FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43818

FusionGeneSummary for ZNRF3_EWSR1

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNRF3_EWSR1
Fusion gene ID: 43818
HgeneTgene
Gene symbol

ZNRF3

EWSR1

Gene ID

84133

2130

Gene namezinc and ring finger 3EWS RNA binding protein 1
SynonymsBK747E2.3|RNF203EWS|EWS-FLI1|bK984G1.4
Cytomap

22q12.1

22q12.2

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase ZNRF3CTA-292E10.6RING finger protein 203RING-type E3 ubiquitin transferase ZNRF3novel C3HC4 type Zinc finger (ring finger)zinc/RING finger protein 3RNA-binding protein EWSEWS RNA-binding protein variant 6Ewing sarcoma breakpoint region 1Ewings sarcoma EWS-Fli1 (type 1) oncogene
Modification date2018052320180527
UniProtAcc

Q9ULT6

Q01844

Ensembl transtripts involved in fusion geneENST00000544604, ENST00000332811, 
ENST00000402174, ENST00000406323, 
ENST00000332050, ENST00000397938, 
ENST00000406548, ENST00000331029, 
ENST00000414183, ENST00000333395, 
ENST00000332035, 
Fusion gene scores* DoF score14 X 4 X 12=6728 X 20 X 7=1120
# samples 1721
** MAII scorelog2(17/672*10)=-1.98292648664106
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(21/1120*10)=-2.41503749927884
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZNRF3 [Title/Abstract] AND EWSR1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZNRF3

GO:0016567

protein ubiquitination

22575959


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-55-7576-01AZNRF3chr22

29280054

+EWSR1chr22

29692229

+
TCGALDLUSCTCGA-63-A5MW-01AZNRF3chr22

29280054

+EWSR1chr22

29674019

+
TCGALDOVTCGA-13-0900-01BZNRF3chr22

29383189

+EWSR1chr22

29669730

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000544604ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
In-frameENST00000544604ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
In-frameENST00000544604ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
In-frameENST00000544604ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
In-frameENST00000544604ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5CDS-intronENST00000544604ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5CDS-intronENST00000544604ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5UTR-3CDSENST00000332811ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5UTR-3CDSENST00000332811ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5UTR-3CDSENST00000332811ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5UTR-3CDSENST00000332811ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5UTR-3CDSENST00000332811ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5UTR-intronENST00000332811ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
5UTR-intronENST00000332811ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000402174ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000402174ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000402174ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000402174ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000402174ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-intronENST00000402174ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-intronENST00000402174ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000406323ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000406323ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000406323ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000406323ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-3CDSENST00000406323ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-intronENST00000406323ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
intron-intronENST00000406323ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29692229

+
Frame-shitENST00000544604ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
Frame-shitENST00000544604ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
Frame-shitENST00000544604ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
Frame-shitENST00000544604ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
Frame-shitENST00000544604ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
Frame-shitENST00000544604ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
Frame-shitENST00000544604ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
5UTR-3CDSENST00000332811ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
5UTR-3CDSENST00000332811ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
5UTR-3CDSENST00000332811ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
5UTR-3CDSENST00000332811ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
5UTR-3CDSENST00000332811ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
5UTR-3CDSENST00000332811ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
5UTR-3CDSENST00000332811ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000402174ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000402174ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000402174ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000402174ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000402174ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000402174ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000402174ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000406323ENST00000332050ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000406323ENST00000397938ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000406323ENST00000406548ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000406323ENST00000331029ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000406323ENST00000414183ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000406323ENST00000333395ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
intron-3CDSENST00000406323ENST00000332035ZNRF3chr22

29280054

+EWSR1chr22

29674019

+
In-frameENST00000544604ENST00000332050ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000544604ENST00000397938ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000544604ENST00000406548ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000544604ENST00000331029ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000544604ENST00000414183ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000544604ENST00000333395ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000544604ENST00000332035ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000332811ENST00000332050ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000332811ENST00000397938ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000332811ENST00000406548ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000332811ENST00000331029ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000332811ENST00000414183ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000332811ENST00000333395ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000332811ENST00000332035ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000402174ENST00000332050ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000402174ENST00000397938ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000402174ENST00000406548ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000402174ENST00000331029ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000402174ENST00000414183ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000402174ENST00000333395ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000402174ENST00000332035ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000406323ENST00000332050ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000406323ENST00000397938ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000406323ENST00000406548ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000406323ENST00000331029ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000406323ENST00000414183ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000406323ENST00000333395ZNRF3chr22

29383189

+EWSR1chr22

29669730

+
In-frameENST00000406323ENST00000332035ZNRF3chr22

29383189

+EWSR1chr22

29669730

+

Top

FusionProtFeatures for ZNRF3_EWSR1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNRF3

