FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4477

FusionGeneSummary for BRWD3_FAM155A

check button Fusion gene summary
Fusion gene informationFusion gene name: BRWD3_FAM155A
Fusion gene ID: 4477
HgeneTgene
Gene symbol

BRWD3

FAM155A

Gene ID

254065

728215

Gene namebromodomain and WD repeat domain containing 3family with sequence similarity 155 member A
SynonymsBRODL|MRX93-
Cytomap

Xq21.1

13q33.3

Type of geneprotein-codingprotein-coding
Descriptionbromodomain and WD repeat-containing protein 3bromo domain-containing protein disrupted in leukemianovel WD repeat domain proteintransmembrane protein FAM155A
Modification date2018052320180523
UniProtAcc

Q6RI45

B1AL88

Ensembl transtripts involved in fusion geneENST00000373275, ENST00000473691, 
ENST00000375915, 
Fusion gene scores* DoF score3 X 2 X 3=184 X 2 X 4=32
# samples 34
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: BRWD3 [Title/Abstract] AND FAM155A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-QK-A8ZB-01ABRWD3chrX

80047353

-FAM155Achr13

107823134

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373275ENST00000375915BRWD3chrX

80047353

-FAM155Achr13

107823134

-
intron-3CDSENST00000473691ENST00000375915BRWD3chrX

80047353

-FAM155Achr13

107823134

-

Top

FusionProtFeatures for BRWD3_FAM155A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BRWD3

Q6RI45

FAM155A

B1AL88


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFAM155AchrX:80047353chr13:107823134ENST00000375915-13417_437362459TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-6411659_17191431803Compositional biasNote=Gly-rich
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-6411158_12281431803DomainBromo 1
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-6411317_14121431803DomainBromo 2
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641170_2091431803RepeatNote=WD 1
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641213_2511431803RepeatNote=WD 2
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641255_2971431803RepeatNote=WD 3
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641307_3471431803RepeatNote=WD 4
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641353_3931431803RepeatNote=WD 5
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641400_4521431803RepeatNote=WD 6
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641456_4951431803RepeatNote=WD 7
HgeneBRWD3chrX:80047353chr13:107823134ENST00000373275-641502_5421431803RepeatNote=WD 8
TgeneFAM155AchrX:80047353chr13:107823134ENST00000375915-13136_145362459Compositional biasNote=Poly-Gly
TgeneFAM155AchrX:80047353chr13:107823134ENST00000375915-1373_95362459Compositional biasNote=Poly-Gln
TgeneFAM155AchrX:80047353chr13:107823134ENST00000375915-1340_60362459TransmembraneHelical


