FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43785

FusionGeneSummary for ZNF91_ASF1B

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF91_ASF1B
Fusion gene ID: 43785
HgeneTgene
Gene symbol

ZNF91

ASF1B

Gene ID

7644

55723

Gene namezinc finger protein 91anti-silencing function 1B histone chaperone
SynonymsHPF7|HTF10CIA-II
Cytomap

19p12

19p13.12

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein 91zinc finger protein 91 (HPF7, HTF10)zinc finger protein HPF7zinc finger protein HTF10histone chaperone ASF1BASF1 anti-silencing function 1 homolog BCCG1-interacting factor A-IIanti-silencing function protein 1 homolog BhAsf1hAsf1bhCIA-II
Modification date2018051920180522
UniProtAcc

Q05481

Q9NVP2

Ensembl transtripts involved in fusion geneENST00000596528, ENST00000599743, 
ENST00000300619, ENST00000397082, 
ENST00000263382, ENST00000592798, 
ENST00000474890, 
Fusion gene scores* DoF score6 X 5 X 5=1503 X 3 X 4=36
# samples 84
** MAII scorelog2(8/150*10)=-0.906890595608519
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ZNF91 [Title/Abstract] AND ASF1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZNF91

GO:0045892

negative regulation of transcription, DNA-templated

25274305

HgeneZNF91

GO:0070895

negative regulation of transposon integration

25274305

TgeneASF1B

GO:0006335

DNA replication-dependent nucleosome assembly

14718166

TgeneASF1B

GO:0006336

DNA replication-independent nucleosome assembly

14718166


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPCPGTCGA-S7-A7WP-01AZNF91chr19

23578127

-ASF1Bchr19

14232520

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000596528ENST00000263382ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
intron-intronENST00000596528ENST00000592798ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
intron-intronENST00000596528ENST00000474890ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
In-frameENST00000599743ENST00000263382ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
5CDS-intronENST00000599743ENST00000592798ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
5CDS-intronENST00000599743ENST00000474890ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
In-frameENST00000300619ENST00000263382ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
5CDS-intronENST00000300619ENST00000592798ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
5CDS-intronENST00000300619ENST00000474890ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
In-frameENST00000397082ENST00000263382ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
5CDS-intronENST00000397082ENST00000592798ZNF91chr19

23578127

-ASF1Bchr19

14232520

-
5CDS-intronENST00000397082ENST00000474890ZNF91chr19

23578127

-ASF1Bchr19

14232520

-

Top

FusionProtFeatures for ZNF91_ASF1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF91

Q05481

ASF1B

Q9NVP2

Transcription factor specifically required to repressSINE-VNTR-Alu (SVA) retrotransposons: recognizes and binds SVAsequences and represses their expression by recruiting arepressive complex containing TRIM28/KAP1 (PubMed:25274305). Mayalso bind the promoter of the FCGR2B gene, leading to repress itsexpression; however, additional evidences are required to confirmthis result in vivo (PubMed:11470777).{ECO:0000269|PubMed:25274305, ECO:0000305|PubMed:11470777}. Histone chaperone that facilitates histone depositionand histone exchange and removal during nucleosome assembly anddisassembly. Cooperates with chromatin assembly factor 1 (CAF-1)to promote replication-dependent chromatin assembly. Does notparticipate in replication-independent nucleosome deposition whichis mediated by ASF1A and HIRA. Required for spermatogenesis.{ECO:0000269|PubMed:11897662, ECO:0000269|PubMed:12842904,ECO:0000269|PubMed:14718166, ECO:0000269|PubMed:15664198,ECO:0000269|PubMed:16151251}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ZNF91_ASF1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF91_ENST00000599743_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_138aa
MPGTPGSLEMADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDN

>In-frame_ZNF91_ENST00000300619_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_138aa
MPGTPGSLEMADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDN

>In-frame_ZNF91_ENST00000397082_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_138aa
MPGTPGSLEMADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF91_ENST00000599743_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_414nt
ATGCCAGGAACCCCTGGAAGCCTAGAAATGGCCGACGCCCCCAACCCATCCCTCATCCCAGAGACTGATGCCGTGGGTGTGACTGTGGTC
CTCATCACCTGCACCTACCATGGACAGGAGTTCATCCGAGTGGGCTACTACGTCAACAACGAGTACCTCAACCCTGAGCTGCGTGAGAAC
CCGCCCATGAAGCCAGATTTCTCCCAGCTCCAGCGGAACATCTTGGCCTCGAACCCCCGGGTGACCCGCTTCCATATCAACTGGGACAAC
AACATGGACAGGCTGGAGGCCATAGAGACCCAGGACCCCTCCCTGGGCTGCGGCCTCCCACTCAACTGCACTCCTATCAAGGGCTTGGGG

