGCAGAGTAAAGTTATATGGTGTTCCTGCAGCGTCCACACAGAGGC
AGCAGCTCTAATGAATGATTAGCTTGTGGAGTTGTGGCAAATACCTTTTTAAAAATGAATCTGTACCACTGTAATTTTATTTAGACTTTT
TTTTAAAGACACAGAAATCACACTGTCATTTCTGTGAGGCTTTTAAGCTTATGAATTTGCTTCACCCGAAGTCATTGGACAGTTACATTT
GCAATTTCTTTTGGTTCATAACAAAACCTGCTTAAGAGAATTTTTTTTTTTGACAGGTGGACGTGGGAATGGAAATTCTTAATGGTTTCT
GGAGTAGAAATCTGTACTTAGAAAACTAGTTTTTGGGTCAGTTCCATTTTGATAGAAGTGAATACATAGACAGCTTTTATTGACTTCCAT
ATGTAACAATACCGTTTAAGCCTTAAATCACAGATATGTGCCTTCTCAGATACAGTAATTCTTGTTCAACCAATGTACAAAATCCATAAA
GAAACCCCTGTTGGATAATGTTTGATGTGTCTATTCCTTCCATGGAATGGAGCACTATGTATGAATGTTGGGTTTCTTTGTACTTGTTAA
GCCACATTTGAGGTTTATGGTAAAAATCATCTTTTGAGTTTGCTCTTTGGTTTTTCTTCATTCCTTTTGAGGATTGGGAAAACAGAAAGA
TTCTTTGATTTGGGTAATGAAGAGGTAATTTGGGACAGTGTGGTGGTACCAGGAAGAAAGAGGATTGGAAAGGCCAGTACTGTTTTAGTT
GCTCGGCACTGTTGGTTTTGTTTTAATGTGGTTGCCCTGTCCACTACATGGTTCTATCAGTAGTGTAATCCATTTTCAATGTAAAGCTCT
TTTAGTTTTTGTCATAGACATAAATTAATATTTTGAGAGGCATCCCTCACCTGTTCATTTCTTCTGTGTTGAAATGAAGTACTTAAAATT
ACCGTTATACATGAACTTTGTGGACTGTAAGATTTGTTATATATGTTCAAATGCCTTTTAGCTGGCTTTTTAATTAATATGCCTGTTTTG
AGTGCTTAATACAATGTAATGTGATTGTAAATCATACCTATTTTAAATCATTCCTTCCTGTATATTTGTACTCAGAGAGCCTTATTTTAT
TCTTCCAGCAGAATTACTACTTGTGATAGTTCATTTACATTCCCCAGAATGTGCCTCTAGTGTGAATTTTGTATTCTTATTAAACGTGTT
TGCTGCAGTAAATCGTTTCTCTGGACCTTCATAGTTTAAGAAGTAACTATTTGGAAATTCTGAAGACACATAATTTGCGTTTTCTGAACC
TTAAAAAAAAAGGTACTTCTGTCACTTATAATTGTTTTAGCTCAGTAAGCTATTTTTTTTCAATGTGAATCTCTTTTGAGAGCTGAACAT
GTCCATTCTTAACCACATTTCAATAACAGTTACTGTAGCTAAGGAGCTAAATAGTTTCATGGATTAATTTTTTTCAGAATAAATTTAAAA
TATCCATGATTCTGATAGTGGGCACATGACCAAAAGAAAAAAGTAAATCAATATATTTAGCCAATGGTACATTTACTTTGTTAGGAATGT
AATTTATGTTCATTATAGAAAAGAATTAGAAGAAAATTTCAAGTAATAGAAGATAAGTACCTTCCCAAGTGAATAAATACTGCATGGAAC


Top

FusionGenePPI for ACPP_ARFIP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACPPACPP, UBC, SHBG, MMRN1, DDX19B, RPS6KB2, TBC1D22B, FTH1, CDK15, CCDC103, CPLX3, FBXL4, AIRE, ZIC1, DUSP21, IL31RA, FCRL5, KIF3A, NPPA, HSF2, FCF1, LACC1, L2HGDHARFIP1ARF3, ARF1, ARF5, SLC2A4, ATP6V1C1, TBC1D15, TSNAX, YAP1, DNM1L, HIST1H4A, IDE, LUC7L2, PRMT3, PSMG3, SEC24A, SHMT2, STAT3, ARFIP2, PICK1, AACS, AKR1A1, ADSS, DPYSL2, G6PD, GART, HSD17B8, MVB12A, PFKM, PFKP, PPP3CA, PROSC, SARS, SEC24D, SHMT1, TSTA3, TXNDC9, USP14, ATOX1, ECH1, FLNB, LYPLA1, PAFAH1B2, PDCD6, PGM2L1, QDPR, STIP1, TBCA, DYNLT1, TMEM17, TMEM216, CDC5L, CDH1, CLPB, HSPA8, HSPBP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACPP_ARFIP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneACPPP15309DB06688Sipuleucel-TProstatic acid phosphatasebiotechapproved|investigational

Top

RelatedDiseases for ACPP_ARFIP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACPPC3495559Juvenile arthritis1CTD_human