Q9ULT6

EWSR1

Q01844

E3 ubiquitin-protein ligase that acts as a negativeregulator of the Wnt signaling pathway by mediating theubiquitination and subsequent degradation of Wnt receptor complexcomponents Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in theintestinal stem cell zone by inhibiting the Wnt signaling pathway,thereby resticting the size of the intestinal stem cell zone.{ECO:0000269|PubMed:22575959}. Might normally function as a transcriptional repressor.EWS-fusion-proteins (EFPS) may play a role in the tumorigenicprocess. They may disturb gene expression by mimicking, orinterfering with the normal function of CTD-POLII within thetranscription initiation complex. They may also contribute to anaberrant activation of the fusion protein target genes.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916454_513332601Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916559_640332601Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09300_340-7355Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09454_513-7355Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09559_640-7355Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017454_513388657Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017559_640388657Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017454_513387656Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017559_640387656Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118454_513393662Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118559_640393662Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216300_34034601Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216454_51334601Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216559_64034601Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29300_34034355Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29454_51334355Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29559_64034355Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217300_34034657Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217454_51334657Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217559_64034657Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217300_34034656Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217454_51334656Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217559_64034656Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218300_34034662Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218454_51334662Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218559_64034662Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916361_447332601DomainRRM
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09256_285-7355DomainNote=IQ
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09361_447-7355DomainRRM
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216256_28534601DomainNote=IQ
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216361_44734601DomainRRM
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29256_28534355DomainNote=IQ
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29361_44734355DomainRRM
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217256_28534657DomainNote=IQ
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217361_44734657DomainRRM
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217256_28534656DomainNote=IQ
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217361_44734656DomainRRM
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218256_28534662DomainNote=IQ
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218361_44734662DomainRRM
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916639_656332601MotifNuclear localization signal
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09639_656-7355MotifNuclear localization signal
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017639_656388657MotifNuclear localization signal
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017639_656387656MotifNuclear localization signal
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118639_656393662MotifNuclear localization signal
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216639_65634601MotifNuclear localization signal
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29639_65634355MotifNuclear localization signal
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217639_65634657MotifNuclear localization signal
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217639_65634656MotifNuclear localization signal
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218639_65634662MotifNuclear localization signal
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+091_285-7355RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+098_285-7355RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09111_116-7355RepeatNote=12
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09117_125-7355RepeatNote=13
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09126_156-7355RepeatNote=14
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09157_163-7355RepeatNote=15
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09164_170-7355RepeatNote=16
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09171_177-7355RepeatNote=17
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09178_188-7355RepeatNote=18
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0917_27-7355RepeatNote=2
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09189_193-7355RepeatNote=19
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09194_201-7355RepeatNote=20
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09202_206-7355RepeatNote=21
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09207_212-7355RepeatNote=22
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09213_218-7355RepeatNote=23
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09219_224-7355RepeatNote=24
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09225_230-7355RepeatNote=25
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09231_238-7355RepeatNote=26
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09239_245-7355RepeatNote=27
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09246_252-7355RepeatNote=28
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09253_259-7355RepeatNote=29
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09260_276-7355RepeatNote=30
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09277_285-7355RepeatNote=31
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0928_34-7355RepeatNote=3
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0935_42-7355RepeatNote=4
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0943_50-7355RepeatNote=5
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0951_59-7355RepeatNote=6
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0960_68-7355RepeatNote=7
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0969_75-7355RepeatNote=8
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0976_84-7355RepeatNote=9
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0985_91-7355RepeatNote=10
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+098_16-7355RepeatNote=1
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+0992_110-7355RepeatNote=11
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216111_11634601RepeatNote=12
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216117_12534601RepeatNote=13
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216126_15634601RepeatNote=14
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216157_16334601RepeatNote=15
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216164_17034601RepeatNote=16
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216171_17734601RepeatNote=17
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216178_18834601RepeatNote=18
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216189_19334601RepeatNote=19
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216194_20134601RepeatNote=20
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216202_20634601RepeatNote=21
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216207_21234601RepeatNote=22
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216213_21834601RepeatNote=23
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216219_22434601RepeatNote=24
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216225_23034601RepeatNote=25
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216231_23834601RepeatNote=26
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216239_24534601RepeatNote=27
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216246_25234601RepeatNote=28
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216253_25934601RepeatNote=29
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216260_27634601RepeatNote=30
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216277_28534601RepeatNote=31
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21635_4234601RepeatNote=4
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21643_5034601RepeatNote=5
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21651_5934601RepeatNote=6
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21660_6834601RepeatNote=7
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21669_7534601RepeatNote=8
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21676_8434601RepeatNote=9
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21685_9134601RepeatNote=10
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21692_11034601RepeatNote=11
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29111_11634355RepeatNote=12
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29117_12534355RepeatNote=13
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29126_15634355RepeatNote=14
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29157_16334355RepeatNote=15
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29164_17034355RepeatNote=16
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29171_17734355RepeatNote=17
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29178_18834355RepeatNote=18
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29189_19334355RepeatNote=19
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29194_20134355RepeatNote=20
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29202_20634355RepeatNote=21
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29207_21234355RepeatNote=22
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29213_21834355RepeatNote=23
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29219_22434355RepeatNote=24
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29225_23034355RepeatNote=25
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29231_23834355RepeatNote=26
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29239_24534355RepeatNote=27
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29246_25234355RepeatNote=28
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29253_25934355RepeatNote=29
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29260_27634355RepeatNote=30
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29277_28534355RepeatNote=31
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2935_4234355RepeatNote=4
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2943_5034355RepeatNote=5
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2951_5934355RepeatNote=6
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2960_6834355RepeatNote=7
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2969_7534355RepeatNote=8
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2976_8434355RepeatNote=9
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2985_9134355RepeatNote=10
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2992_11034355RepeatNote=11
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217111_11634657RepeatNote=12
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217117_12534657RepeatNote=13
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217126_15634657RepeatNote=14
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217157_16334657RepeatNote=15
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217164_17034657RepeatNote=16
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217171_17734657RepeatNote=17
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217178_18834657RepeatNote=18
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217189_19334657RepeatNote=19
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217194_20134657RepeatNote=20
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217202_20634657RepeatNote=21
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217207_21234657RepeatNote=22
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217213_21834657RepeatNote=23
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217219_22434657RepeatNote=24
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217225_23034657RepeatNote=25
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217231_23834657RepeatNote=26
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217239_24534657RepeatNote=27
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217246_25234657RepeatNote=28
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217253_25934657RepeatNote=29
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217260_27634657RepeatNote=30
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217277_28534657RepeatNote=31
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21735_4234657RepeatNote=4
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21743_5034657RepeatNote=5
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21751_5934657RepeatNote=6
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21760_6834657RepeatNote=7
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21769_7534657RepeatNote=8
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21776_8434657RepeatNote=9
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21785_9134657RepeatNote=10
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21792_11034657RepeatNote=11
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217111_11634656RepeatNote=12
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217117_12534656RepeatNote=13
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217126_15634656RepeatNote=14
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217157_16334656RepeatNote=15
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217164_17034656RepeatNote=16
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217171_17734656RepeatNote=17
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217178_18834656RepeatNote=18
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217189_19334656RepeatNote=19
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217194_20134656RepeatNote=20
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217202_20634656RepeatNote=21
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217207_21234656RepeatNote=22
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217213_21834656RepeatNote=23
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217219_22434656RepeatNote=24
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217225_23034656RepeatNote=25
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217231_23834656RepeatNote=26
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217239_24534656RepeatNote=27
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217246_25234656RepeatNote=28
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217253_25934656RepeatNote=29
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217260_27634656RepeatNote=30
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217277_28534656RepeatNote=31
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21735_4234656RepeatNote=4
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21743_5034656RepeatNote=5
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21751_5934656RepeatNote=6
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21760_6834656RepeatNote=7
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21769_7534656RepeatNote=8
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21776_8434656RepeatNote=9
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21785_9134656RepeatNote=10
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21792_11034656RepeatNote=11
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218111_11634662RepeatNote=12
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218117_12534662RepeatNote=13
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218126_15634662RepeatNote=14
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218157_16334662RepeatNote=15
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218164_17034662RepeatNote=16
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218171_17734662RepeatNote=17
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218178_18834662RepeatNote=18
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218189_19334662RepeatNote=19
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218194_20134662RepeatNote=20
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218202_20634662RepeatNote=21
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218207_21234662RepeatNote=22
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218213_21834662RepeatNote=23
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218219_22434662RepeatNote=24
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218225_23034662RepeatNote=25
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218231_23834662RepeatNote=26
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218239_24534662RepeatNote=27
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218246_25234662RepeatNote=28
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218253_25934662RepeatNote=29
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218260_27634662RepeatNote=30
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218277_28534662RepeatNote=31
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21835_4234662RepeatNote=4
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21843_5034662RepeatNote=5
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21851_5934662RepeatNote=6