>In-frame_ZNF91_ENST00000300619_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_414nt
ATGCCAGGAACCCCTGGAAGCCTAGAAATGGCCGACGCCCCCAACCCATCCCTCATCCCAGAGACTGATGCCGTGGGTGTGACTGTGGTC
CTCATCACCTGCACCTACCATGGACAGGAGTTCATCCGAGTGGGCTACTACGTCAACAACGAGTACCTCAACCCTGAGCTGCGTGAGAAC
CCGCCCATGAAGCCAGATTTCTCCCAGCTCCAGCGGAACATCTTGGCCTCGAACCCCCGGGTGACCCGCTTCCATATCAACTGGGACAAC
AACATGGACAGGCTGGAGGCCATAGAGACCCAGGACCCCTCCCTGGGCTGCGGCCTCCCACTCAACTGCACTCCTATCAAGGGCTTGGGG

>In-frame_ZNF91_ENST00000397082_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_414nt
ATGCCAGGAACCCCTGGAAGCCTAGAAATGGCCGACGCCCCCAACCCATCCCTCATCCCAGAGACTGATGCCGTGGGTGTGACTGTGGTC
CTCATCACCTGCACCTACCATGGACAGGAGTTCATCCGAGTGGGCTACTACGTCAACAACGAGTACCTCAACCCTGAGCTGCGTGAGAAC
CCGCCCATGAAGCCAGATTTCTCCCAGCTCCAGCGGAACATCTTGGCCTCGAACCCCCGGGTGACCCGCTTCCATATCAACTGGGACAAC
AACATGGACAGGCTGGAGGCCATAGAGACCCAGGACCCCTCCCTGGGCTGCGGCCTCCCACTCAACTGCACTCCTATCAAGGGCTTGGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF91_ENST00000599743_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_1467nt
CCGGAGTTTCCAGGTCTCGACTTCACTGCTCTGTGTCCTCTGCTCCAGGAGGCCCAGCCTGTGTGGCCCTGTGACCTGCAGGTATTGGAG
AGCCACAGCTAAGATGCCAGGAACCCCTGGAAGCCTAGAAATGGCCGACGCCCCCAACCCATCCCTCATCCCAGAGACTGATGCCGTGGG
TGTGACTGTGGTCCTCATCACCTGCACCTACCATGGACAGGAGTTCATCCGAGTGGGCTACTACGTCAACAACGAGTACCTCAACCCTGA
GCTGCGTGAGAACCCGCCCATGAAGCCAGATTTCTCCCAGCTCCAGCGGAACATCTTGGCCTCGAACCCCCGGGTGACCCGCTTCCATAT
CAACTGGGACAACAACATGGACAGGCTGGAGGCCATAGAGACCCAGGACCCCTCCCTGGGCTGCGGCCTCCCACTCAACTGCACTCCTAT
CAAGGGCTTGGGGCTCCCTGGCTGCATCCCTGGCCTCCTCCCTGAGAACTCCATGGACTGCATCTAACTGCAGGAACCCAGAGTGTCCCA
GCACGCCGGGAGGGGCAACCAGGCCTCCCAGCGAGTCCTGCAGGGCCCATCTAGAGGACTTTGGGGGCCATCAGCTGCAATCCAGGTCTG
TCAAACTCAGCCCCTAGGAAAGAACAGGCCTTGGGTCTCCCCTAGTCCTGGCCAGAAGGATGATCTCGCTTTTCCTCTACAGGCCTATAA
GAAGCAGGTACTTCAGTTCTAAATTCTGACTTGTGTTCTTTTCGTCTTCATAAATTCTAACTAAGGCCACTGTGCCACTGTGCACCCTTG
AGTACCATTGATCCAAAGCTTTCCCACAGACCTCCCTGGCCCACCTAGAGGCTTTCTTGGTCAGTGCCTGTCAAGGCTCCAGTCCTGCTG
AGCCAAAGGCTTTGTCATTCCTTTCTCTTCCTGTACATCTGAGCAGACCCACTCCAGCTTTCTGGTGTCACAGGCGGGAATGTTAGTTAG
TAGGTAGACTTAGATCCCATTTCTGTCCTGCTCCCAGGAAGATTCTTAGGTCCTCTTCAATCCAGCAGCCCCTCCCAGAGGTGTGATCAG
CAGGATGCTGAGGAACCATGTTGCCTTTCCTGTCAATCACAGCCACCTTCCTGTTATCTCCTAAATGGATCTGGCTTTTCCTGGAGGCTG
CCATGGTTGGAAGATGGTATCAGAGGGCCTGCCTGGGCAGTCTGTCTCCGGGCCAGGGTCAGGGACCCTCTGCCTCTGGCAGCCTTAACC
TGTCCTCTGCTAGGACCAGGGTGATTTCAAGCCAGGGAAGCAACTGGGACCCTGAAAACTGTCCCTCCCCAGCCCGCTCCCCCTCTCTGT
GCCCTGGTCCCCTTGCTGCCATGTGGATGCTGTTGTGATTGCTGTTTGTATATTATCAAAATGTTTTTATATTAAAAATGTTTGGTCTGA