Top

FusionGeneSequence for BRWD3_FAM155A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BRWD3_ENST00000373275_chrX_80047353_-_FAM155A_ENST00000375915_chr13_107823134_-_240aa
MAAAPTQIEAELTYLIARFLQSGPCNKSAQVLVQELEEHQLIPRRLDWEGKEHRRSFEDLVAANAHIPPDYLLKICERIGPLLDKEIPQS
VPGVQTLLGVGRQSLLRDAKDCKSTLWNGSAFAALHRGRPPELPVNTVKPPNVGLTETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BRWD3_ENST00000373275_chrX_80047353_-_FAM155A_ENST00000375915_chr13_107823134_-_720nt
ATGGCGGCAGCACCTACCCAGATCGAAGCCGAGCTGTATTACCTGATCGCTAGGTTCTTGCAGTCTGGACCCTGCAACAAATCCGCTCAG
GTGCTAGTGCAGGAGCTCGAGGAGCATCAGCTGATTCCGCGCCGCTTAGATTGGGAGGGGAAAGAGCACCGAAGAAGCTTCGAGGATCTG
GTGGCAGCAAATGCACACATTCCTCCAGACTACCTCCTTAAAATTTGTGAGAGAATTGGTCCTTTACTAGATAAAGAGATCCCTCAGAGT
GTTCCTGGGGTACAGACATTATTAGGTGTTGGTCGGCAGTCTCTGCTACGGGATGCCAAAGACTGTAAGAGTACACTATGGAATGGGTCT
GCTTTTGCGGCTCTGCATAGAGGCAGACCTCCAGAACTACCTGTAAATTATGTGAAACCTCCAAATGTGGGGCTTTATGAAACCTTTCTA
ACCAATGATGAACCAGAATGCTGTGACGTCAGGAGAGAAGAAAAATCAAATAACCCATCCAAAGGGACCGTAGAGAAAAGTGGCTCCTGT
CACAGGACATCGCTCACAGTGTCATCAGCAACAAGACTGTGCAACAGCAGACTCAAGCTGTGTGTTCTTGTACTGATTCTCTTACACACA
GTGCTCACAGCCTCGGCAGCACAGAACACAGCCGGACTGAGCTTTGGAGGCATCAACACGCTGGAAGAAAACTCAACCAATGAGGAGTAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BRWD3_ENST00000373275_chrX_80047353_-_FAM155A_ENST00000375915_chr13_107823134_-_2899nt
CTCTCCTTCCTCCTCCGCCTCCTCAGCTCTTGGGCTAGAATATCTATGGGTCGAAACGTGATGCGATGAATTCGAGAGAGAGCGAAACTA
GGACGAGGAGTGCGGCGGAAGCGGCGGGACTCCCGGGCATGGGGGCTTCACCACAATAGAGGCAGCGCCCCCACCCGCCCCCGCCAGCCC
CTCCGGAGCGAAGCCCCCAAACCCCCTCGGGAAAAGGATGGCGGCAGCACCTACCCAGATCGAAGCCGAGCTGTATTACCTGATCGCTAG
GTTCTTGCAGTCTGGACCCTGCAACAAATCCGCTCAGGTGCTAGTGCAGGAGCTCGAGGAGCATCAGCTGATTCCGCGCCGCTTAGATTG
GGAGGGGAAAGAGCACCGAAGAAGCTTCGAGGATCTGGTGGCAGCAAATGCACACATTCCTCCAGACTACCTCCTTAAAATTTGTGAGAG
AATTGGTCCTTTACTAGATAAAGAGATCCCTCAGAGTGTTCCTGGGGTACAGACATTATTAGGTGTTGGTCGGCAGTCTCTGCTACGGGA
TGCCAAAGACTGTAAGAGTACACTATGGAATGGGTCTGCTTTTGCGGCTCTGCATAGAGGCAGACCTCCAGAACTACCTGTAAATTATGT
GAAACCTCCAAATGTGGGGCTTTATGAAACCTTTCTAACCAATGATGAACCAGAATGCTGTGACGTCAGGAGAGAAGAAAAATCAAATAA
CCCATCCAAAGGGACCGTAGAGAAAAGTGGCTCCTGTCACAGGACATCGCTCACAGTGTCATCAGCAACAAGACTGTGCAACAGCAGACT
CAAGCTGTGTGTTCTTGTACTGATTCTCTTACACACAGTGCTCACAGCCTCGGCAGCACAGAACACAGCCGGACTGAGCTTTGGAGGCAT
CAACACGCTGGAAGAAAACTCAACCAATGAGGAGTAACGGAAGGACGAGTGTCACCACAGCAGCAGCTGGCCCGCCGTGAAAAATGGCAA
CTGCTGTCTCATGTAACAGAAACTGGGTGCTTTTACCCTCGAATTACTTATTGCAAGGCCTTTAGGGTAAAATTTAAACAGATGGGCCTG
AATCCAAACAAGGACACAACCACAGCTTTTTATTGACTAAAAGGCTGGAAAGTGACTTTAAATTTCTCACACCATTTTATACACTGTGTT
TTAATGTTTGGAGGTTTTATTTGCTTTCGTTTTGGTTTGGGTTTATTTGTTTGTTTATTTTTTGCACTTGTTAATACAGGATTTATTTTG
GGGGATGGTTTCTCAGAGGTAAACTAAGTCTTTTCACTGTCTCTATCTCTCTATATATTTCTAGTCATTGTGTGTGTTCATCAGATAGTT
CTGTCTTTATGTCCTGTCAGCTTCTATTAGAGGAATGATTGCTATGACCTCATGGTATAGCAAAAAACAACAACAAAAAAAGAATAAAAA
ATAAAAAAGACAAAAAAAAGAAAACAACAAAAAAATAAAAATAAAAAAAATCCCTAAGTCTCCCTTCTACCCACAGAACCAACAACACCC
TTCCCGGCCTTTCCTTTCCCTCGCCCTCTTCTCGTCCCCTAAGCAAACAACATCCGCTTGCTTCTGTCTGTGTAACCACAGTGAATGGGT
GTGCACGCTTGGTGGGCCTCTGAGCCCCTGTTGCACAAACCAGAAACAGAGCGGAGCCAAGGGGGCCTGACAAGAGTTCCTTTTTAGCTG
AACAAACAAGTGCTCTCCATAATAGGTGGAATCAGACAGTTAACACATTTTTATGTTGAAAACAAAATAAAAGGAAAAAATTAAAAAAAA
CTATCATGAACTGTATTGCTCCAGTTCCCATCCCCAAGTGGCCCAGCCCTTTCTTGCTGGTCCAGTTGGACAGGAGCAGCTATCTAGAAT
CAGGATGCGGGGAGTGAGGAAGTTTTTCTTTTGACAATGAAGGTGGGCTTTCATTGTGATTTTTGTTCTGTTGCAGTAATATAGGAGCAC
ATTTTGGCCATTGTAATTACAGGGAACAAACAAAGGGATTGCGGACACATATCTGGACTTCTTTTCCTCCCTTATTGTTGTGGAAGAGAC
ACTAGAAATGCTCAAACACCTGCAATATACAGAATATACACAATTTTATTCCAGTATTTCCCTAACATATGGTTTAAAATTATTCCAGGT
ATACAGTGTATGCAATTCTGCATTATCACAGAGGAACAACTTCTTTTTTAAAAAATAAATAGGTCAGCCATTTTTATTAACGTGCAAAAA
CTTTATCACTCTAACATGCTCTAGGTAGTTGAGGAAAAGAGGTCTGATCACTGTTTGTATTTTATTTTCTTTGTGGGAACATTTCACCTG
CTGAGTGTACATGAATTTGCTTTCTATAAAAGGCTTTTATGAGTTTACAGTAGAATCAGTGGAAGGAAGAGTTAATAAGGGCTGTTTTTA
AAAAAACAAACAAACAAACAAAACAAATAATTAAAAAAAAAATTTTACATTCCTTCCTATTCTCTAACTACACTTGGGAAGTGCACTTCA
GATAAGTTTGCAGTGTGACTGAGAGATGAAGGAAATCCATAGAAAAGGTCCTCTTAGTGAACAAAATTTAGTTATTAACTTTATAGCTAT
GAAATTTCCCCGGGCATTTGTTTTTGTTCAAACAGACTTTAACCTCTGCATCATACTTAACCCTGCGACATGCGTACAGTATGCATATTT
TGTTTTGAAAAAAAATGTTTCGTTCCAGTCTGTTAAGAATATTCAAAAATAATAAAGGTATTGCTTAATAAAATTGCTAGAATTGTTTAG
CAGTACATGCACAATATTTTACTAGATTCTTTGTTTTAATAGTGTTTTGTTGAGACTGAAAATCTTAAAATGGTCTGCGCAAATACAAAA


Top

FusionGenePPI for BRWD3_FAM155A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BRWD3UBXN7, CSNK2A1, TERF1, CUL4B, LLGL2FAM155A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BRWD3_FAM155A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BRWD3_FAM155A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBRWD3C1970841MENTAL RETARDATION, X-LINKED 93 (disorder)1CTD_human;UNIPROT