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21860_6834662RepeatNote=7
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21869_7534662RepeatNote=8
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21876_8434662RepeatNote=9
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21885_9134662RepeatNote=10
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21892_11034662RepeatNote=11
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916518_549332601Zinc fingerRanBP2-type
TgeneEWSR1chr22:29280054chr22:29692229ENST00000333395+09518_549-7355Zinc fingerRanBP2-type
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017518_549388657Zinc fingerRanBP2-type
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017518_549387656Zinc fingerRanBP2-type
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118518_549393662Zinc fingerRanBP2-type
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+216518_54934601Zinc fingerRanBP2-type
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+29518_54934355Zinc fingerRanBP2-type
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+217518_54934657Zinc fingerRanBP2-type
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+217518_54934656Zinc fingerRanBP2-type
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+218518_54934662Zinc fingerRanBP2-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNRF3chr22:29280054chr22:29692229ENST00000332811+19241_9360837Topological domainCytoplasmic
HgeneZNRF3chr22:29280054chr22:29692229ENST00000332811+1956_2190837Topological domainExtracellular
HgeneZNRF3chr22:29280054chr22:29692229ENST00000402174+19241_936-31837Topological domainCytoplasmic
HgeneZNRF3chr22:29280054chr22:29692229ENST00000402174+1956_219-31837Topological domainExtracellular
HgeneZNRF3chr22:29280054chr22:29692229ENST00000406323+18241_936-8837Topological domainCytoplasmic
HgeneZNRF3chr22:29280054chr22:29692229ENST00000406323+1856_219-8837Topological domainExtracellular
HgeneZNRF3chr22:29280054chr22:29692229ENST00000544604+19241_936100937Topological domainCytoplasmic
HgeneZNRF3chr22:29280054chr22:29692229ENST00000544604+1956_219100937Topological domainExtracellular
HgeneZNRF3chr22:29383189chr22:29669730ENST00000332811+29241_93642837Topological domainCytoplasmic
HgeneZNRF3chr22:29383189chr22:29669730ENST00000332811+2956_21942837Topological domainExtracellular
HgeneZNRF3chr22:29383189chr22:29669730ENST00000402174+29241_93642837Topological domainCytoplasmic
HgeneZNRF3chr22:29383189chr22:29669730ENST00000402174+2956_21942837Topological domainExtracellular
HgeneZNRF3chr22:29383189chr22:29669730ENST00000406323+18241_93642837Topological domainCytoplasmic
HgeneZNRF3chr22:29383189chr22:29669730ENST00000406323+1856_21942837Topological domainExtracellular
HgeneZNRF3chr22:29383189chr22:29669730ENST00000544604+29241_936142937Topological domainCytoplasmic
HgeneZNRF3chr22:29383189chr22:29669730ENST00000544604+2956_219142937Topological domainExtracellular
HgeneZNRF3chr22:29280054chr22:29692229ENST00000332811+19220_2400837TransmembraneHelical
HgeneZNRF3chr22:29280054chr22:29692229ENST00000402174+19220_240-31837TransmembraneHelical
HgeneZNRF3chr22:29280054chr22:29692229ENST00000406323+18220_240-8837TransmembraneHelical
HgeneZNRF3chr22:29280054chr22:29692229ENST00000544604+19220_240100937TransmembraneHelical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000332811+29220_24042837TransmembraneHelical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000402174+29220_24042837TransmembraneHelical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000406323+18220_24042837TransmembraneHelical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000544604+29220_240142937TransmembraneHelical
HgeneZNRF3chr22:29280054chr22:29692229ENST00000332811+19293_3340837Zinc fingerRING-type%3B atypical
HgeneZNRF3chr22:29280054chr22:29692229ENST00000402174+19293_334-31837Zinc fingerRING-type%3B atypical
HgeneZNRF3chr22:29280054chr22:29692229ENST00000406323+18293_334-8837Zinc fingerRING-type%3B atypical
HgeneZNRF3chr22:29280054chr22:29692229ENST00000544604+19293_334100937Zinc fingerRING-type%3B atypical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000332811+29293_33442837Zinc fingerRING-type%3B atypical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000402174+29293_33442837Zinc fingerRING-type%3B atypical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000406323+18293_33442837Zinc fingerRING-type%3B atypical
HgeneZNRF3chr22:29383189chr22:29669730ENST00000544604+29293_334142937Zinc fingerRING-type%3B atypical
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916300_340332601Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017300_340388657Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017300_340387656Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118300_340393662Compositional biasNote=Arg/Gly/Pro-rich
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916256_285332601DomainNote=IQ
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017256_285388657DomainNote=IQ
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017361_447388657DomainRRM
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017256_285387656DomainNote=IQ
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017361_447387656DomainRRM
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118256_285393662DomainNote=IQ
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118361_447393662DomainRRM
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+9161_285332601RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+9168_285332601RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+10171_285388657RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+10178_285388657RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+10171_285387656RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+10178_285387656RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+11181_285393662RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+11188_285393662RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+2161_28534601RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+2168_28534601RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+291_28534355RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+298_28534355RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+2171_28534657RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+2178_28534657RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+2171_28534656RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+2178_28534656RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+2181_28534662RegionNote=EAD (Gln/Pro/Thr-rich)
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+2188_28534662RegionNote=31 X approximate tandem repeats
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916111_116332601RepeatNote=12
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916117_125332601RepeatNote=13
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916126_156332601RepeatNote=14
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916157_163332601RepeatNote=15
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916164_170332601RepeatNote=16
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916171_177332601RepeatNote=17
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916178_188332601RepeatNote=18
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91617_27332601RepeatNote=2
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916189_193332601RepeatNote=19
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916194_201332601RepeatNote=20
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916202_206332601RepeatNote=21
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916207_212332601RepeatNote=22
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916213_218332601RepeatNote=23
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916219_224332601RepeatNote=24
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916225_230332601RepeatNote=25
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916231_238332601RepeatNote=26
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916239_245332601RepeatNote=27
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916246_252332601RepeatNote=28
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916253_259332601RepeatNote=29
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916260_276332601RepeatNote=30
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+916277_285332601RepeatNote=31
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91628_34332601RepeatNote=3
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91635_42332601RepeatNote=4
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91643_50332601RepeatNote=5
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91651_59332601RepeatNote=6
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91660_68332601RepeatNote=7
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91669_75332601RepeatNote=8
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91676_84332601RepeatNote=9
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91685_91332601RepeatNote=10
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+9168_16332601RepeatNote=1
TgeneEWSR1chr22:29280054chr22:29692229ENST00000332035+91692_110332601RepeatNote=11
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017111_116388657RepeatNote=12
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017117_125388657RepeatNote=13
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017126_156388657RepeatNote=14
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017157_163388657RepeatNote=15
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017164_170388657RepeatNote=16
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017171_177388657RepeatNote=17
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017178_188388657RepeatNote=18
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101717_27388657RepeatNote=2
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017189_193388657RepeatNote=19
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017194_201388657RepeatNote=20
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017202_206388657RepeatNote=21
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017207_212388657RepeatNote=22
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017213_218388657RepeatNote=23
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017219_224388657RepeatNote=24
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017225_230388657RepeatNote=25
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017231_238388657RepeatNote=26
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017239_245388657RepeatNote=27
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017246_252388657RepeatNote=28
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017253_259388657RepeatNote=29
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017260_276388657RepeatNote=30
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+1017277_285388657RepeatNote=31
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101728_34388657RepeatNote=3
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101735_42388657RepeatNote=4
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101743_50388657RepeatNote=5
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101751_59388657RepeatNote=6
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101760_68388657RepeatNote=7
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101769_75388657RepeatNote=8
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101776_84388657RepeatNote=9
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101785_91388657RepeatNote=10
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+10178_16388657RepeatNote=1
TgeneEWSR1chr22:29280054chr22:29692229ENST00000397938+101792_110388657RepeatNote=11
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017111_116387656RepeatNote=12
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017117_125387656RepeatNote=13
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017126_156387656RepeatNote=14
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017157_163387656RepeatNote=15
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017164_170387656RepeatNote=16
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017171_177387656RepeatNote=17
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017178_188387656RepeatNote=18
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101717_27387656RepeatNote=2
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017189_193387656RepeatNote=19
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017194_201387656RepeatNote=20
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017202_206387656RepeatNote=21
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017207_212387656RepeatNote=22
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017213_218387656RepeatNote=23
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017219_224387656RepeatNote=24
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017225_230387656RepeatNote=25
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017231_238387656RepeatNote=26
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017239_245387656RepeatNote=27
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017246_252387656RepeatNote=28
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017253_259387656RepeatNote=29
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017260_276387656RepeatNote=30
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+1017277_285387656RepeatNote=31
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101728_34387656RepeatNote=3
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101735_42387656RepeatNote=4
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101743_50387656RepeatNote=5
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101751_59387656RepeatNote=6
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101760_68387656RepeatNote=7
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101769_75387656RepeatNote=8
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101776_84387656RepeatNote=9
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101785_91387656RepeatNote=10
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+10178_16387656RepeatNote=1
TgeneEWSR1chr22:29280054chr22:29692229ENST00000406548+101792_110387656RepeatNote=11
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118111_116393662RepeatNote=12
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118117_125393662RepeatNote=13
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118126_156393662RepeatNote=14
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118157_163393662RepeatNote=15
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118164_170393662RepeatNote=16
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118171_177393662RepeatNote=17
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118178_188393662RepeatNote=18
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111817_27393662RepeatNote=2
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118189_193393662RepeatNote=19
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118194_201393662RepeatNote=20
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118202_206393662RepeatNote=21
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118207_212393662RepeatNote=22
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118213_218393662RepeatNote=23
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118219_224393662RepeatNote=24
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118225_230393662RepeatNote=25
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118231_238393662RepeatNote=26
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118239_245393662RepeatNote=27
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118246_252393662RepeatNote=28
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118253_259393662RepeatNote=29
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118260_276393662RepeatNote=30
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+1118277_285393662RepeatNote=31
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111828_34393662RepeatNote=3
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111835_42393662RepeatNote=4
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111843_50393662RepeatNote=5
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111851_59393662RepeatNote=6
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111860_68393662RepeatNote=7
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111869_75393662RepeatNote=8
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111876_84393662RepeatNote=9
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111885_91393662RepeatNote=10
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+11188_16393662RepeatNote=1
TgeneEWSR1chr22:29280054chr22:29692229ENST00000414183+111892_110393662RepeatNote=11
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21617_2734601RepeatNote=2
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+21628_3434601RepeatNote=3
TgeneEWSR1chr22:29383189chr22:29669730ENST00000332035+2168_1634601RepeatNote=1
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2917_2734355RepeatNote=2
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+2928_3434355RepeatNote=3
TgeneEWSR1chr22:29383189chr22:29669730ENST00000333395+298_1634355RepeatNote=1
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21717_2734657RepeatNote=2
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+21728_3434657RepeatNote=3
TgeneEWSR1chr22:29383189chr22:29669730ENST00000397938+2178_1634657RepeatNote=1
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21717_2734656RepeatNote=2
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+21728_3434656RepeatNote=3
TgeneEWSR1chr22:29383189chr22:29669730ENST00000406548+2178_1634656RepeatNote=1
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21817_2734662RepeatNote=2
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+21828_3434662RepeatNote=3
TgeneEWSR1chr22:29383189chr22:29669730ENST00000414183+2188_1634662RepeatNote=1


Top

FusionGeneSequence for ZNRF3_EWSR1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000332050_chr22_29692229_+_369aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPP
PLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPP
PGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHR

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000397938_chr22_29692229_+_369aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPP
PLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPP
PGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHR

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000406548_chr22_29692229_+_369aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPP
PLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPP
PGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHR

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000331029_chr22_29692229_+_369aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPP
PLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPP
PGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHR

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000414183_chr22_29692229_+_369aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPP
PLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPP
PGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHR

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_692aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQ
PPTGTTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPS
LGTGQSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPS
QTSQQSSSYGQQRPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATV
STEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGS
RGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGD

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_765aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQ
PPTGTTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPS
LGTGQSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPS
QTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDE
GPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDG
KDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDW
QCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGG

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_764aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQ
PPTGTTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPS
LGTGQSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPS
QTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEG
PDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGK
DFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQ
CPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGG

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_727aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQ
PPTGTTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPS
LGTGQSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPS
QTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRDPDEDSDNSAITVQGLNDSVTLDDLADF
FKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPL
RGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPG
GDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQE

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_770aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQ
PPTVEGTSTGTTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTG
GYNQPSLGTGQSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGS
YSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPG
GPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAV
EWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQH
RAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDR

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_463aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQ
PPTGTTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPS
LGTGQSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPS
QTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGLQSESLVYTSILKKYPY

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_709aa
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGA
TLSAEGEIVQMHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQ
PPTGTTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPS
STGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFD
RGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMI
HIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMG
GRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGL

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_592aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQRPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKA
AVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNV
QHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGM

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_665aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPV
DPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKV
SLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQ
NFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPP

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_664aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPPVD
PDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVS
LARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQN
FAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_627aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMN
KRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_670aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTG
TTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTG
QSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQ
QSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLD
LGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQG
SKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNP
GCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_363aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGLQSESLVYTSILKKYPYSVLSRQHNEK

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_609aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQ
QSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRG
GGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGK
PKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFP
PRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMF

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_592aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQRPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKA
AVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNV
QHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGM

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_665aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPV
DPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKV
SLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQ
NFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPP

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_664aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPPVD
PDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVS
LARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQN
FAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPG

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_627aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMN
KRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGG

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_670aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTG
TTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTG
QSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQ
QSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLD
LGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQG
SKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNP
GCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGG

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_363aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGLQSESLVYTSILKKYPYSVLSRQHNEK

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_609aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQ
QSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRG
GGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGK
PKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFP
PRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMF

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_592aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQRPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKA
AVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNV
QHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGM

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_665aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPV
DPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKV
SLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQ
NFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPP

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_664aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPPVD
PDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVS
LARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQN
FAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPG

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_627aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMN
KRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGG

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_670aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTG
TTTPTAPQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTG
QSNYSTPQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQ
QSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLD
LGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSTEDPPTAKAAVEWFDGKDFQG
SKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNP
GCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGG

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_363aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYST
PQVPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYG
QQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGLQSESLVYTSILKKYPYSVLSRQHNEK

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_609aa
MHPLGLCNNNDEEDLTETGWVGVVKLEQPELDPKPCLTVLGKATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTA
PQAYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQ
QSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRG
GGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAITVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGK
PKGDATVSTEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFP
PRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000332050_chr22_29692229_+_1107nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000397938_chr22_29692229_+_1107nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000406548_chr22_29692229_+_1107nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000331029_chr22_29692229_+_1107nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000414183_chr22_29692229_+_1107nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_2076nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGG
GTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGA
ACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAG
CCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACT
GCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCA
GCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGC
CTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCT
ACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAG
CAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGT
CAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGAT
GAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGG
GTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTG
TCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCT
CGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGA
GGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCC
CGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCC
TGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGA
GGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGAC
AGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTG
ATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCC

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_2295nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGG
GTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGA
ACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAG
CCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACT
GCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCA
GCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGC
CTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCT
ACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAG
CAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGT
CAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCT
GGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATG
AGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAA
GGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTG
ACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTG
GACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGG
AAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAG
GGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGA
GATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGG
CAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTC
CCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGT
GGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGA
GGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATG

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_2292nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGG
GTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGA
ACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAG
CCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACT
GCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCA
GCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGC
CTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCT
ACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAG
CAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGT
CAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCT
GGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATG
AGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGA
CCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACT
CTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGAC
AAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAA
GATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGC
AGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGAT
AGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAG
TGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCG
CCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGT
CCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGA
AGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGAT

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_2181nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGG
GTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGA
ACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAG
CCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACT
GCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCA
GCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGC
CTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCT
ACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAG
CAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGT
CAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCT
GGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATG
AGCAGAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTC
TTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAA
GGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTT
AAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTC
CGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGA
GGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGA
AACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGT
GGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGT
GGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGG
CCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAG

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2310nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGG
GTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGA
ACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAG
CCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGT
GCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCC
TATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGG
GGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCA
CCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAA
CCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCC
TACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGT
GTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGA
TTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGT
GGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGA
TTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATG
ATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTG
GAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGT
CTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATG
GGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCAC
CGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAG
CCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGC
CTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGA
GGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGA

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1389nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGG
GTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGA
ACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAG
CCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACT
GCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCA
GCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGC
CTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCT
ACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAG
CAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGT
CAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCT
GGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATG
AGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGGTTACAAAGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTAC

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_2127nt
ATGAGGCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGC
CTGCCGCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTC
GTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCC
ACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGG
GTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGA
ACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAG
CCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACT
GCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCA
GCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGC
AGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGC
CAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTAT
GGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGAT
CGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGA
CCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTA
AATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATC
CACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAA
TGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTG
CCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGA
GGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGA
GCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCT
GAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTC
ATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGT
GGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGA

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_1776nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTA
CAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAA
CCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCT
GCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGG
GGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGT
CGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTC
CAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCC
CCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGA
GGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATG
GACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGA

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_1995nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTA
GATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAG
CAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGAT
GCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTC
TCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGA
GGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCC
CGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAG
AACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGAT
CGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGT
GGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCT
GGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGA

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_1992nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGAT
CCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAG
TGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCC
ACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCC
CTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGT
CCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGG
GGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAAC
TTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGT
GGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGT
GGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGA
CCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGAT

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_1881nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGATCCAGATGAAGACTCTGACAAC
AGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAAC
AAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCA
CCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCA
ATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCT
GGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCT
GGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGC
AACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGC
ATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGT
GGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGA

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2010nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGT
TATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACC
ACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCT
ACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGA
CAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCC
TCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTAT
GGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAA
CAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCC
GGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGG
CGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGAT
CTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTG
GCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGA
AAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGG
AGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCA
CCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTC
CCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCG
GGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCG
CCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATG
TTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGC
CCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCAC

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1089nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGGTTACAAAGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTACTCAGTACTCAGCCGGCAGCATAATGAAAAG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_1827nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACA
CAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAA
CAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGC
AGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCA
GGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGA
GGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTA
GGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCA
GACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_1776nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTA
CAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAA
CCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCT
GCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGG
GGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGT
CGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTC
CAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCC
CCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGA
GGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATG
GACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGA

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_1995nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTA
GATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAG
CAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGAT
GCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTC
TCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGA
GGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCC
CGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAG
AACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGAT
CGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGT
GGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCT
GGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGA

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_1992nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGAT
CCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAG
TGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCC
ACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCC
CTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGT
CCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGG
GGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAAC
TTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGT
GGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGT
GGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGA
CCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGAT

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_1881nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGATCCAGATGAAGACTCTGACAAC
AGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAAC
AAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCA
CCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCA
ATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCT
GGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCT
GGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGC
AACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGC
ATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGT
GGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGA

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2010nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGT
TATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACC
ACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCT
ACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGA
CAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCC
TCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTAT
GGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAA
CAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCC
GGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGG
CGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGAT
CTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTG
GCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGA
AAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGG
AGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCA
CCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTC
CCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCG
GGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCG
CCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATG
TTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGC
CCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCAC

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1089nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGGTTACAAAGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTACTCAGTACTCAGCCGGCAGCATAATGAAAAG

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_1827nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACA
CAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAA
CAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGC
AGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCA
GGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGA
GGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTA
GGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCA
GACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_1776nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTA
CAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAA
CCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCT
GCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGG
GGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGT
CGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTC
CAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCC
CCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGA
GGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATG
GACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGA

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_1995nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTA
GATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAG
CAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGAT
GCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTC
TCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGA
GGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCC
CGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAG
AACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGAT
CGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGT
GGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCT
GGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGA

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_1992nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGAT
CCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAG
TGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCC
ACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCC
CTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGT
CCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGG
GGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAAC
TTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGT
GGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGT
GGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGA
CCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGAT

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_1881nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGATCCAGATGAAGACTCTGACAAC
AGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAAC
AAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCA
CCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCA
ATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCT
GGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCT
GGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGC
AACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGC
ATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGT
GGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGA

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2010nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGT
TATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACC
ACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCT
ACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGA
CAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCC
TCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTAT
GGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAA
CAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCC
GGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGG
CGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGAT
CTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTG
GCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGA
AAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGG
AGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCA
CCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTC
CCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCG
GGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCG
CCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATG
TTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGC
CCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCAC

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1089nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGA
AACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTAT
CCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGT
TATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTAT
GGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGG
CAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGG
AGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGT
GGAATGGGGTTACAAAGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTACTCAGTACTCAGCCGGCAGCATAATGAAAAG

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_1827nt
ATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAA
TTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTAT
ACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCC
CCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTAT
GCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACA
CAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAA
CAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGC
AGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCA
GGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGA
GGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTA
GGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCA
GACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAG
CCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGC
AAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCA
CCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCT
CCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGT
TGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCC
CCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTC
AGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCT
GGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000332050_chr22_29692229_+_1645nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAA
AGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACT
TAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACT
CCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAG
AGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGG
AAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGG
TGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGG
TGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGG
GCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGA
GCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATT
TATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTA
AAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTG
AGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATA

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000397938_chr22_29692229_+_1646nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAA
AGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACT
TAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACT
CCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAG
AGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGG
AAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGG
TGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGG
TGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGG
GCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGA
GCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATT
TATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTA
AAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTG
AGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATA

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000406548_chr22_29692229_+_1457nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAA
AGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACT
TAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACT
CCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAG
AGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGG
AAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGG
TGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGG
TGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGG
GCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGA
GCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATT
TATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTA

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000331029_chr22_29692229_+_1646nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAA
AGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACT
TAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACT
CCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAG
AGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGG
AAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGG
TGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGG
TGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGG
GCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGA
GCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATT
TATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTA
AAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTG
AGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATA

>In-frame_ZNRF3_ENST00000544604_chr22_29280054_+_EWSR1_ENST00000414183_chr22_29692229_+_1464nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAA
AGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACT
TAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACT
CCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAG
AGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGG
AAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGG
TGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGG
TGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGG
GCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGA
GCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATT
TATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTA

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_2614nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGG
AGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGA
CTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGT
TAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTA
TGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAA
GAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCC
AGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGG
GAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAG
AACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGG
CCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGG
TGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGA
ACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTA
GATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATG
TTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGT
GCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTG
GAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATAAAATTCCAAATGTTTATAAAG

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_2834nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGG
AGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACC
AGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCT
AGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAA
GGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGA
TTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAG
AGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAG
AGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTG
TCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCC
ACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCC
CGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAG
ACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAA
AGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAAC
CAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACC
ATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAA
CAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTT

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_2642nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGG
AGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGA
TCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGA
TGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGA
AACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTT
TCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGG
CATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGG
AGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCC
CAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACC
CTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGG
TGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACG
AGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGG
CGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAG
AAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATT

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_2720nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGG
AGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAA
GCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGA
TGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGT
CTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGG
AGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACC
CCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCA
GAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGA
TCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCG
TGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCC
TGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAG
AGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAAT
TCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAA
GTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATG
CTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATAAAATTC

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2667nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGG
AGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTA
TGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGG
GCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTA
CAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCC
ATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAG
CAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAG
CCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTA
TGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGA
TCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACC
CATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAA
TGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCA
CATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATG
GTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCC
ACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGG
CCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGC
TGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGA
AGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCAT
GGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGG
CTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACC
TGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAG
ATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACT

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1745nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGG
AGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGGTTACAAAGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTACTCAGT
ACTCAGCCGGCAGCATAATGAAAAGTGGGACTAGACACGGTGTCCATATGGAGAGGAAAAATATACATAGAATATTTTTAACAAAATGTA
TTCATTGTATAAATGGAATCCTTCTGTAACTTTGGTAACTGCATACTTGTTGTTTGGTAATGAACCAGAGGAGGTATAATACTCTAGAAT

>In-frame_ZNRF3_ENST00000544604_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_2477nt
AGATGAAAGGGCCGCGGCGCGACGGCCGGGGGAGCCGAGCTGAGCCTGCGACCCACAAAGCCGCCGCCGCCGCCGCCGTGATGGGGCTGT
GAGGCGTCCGCCCGCGTTCGGTCCTCAGCCGGCCCGCGACTATGCCCGGCCGCGCCCGCCCTCCGCGCCCTCCCGCCGCAGGACCATGAG
GCCGCGCTCGGGCGGGCGCCCAGGGGCCACGGGCCGCCGCCGCCGCCGCCTGCGCCGCCGCCCCCGCGGCCTCCGGTGCAGCCGCCTGCC
GCCGCCGCCGCCGCTGCCGCTGCTGCTCGGGCTGCTGCTGGCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGA
GGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACCACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCT
CAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGG
AGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTA
TGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGC
TCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCA
GGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGG
AGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCAT
GGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGA
CAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACAT
CTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTT
TGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACC
CCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCG
TGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGG
AGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGG
CTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGA
TCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTT
TGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGG
AAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATT
TATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTA

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_2304nt
GCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACC
ACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGC
CTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCA
TGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACC
ACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGC
CAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCA
TATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAG
ACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGG
AGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGT
TACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCC
ACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGACCCATG
GATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGAC
AGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATC
TACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTT
GATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCC
CGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGT
GGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGA
GACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGC
TTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGAT
CGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTT
GGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGA
AAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTT
ATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAG
TATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTT
TAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_2524nt
GCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACC
ACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGC
CTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCA
TGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACC
ACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGC
CAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCA
TATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAG
ACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGG
AGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGT
TACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCC
ACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTC
CGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCT
GATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGCT
GGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGAC
TCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTT
AAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTAT
GAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAG
AAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCA
GGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGG
AACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGA
ACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGC
CCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGT
GGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAA
CAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAG
ATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGT
TGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTG
CGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGG
AGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATAAAATTCCAAATGTTTATAAAGA

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_2332nt
GCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACC
ACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGC
CTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCA
TGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACC
ACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGC
CAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCA
TATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAG
ACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGG
AGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGT
TACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCC
ACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTC
CGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCT
GATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGA
GAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCT
GACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAG
ATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAA
GACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAG
CCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGA
GGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAAC
CCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACA
GAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCT
GGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGC
TTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAG
ATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATG
CAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_2410nt
GCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACC
ACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGC
CTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCA
TGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACC
ACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGC
CAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCA
TATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAG
ACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGG
AGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGT
TACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCC
ACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTC
CGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCT
GATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTA
CAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAA
CCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCT
GCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGG
GGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGT
CGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTC
CAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCC
CCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGA
GGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATG
GACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGA
CGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCA
TTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCC
TTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTT
TTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2357nt
GCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACC
ACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGC
CTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCA
TGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACC
ACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACT
GCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCC
TATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGAT
GGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGT
TATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACT
AGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGC
TATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTAC
GGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAAC
CGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGC
GGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTA
GATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAG
CAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGAT
GCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTC
TCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGA
GGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCC
CGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAG
AACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGAT
CGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGT
GGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCT
GGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGA
GATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATT
CCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAG

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1435nt
GCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACC
ACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGC
CTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCA
TGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACC
ACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGC
CAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCA
TATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAG
ACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGG
AGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGT
TACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCC
ACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTC
CGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCT
GATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGGTTACAA
AGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTACTCAGTACTCAGCCGGCAGCATAATGAAAAGTGGGACTAGACACGG
TGTCCATATGGAGAGGAAAAATATACATAGAATATTTTTAACAAAATGTATTCATTGTATAAATGGAATCCTTCTGTAACTTTGGTAACT

>In-frame_ZNRF3_ENST00000332811_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_2167nt
GCGGCCGCGGGGCCCGGCGCGGCGCGGGCCAAGGAGACGGCGTTCGTGGAGGTGGTGCTGTTCGAGTCGAGCCCAAGCGGCGATTACACC
ACCTACACCACCGGCCTCACGGGCCGCTTCTCGCGGGCCGGGGCCACGCTCAGCGCCGAGGGCGAGATCGTGCAGATGCACCCACTGGGC
CTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCA
TGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACC
ACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGC
CAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCA
TATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTAT
GATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGG
CAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAG
CAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGC
ATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGA
ATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGAT
CCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAG
TGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCC
ACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCC
CTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGT
CCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGG
GGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAAC
TTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGT
GGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGT
GGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGA
CCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGAT
CGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCA
TATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTA

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_2232nt
GCACAGAAGTTTGCTGCATCACTGGTGAGCTGGGGAGTGTCCTGTGTGGTGTCCACTTAATCTTACTAGGAAGGATCCCCTCATTTCAAC
AAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCA
GAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGC
TATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACT
GCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCC
TATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGAT
GGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGT
TATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACT
AGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGC
TATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTAC
GGGCAGCAGAGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTAT
GTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGG
CAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAG
GCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATG
CGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATG
GGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAAC
GTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAG
GCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGA
AGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGC
ATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGA
GGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCT
GCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTAT
TCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTT
CTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAA

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_2452nt
GCACAGAAGTTTGCTGCATCACTGGTGAGCTGGGGAGTGTCCTGTGTGGTGTCCACTTAATCTTACTAGGAAGGATCCCCTCATTTCAAC
AAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCA
GAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGC
TATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACT
GCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCC
TATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGAT
GGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGT
TATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACT
AGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGC
TATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTAC
GGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAAC
CGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGC
GGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCT
GTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTT
AAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGC
GATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAA
GTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGT
GGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGA
CCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAAC
CAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGT
GATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGC
CGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCC
CCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGC
AGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATA
ATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAAC
AAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCA
TGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATAAAAT

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_2260nt
GCACAGAAGTTTGCTGCATCACTGGTGAGCTGGGGAGTGTCCTGTGTGGTGTCCACTTAATCTTACTAGGAAGGATCCCCTCATTTCAAC
AAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCA
GAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGC
TATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACT
GCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCC
TATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGAT
GGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGT
TATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACT
AGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGC
TATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTAC
GGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAAC
CGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGC
GGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTA
GATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAG
CAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGAT
GCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTC
TCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGA
GGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCC
CGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAG
AACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGAT
CGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGT
GGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCT
GGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGA
GATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATT
CCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAG

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_2338nt
GCACAGAAGTTTGCTGCATCACTGGTGAGCTGGGGAGTGTCCTGTGTGGTGTCCACTTAATCTTACTAGGAAGGATCCCCTCATTTCAAC
AAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCA
GAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGC
TATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACT
GCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCC
TATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGAT
GGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGT
TATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACT
AGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGC
TATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTAC
GGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAAC
CGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGATCCAGATGAAGACTCTGAC
AACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATG
AACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGAC
CCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCT
CCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGT
CCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCC
TCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAG
TGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGT
GGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTC
CGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATG
GGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAG
AGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCA
CAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTGCGGAGT
TTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGGAGAACC

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2285nt
GCACAGAAGTTTGCTGCATCACTGGTGAGCTGGGGAGTGTCCTGTGTGGTGTCCACTTAATCTTACTAGGAAGGATCCCCTCATTTCAAC
AAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCA
GAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGC
TATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACA
GGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTC
ACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCA
CCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATAT
GGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTAT
TCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGC
TATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGC
CAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTT
TCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGT
GGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTT
GATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGAT
CTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACA
GGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAA
GGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATG
CCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGC
TTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAAT
CCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTT
CCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGA
ATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGT
GGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAG
CACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAA
TGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTG

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1363nt
GCACAGAAGTTTGCTGCATCACTGGTGAGCTGGGGAGTGTCCTGTGTGGTGTCCACTTAATCTTACTAGGAAGGATCCCCTCATTTCAAC
AAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCA
GAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGC
TATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACT
GCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCC
TATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGAT
GGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGT
TATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACT
AGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGC
TATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTAC
GGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAAC
CGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGC
GGTGGAATGGGGTTACAAAGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTACTCAGTACTCAGCCGGCAGCATAATGAA
AAGTGGGACTAGACACGGTGTCCATATGGAGAGGAAAAATATACATAGAATATTTTTAACAAAATGTATTCATTGTATAAATGGAATCCT
TCTGTAACTTTGGTAACTGCATACTTGTTGTTTGGTAATGAACCAGAGGAGGTATAATACTCTAGAATTGTGTAACATTAAAGTGTAAAC

>In-frame_ZNRF3_ENST00000402174_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_2095nt
GCACAGAAGTTTGCTGCATCACTGGTGAGCTGGGGAGTGTCCTGTGTGGTGTCCACTTAATCTTACTAGGAAGGATCCCCTCATTTCAAC
AAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGAGTGGTGAAGCTGGAACAGCCA
GAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGC
TATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACT
GCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCC
TATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGA
CCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGG
GGAGGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGAT
CTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTG
GCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGA
AAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGG
AGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCA
CCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTC
CCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCG
GGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCG
CCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATG
TTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGC
CCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCAC
CGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGT
TTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAG

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000332050_chr22_29669730_+_2163nt
TTTTCTTTCCATTTTATTTCCTAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGA
GTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTAT
GGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACA
GTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACT
GCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGA
TATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGC
TATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGT
AGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATAT
AGCCAACAGAGCAGCAGCTACGGGCAGCAGAGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGAC
TCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTT
AAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTAT
GAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAG
AAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCA
GGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGG
AACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGA
ACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGC
CCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGT
GGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAA
CAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAG
ATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGT
TGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTG
CGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGG
AGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATAAAATTCCAAATGTTTATAAAGA

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000397938_chr22_29669730_+_2383nt
TTTTCTTTCCATTTTATTTCCTAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGA
GTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTAT
GGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACA
GTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACT
GCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGA
TATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGC
TATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGT
AGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATAT
AGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGA
TTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGA
GGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCA
GATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTA
GATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAG
GAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGAT
TTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGA
GGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGA
GGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGT
CCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCA
CCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCC
GGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGA
CGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAA
GGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACC
AGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCA
TTTGTGAAGAAACATTAAAACAAGTTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAAC
AATGGGAACCCCTTGTGAGCATGCTCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTT

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000406548_chr22_29669730_+_2191nt
TTTTCTTTCCATTTTATTTCCTAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGA
GTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTAT
GGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACA
GTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACT
GCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGA
TATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGC
TATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGT
AGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATAT
AGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGA
TTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGA
GGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGAT
CTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGAT
GATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAA
ACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTT
CAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGC
ATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGA
GGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCC
AATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCC
TTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGT
GGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGA
GGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGC
GAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGA
AAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTT

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000331029_chr22_29669730_+_2269nt
TTTTCTTTCCATTTTATTTCCTAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGA
GTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTAT
GGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACA
GTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACT
GCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGA
TATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGC
TATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGT
AGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATAT
AGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGA
TTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGA
GATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAG
CAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGAT
GCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTC
TCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGA
GGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCC
CGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAG
AACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGAT
CGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGT
GGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCT
GGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGA
GATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATT
CCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAGTATTTTTCACCATTTGTGAAGAAACATTAAAACAAG
TTAAATGGTAGTGTGCGGAGTTTTTTTTTCTTCCTTCTTTTAAAAATGGTTGTTTAAGACTTTAACAATGGGAACCCCTTGTGAGCATGC
TCAGTATCATTGTGGAGAACCAAGAGGGCCTCTTAACTGTAACAATGTTCATGGTTGTGATGTTTTTTTTTTTTTTTTAAATAAAATTCC

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000414183_chr22_29669730_+_2216nt
TTTTCTTTCCATTTTATTTCCTAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGA
GTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTAT
GGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTAT
GATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGG
CAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTAC
AACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCA
TCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGC
AGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGC
CAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTAT
GGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGAT
CGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCC
ATGGATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAAT
GACAGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCAC
ATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGG
TTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCA
CCCCGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGC
CGTGGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCT
GGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAA
GGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATG
GATCGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGC
TTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCT
GGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGA
TTTATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTT

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000333395_chr22_29669730_+_1294nt
TTTTCTTTCCATTTTATTTCCTAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGA
GTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTAT
GGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACA
GTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACT
GCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGA
TATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGC
TATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGT
AGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATAT
AGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGA
TTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGA
GGTGGGCGGGGAGGAGGACGCGGTGGAATGGGGTTACAAAGTGAGAGCCTTGTATACACTTCAATACTTAAAAAGTACCCGTACTCAGTA
CTCAGCCGGCAGCATAATGAAAAGTGGGACTAGACACGGTGTCCATATGGAGAGGAAAAATATACATAGAATATTTTTAACAAAATGTAT
TCATTGTATAAATGGAATCCTTCTGTAACTTTGGTAACTGCATACTTGTTGTTTGGTAATGAACCAGAGGAGGTATAATACTCTAGAATT

>In-frame_ZNRF3_ENST00000406323_chr22_29383189_+_EWSR1_ENST00000332035_chr22_29669730_+_2026nt
TTTTCTTTCCATTTTATTTCCTAGATGCACCCACTGGGCCTATGTAATAACAATGACGAAGAGGACTTGTATGAATATGGCTGGGTAGGA
GTGGTGAAGCTGGAACAGCCAGAATTGGACCCGAAACCATGCCTCACTGTCCTAGGCAAGGCATATGGGCAACAAAGCTATGGAACCTAT
GGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCC
ACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACA
GTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACT
GCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTAT
GGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCT
CCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAG
GAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGA
GGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGCTGGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATG
GATGAAGGACCAGATCTTGATCTAGGCCCACCTGTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGAC
AGTGTGACTCTAGATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCATGATCCACATC
TACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCACCCACTGCCAAGGCTGCCGTGGAATGGTTT
GATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCCTTGCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCC
CGTGAGGGCAGAGGCATGCCACCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGT
GGAGGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAAACGTCCAGCACCGAGCTGGA
GACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAGAACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGC
TTCCTCCCGCCACCCTTTCCGCCCCCGGGTGGTGATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGAT
CGTGGTGGTCCCGGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCGAGGTGGCTTT
GGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGAGGAAGAAGAGGAGGACGTGGAGGACCTGGA
AAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATCGGCCCTACTAGATGCAGAGACCCCGCAGAGCTGCATTGACTACCAGATTT
ATTTTTTAAACCAGAAAATGTTTTAAATTTATAATTCCATATTTATAATGTTGGCCACAACATTATGATTATTCCTTGTCTGTACTTTAG


Top

FusionGenePPI for ZNRF3_EWSR1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNRF3UBE2N, FZD4, RSPO1, LGR4, LRP6, GFI1B, DVL2, HSPB1, RSPO2, RSPO3, LGR5, FZD7EWSR1PRTFDC1, ZDHHC3, MSC, SLC22A24, MYO1F, KXD1, KHDRBS2, DNAJB3, FASN, NLE1, MNS1, PRUNE2, WWP2, NDUFB1, BNIP3L, NSUN4, KRR1, WWP1, RMND5B, SLC1A1, RASL11B, DFFA, WDR37, RPS15A, CPSF6, C11orf16, YY1AP1, RNF183, MTCP1, TULP2, RBPMS, KEL, MYOZ2, FAM131C, HMGA1, NPPB, HERPUD1, CD177, RPL31, VPS72, ACTL6A, RAD23A, MAGEA11, CFDP1, DMRTB1, CXADR, ZNF165, SSBP2, TPGS2, RAB37, CETP, NDUFV1, DYNLL2, NBPF3, CEACAM5, GPBP1L1, SERP2, GNPDA1, C19orf57, ELAVL3, ELAVL4, LILRA3, BAD, CCDC7, MRPS18B, CUEDC2, CNST, TSPAN3, CCDC91, TRIM37, NINL, NTNG2, CPSF7, PGLS, EPT1, MYL6, SMAD4, TMSB4Y, TRPV5, MVK, MAPK1IP1L, MDFI, MTMR9, PLSCR1, RALYL, PDHX, C10orf12, RHOXF2, MATK, SALL2, AGT, KCNMB1, SUV39H2, SMNDC1, ARHGDIA, PUF60, GSK3B, ILK, CD2BP2, BARD1, CREBBP, BTK, SF1, SNRPC, ELK1, PTK2B, CALM1, POU4F1, EZH2, IRF3, TONSL, RFX3, HLTF, SUPT4H1, ZNF184, HIST1H2BN, BLZF1, HDAC3, FXR2, HMGN4, POLR3A, ECD, ZBTB1, SCMH1, SUZ12, E2F8, TRIM5, ZNF383, DHX9, SMN1, PCM1, RAD21, NDRG1, CEBPA, ELAVL1, SIRT7, HNRNPA1, TSG101, TP53, POLR2A, YBX1, TDRD3, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, KCND3, ATN1, ATXN3, ERCC5, HBP1, HSPA2, PCBP1, USP7, SRSF5, TMEM126A, SAP30BP, GORASP2, MBD3, MRPS9, HAX1, SFXN1, ITGA5, TCIRG1, RNF168, GEMIN5, HAS1, MTCH1, NDUFA5, MCAT, MRPL57, HDAC2, ESR1, FN1, VCAM1, ITGA4, CD81, PRMT1, SF3B4, EP300, PRRC2A, EWSR1, FUS, ITGB5, NONO, TRAF3, HNRNPUL1, EPAS1, CHERP, CDK12, ITCH, WBP4, RPA3, RPA2, RPA1, HSPA5, RIOK2, TRAF1, TRAF2, SEC24D, TFG, SEC24A, SSBP3, PRR13, ATPAF2, PEF1, JUN, CUL7, OBSL1, CCDC8, RNF2, BMI1, EGFR, ABL1, SRPK1, ABCE1, PRMT8, RPS6KB2, ACAA2, ACAT1, EIF4H, ANXA2, HIP1R, PICALM, POR, NTRK1, SCARNA22, NPM1, KRT2, PRDX2, S100A9, YWHAZ, DDX17, PCLO, ANXA6, SEC24C, GIPC1, CSRP2, FHL1, HNRNPA3, CTTN, MARCKSL1, PARP1, SERPINB3, CCDC50, KIF2A, KRT6B, HIST1H1D, STK38, H2AFV, PACSIN2, U2AF1, RSL24D1, XRCC5, ESYT3, RPL29, SDF2L1, LRP1B, MSN, SEC23A, RPL7A, SNX18, PPIL1, RPS27A, IGHM, SUMO3, GTF2I, RUVBL1, KRT16, RBM8A, RPL8, SRSF9, ZC3HAV1L, GAPDH, ETV3, IGF2R, COL5A2, HNRNPD, ANP32B, WAC, TFAP2A, TTN, CBR3, ARGLU1, HNRNPAB, SRRT, ATP1B3, COPS7B, PRR12, ATF3, NOMO3, NOMO1, NOMO2, EYA3, C1orf198, MAZ, U2AF2, SSB, TRA2B, C1orf52, HMGB1, HMGB1P10, RPRD1A, HNRNPH3, EIF5A2, C1orf131, SEC13, MAPRE1, CSTF2T, SRSF3, LENG1, UPF1, HDGFRP2, RPS10P7, RPS10P11, RPS10, RPS10P13, RPS10P4, RPS10P22, DACH1, ANO1, NCOR1, MLX, SUMO1P3, SUMO1, WIZ, PFDN6, ARFIP2, ZHX3, EEF1B2, MBIP, BAG6, DENND2A, PRCC, SRSF1, EIF4ENIF1, SPTAN1, CDCA8, PLS3, API5P1, API5, PSMA4, DNTTIP1, AKAP8, NCOA3, SMTN, FBRS, SMARCE1, ERC1, WBP11, SPTBN1, NFRKB, OLA1, ZNF207, R3HDM1, TRIM33, SAFB, UBFD1, SRSF7, SRSF2, GATA6, VDAC1P1, VDAC1, IL16, GMNN, ILF2, MED4, QKI, VCL, MFAP1, SNAP29, PADI1, BCL9, BCL9L, PKM, GPATCH11, CASC3, PSMC6, CACYBP, RPL12P6, RPL12P32, RPL12P14, RPL12, RPL12P2, RPL12P35, RPL12P19, TPI1, TPI1P1, CHAF1A, MIA3, CIC, SDCBP, CA2, FKBP3, ACE, NKX2-5, CSTF2, PFDN2, UBTF, FAM207A, LOC729774, BRD8, C12orf45, C1orf35, TCF20, SOD1, SPAG7, MED8, ETS2, ALDOC, FKBP4, INCENP, CEP85, CECR2, TFE3, SUPT16HP1, SUPT16H, MAPT, HTATSF1, RPS18P12, RPS18P5, KPNA2, TMX1, CKAP4, HSPE1, COPRS, PTGES3, LAMP2, ERLIN2, CTNNBL1, TOMM22, NRBF2, C9orf78, NCOA6, MED26, RANBP1, LOC389842, LOC727803, HMGB3, CANX, PUS7, RPSAP19, RPSA, RPSAP18, RPSAP58, RPSAP15, RPSAP8, RPSAP9, RPSAP12, RPSAP29, RPSAP61, ARHGAP17, USF1, PSIP1, SNRPEP2, SNRPE, NUDT5, PPM1G, OTUB1, AHCY, COPS3, NSMCE2, SAE1, PROSER1, GRWD1, CREB5, TAF9B, RBM33, EDF1, PGK1, FAM114A2, SRRM1, RAD23B, CIAPIN1, CIAPIN1P, LRRC59, PABPN1, KMT2A, RPRD1B, GPATCH8, CCDC43, DGCR14, PPP1R2, ERICH1, EIF5A, EIF5AL1, BAG3, PCNA, SOX7, PNISR, FAM168A, MED15, SRSF11, SIRT1, RSF1, MAML1, HPRT1, SPDL1, CRTC3, CEP55, CDV3, ALYREF, RNF40, STOML2, DGCR8, NUCKS1, UBN2, PSMD7, WNT10A, HMBS, KHDRBS1, VBP1, NCSTN, CDCA2, SFSWAP, ZRANB2, DDB1, RBBP6, ZEB1, SRSF6, LOC644422, EIF2S1, RFX5, RPS19, RPS19P3, TALDO1, CWC15, CDCA5, LOC645086, C11orf58, TXN, STX12, PHRF1, BSG, TAF4, SH3GL1, LIN37, HRNR, FAM192A, RRBP1, KIAA0907, GOLGB1, PAX9, P4HB, CHMP5, LDHB, CALR, SUMO2P1, SUMO2, PDIA6, AHSA1, EN2, CCDC124, RPLP0P6, RPLP0P2, RPLP0P3, RPLP0, NIPBL, PDLIM4, PRKCSH, C15orf39, HNRNPDL, PDIA4, NUP210, RPLP2P3, RPLP2, PRDX4, DAZAP1, UBE2T, PHAX, AMOT, MARCKS, LOC284685, SMARCC1, BCORL1, RFC4, GLRX3, ANP32E, HYOU1, NPM3, ATF7IP, SARNP, TRA2A, HDGF, STIP1, PELP1, KCTD12, GLO1, PCF11, CLIC1, DNAJC8, RNF114, SLC4A1AP, FAM50A, GTF2A1, PRPF40A, CDC37, PPIAP22, PPIA, SMARCC2, MEGF11, KIAA1143, DENR, LAMP1, MYBL2, PITX1, UBE2MP1, UBE2M, CHTF8, OTX1, NACA, FNBP4, GTF2F2, GLTSCR1, GTF2E1, PQBP1, EMD, RNF113A, GPALPP1, SNRPA, RRP15, RPS25, RPS25P8, GMEB2, LNPEP, DNAJB1, IGBP1P1, IGBP1, HINT1, ARID1A, PPIB, ANXA11, MATR3, PPARGC1A, MCM2, UBASH3B, SFPQ, CAPN13, HEY1, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNRF3_EWSR1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNRF3_EWSR1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneZNRF3C0030297Pancreatic Neoplasm2CTD_human
HgeneZNRF3C0206686Adrenocortical carcinoma1CTD_human
TgeneEWSR1C0553580Ewings sarcoma3CTD_human;HPO;ORPHANET
TgeneEWSR1C0206663Neuroectodermal Tumor, Primitive1CTD_human