>In-frame_ZNF91_ENST00000300619_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_1570nt
ATCTAATCAGGGACGCTGGGCTGGGAACTGTCCAATCAGGCACAAAGCTGGAGCGGACAGGGCGGCTTCCGGGATGTGGCTGGGCCTTTG
TCTCTCGCTGCCGCCGGAGTTTCCAGGTCTCGACTTCACTGCTCTGTGTCCTCTGCTCCAGGAGGCCCAGCCTGTGTGGCCCTGTGACCT
GCAGGTATTGGAGAGCCACAGCTAAGATGCCAGGAACCCCTGGAAGCCTAGAAATGGCCGACGCCCCCAACCCATCCCTCATCCCAGAGA
CTGATGCCGTGGGTGTGACTGTGGTCCTCATCACCTGCACCTACCATGGACAGGAGTTCATCCGAGTGGGCTACTACGTCAACAACGAGT
ACCTCAACCCTGAGCTGCGTGAGAACCCGCCCATGAAGCCAGATTTCTCCCAGCTCCAGCGGAACATCTTGGCCTCGAACCCCCGGGTGA
CCCGCTTCCATATCAACTGGGACAACAACATGGACAGGCTGGAGGCCATAGAGACCCAGGACCCCTCCCTGGGCTGCGGCCTCCCACTCA
ACTGCACTCCTATCAAGGGCTTGGGGCTCCCTGGCTGCATCCCTGGCCTCCTCCCTGAGAACTCCATGGACTGCATCTAACTGCAGGAAC
CCAGAGTGTCCCAGCACGCCGGGAGGGGCAACCAGGCCTCCCAGCGAGTCCTGCAGGGCCCATCTAGAGGACTTTGGGGGCCATCAGCTG
CAATCCAGGTCTGTCAAACTCAGCCCCTAGGAAAGAACAGGCCTTGGGTCTCCCCTAGTCCTGGCCAGAAGGATGATCTCGCTTTTCCTC
TACAGGCCTATAAGAAGCAGGTACTTCAGTTCTAAATTCTGACTTGTGTTCTTTTCGTCTTCATAAATTCTAACTAAGGCCACTGTGCCA
CTGTGCACCCTTGAGTACCATTGATCCAAAGCTTTCCCACAGACCTCCCTGGCCCACCTAGAGGCTTTCTTGGTCAGTGCCTGTCAAGGC
TCCAGTCCTGCTGAGCCAAAGGCTTTGTCATTCCTTTCTCTTCCTGTACATCTGAGCAGACCCACTCCAGCTTTCTGGTGTCACAGGCGG
GAATGTTAGTTAGTAGGTAGACTTAGATCCCATTTCTGTCCTGCTCCCAGGAAGATTCTTAGGTCCTCTTCAATCCAGCAGCCCCTCCCA
GAGGTGTGATCAGCAGGATGCTGAGGAACCATGTTGCCTTTCCTGTCAATCACAGCCACCTTCCTGTTATCTCCTAAATGGATCTGGCTT
TTCCTGGAGGCTGCCATGGTTGGAAGATGGTATCAGAGGGCCTGCCTGGGCAGTCTGTCTCCGGGCCAGGGTCAGGGACCCTCTGCCTCT
GGCAGCCTTAACCTGTCCTCTGCTAGGACCAGGGTGATTTCAAGCCAGGGAAGCAACTGGGACCCTGAAAACTGTCCCTCCCCAGCCCGC
TCCCCCTCTCTGTGCCCTGGTCCCCTTGCTGCCATGTGGATGCTGTTGTGATTGCTGTTTGTATATTATCAAAATGTTTTTATATTAAAA

>In-frame_ZNF91_ENST00000397082_chr19_23578127_-_ASF1B_ENST00000263382_chr19_14232520_-_1456nt
AGGTCTCGACTTCACTGCTCTGTGTCCTCTGCTCCAGGAGGCCCAGCCTGTGTGGCCCTGTGACCTGCAGGTATTGGAGAGCCACAGCTA
AGATGCCAGGAACCCCTGGAAGCCTAGAAATGGCCGACGCCCCCAACCCATCCCTCATCCCAGAGACTGATGCCGTGGGTGTGACTGTGG
TCCTCATCACCTGCACCTACCATGGACAGGAGTTCATCCGAGTGGGCTACTACGTCAACAACGAGTACCTCAACCCTGAGCTGCGTGAGA
ACCCGCCCATGAAGCCAGATTTCTCCCAGCTCCAGCGGAACATCTTGGCCTCGAACCCCCGGGTGACCCGCTTCCATATCAACTGGGACA
ACAACATGGACAGGCTGGAGGCCATAGAGACCCAGGACCCCTCCCTGGGCTGCGGCCTCCCACTCAACTGCACTCCTATCAAGGGCTTGG
GGCTCCCTGGCTGCATCCCTGGCCTCCTCCCTGAGAACTCCATGGACTGCATCTAACTGCAGGAACCCAGAGTGTCCCAGCACGCCGGGA
GGGGCAACCAGGCCTCCCAGCGAGTCCTGCAGGGCCCATCTAGAGGACTTTGGGGGCCATCAGCTGCAATCCAGGTCTGTCAAACTCAGC
CCCTAGGAAAGAACAGGCCTTGGGTCTCCCCTAGTCCTGGCCAGAAGGATGATCTCGCTTTTCCTCTACAGGCCTATAAGAAGCAGGTAC
TTCAGTTCTAAATTCTGACTTGTGTTCTTTTCGTCTTCATAAATTCTAACTAAGGCCACTGTGCCACTGTGCACCCTTGAGTACCATTGA
TCCAAAGCTTTCCCACAGACCTCCCTGGCCCACCTAGAGGCTTTCTTGGTCAGTGCCTGTCAAGGCTCCAGTCCTGCTGAGCCAAAGGCT
TTGTCATTCCTTTCTCTTCCTGTACATCTGAGCAGACCCACTCCAGCTTTCTGGTGTCACAGGCGGGAATGTTAGTTAGTAGGTAGACTT
AGATCCCATTTCTGTCCTGCTCCCAGGAAGATTCTTAGGTCCTCTTCAATCCAGCAGCCCCTCCCAGAGGTGTGATCAGCAGGATGCTGA
GGAACCATGTTGCCTTTCCTGTCAATCACAGCCACCTTCCTGTTATCTCCTAAATGGATCTGGCTTTTCCTGGAGGCTGCCATGGTTGGA
AGATGGTATCAGAGGGCCTGCCTGGGCAGTCTGTCTCCGGGCCAGGGTCAGGGACCCTCTGCCTCTGGCAGCCTTAACCTGTCCTCTGCT
AGGACCAGGGTGATTTCAAGCCAGGGAAGCAACTGGGACCCTGAAAACTGTCCCTCCCCAGCCCGCTCCCCCTCTCTGTGCCCTGGTCCC
CTTGCTGCCATGTGGATGCTGTTGTGATTGCTGTTTGTATATTATCAAAATGTTTTTATATTAAAAATGTTTGGTCTGAAAATTAAAAGC


Top

FusionGenePPI for ZNF91_ASF1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF91NDEL1, ELAVL1, CHMP5, TRIM44ASF1BTLK1, IPO4, CDAN1, TLK2, CHAF1B, RPS3A, DOK2, C15orf41, MMS22L, RBBP4, CHAF1A, TTN, TONSL, HIST1H3F, UBXN1, DYNLL1, PSPH, RPL31, MRPS7, HCFC1, HIRA, HIST3H3, HIST4H4, HAT1, RBBP7, HIST1H3A, H3F3A, MCM2, MCM6, HIST1H3E, ASF1A, HIST1H3C, KHSRP, IDH1, MOV10, NXF1, MCM3, MCM4, MCM5, MCM7, NASP, STAT5B, CABIN1, UBN1, UBN2, PAN3, PAN2, PPTC7, RIF1, HIST1H4A, HIST2H4A, RCVRN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF91_ASF1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF91_ASF1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource