FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4361

FusionGeneSummary for BRAF_FAM114A2

check button Fusion gene summary
Fusion gene informationFusion gene name: BRAF_FAM114A2
Fusion gene ID: 4361
HgeneTgene
Gene symbol

BRAF

FAM114A2

Gene ID

673

10827

Gene nameB-Raf proto-oncogene, serine/threonine kinasefamily with sequence similarity 114 member A2
SynonymsB-RAF1|B-raf|BRAF1|NS7|RAFB1133K02|C5orf3
Cytomap

7q34

5q33.2

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase B-raf94 kDa B-raf proteinB-Raf proto-oncogene serine/threonine-protein kinase (p94)B-Raf serine/threonine-proteinmurine sarcoma viral (v-raf) oncogene homolog B1proto-oncogene B-Rafv-raf murine sarcoma viral oncogene protein FAM114A2testis tissue sperm-binding protein Li 81P
Modification date2018052720180519
UniProtAcc

P15056

Q9NRY5

Ensembl transtripts involved in fusion geneENST00000288602, ENST00000351797, 
ENST00000522858, ENST00000520667, 
ENST00000518946, ENST00000520313, 
Fusion gene scores* DoF score18 X 12 X 10=21603 X 3 X 3=27
# samples 223
** MAII scorelog2(22/2160*10)=-3.29545588352617
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: BRAF [Title/Abstract] AND FAM114A2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBRAF

GO:0006468

protein phosphorylation

17563371

HgeneBRAF

GO:0010828

positive regulation of glucose transmembrane transport

23010278

HgeneBRAF

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

HgeneBRAF

GO:0043066

negative regulation of apoptotic process

19667065

HgeneBRAF

GO:0070374

positive regulation of ERK1 and ERK2 cascade

22065586

HgeneBRAF

GO:0071277

cellular response to calcium ion

18567582

HgeneBRAF

GO:0090150

establishment of protein localization to membrane

23010278


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHCATCGA-ET-A3BN-01ABRAFchr7

140482821

-FAM114A2chr5

153382529

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000288602ENST00000351797BRAFchr7

140482821

-FAM114A2chr5

153382529

-
In-frameENST00000288602ENST00000522858BRAFchr7

140482821

-FAM114A2chr5

153382529

-
In-frameENST00000288602ENST00000520667BRAFchr7

140482821

-FAM114A2chr5

153382529

-
5CDS-intronENST00000288602ENST00000518946BRAFchr7

140482821

-FAM114A2chr5

153382529

-
5CDS-intronENST00000288602ENST00000520313BRAFchr7

140482821

-FAM114A2chr5

153382529

-

Top

FusionProtFeatures for BRAF_FAM114A2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BRAF

P15056

FAM114A2

Q9NRY5


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBRAFchr7:140482821chr5:153382529ENST00000288602-1018122_129438767Compositional biasNote=Poly-Ser
HgeneBRAFchr7:140482821chr5:153382529ENST00000288602-1018428_432438767Compositional biasNote=Poly-Ser
HgeneBRAFchr7:140482821chr5:153382529ENST00000288602-10186_11438767Compositional biasNote=Poly-Gly
HgeneBRAFchr7:140482821chr5:153382529ENST00000288602-1018155_227438767DomainRBD
HgeneBRAFchr7:140482821chr5:153382529ENST00000288602-1018234_280438767Zinc fingerPhorbol-ester/DAG-type

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBRAFchr7:140482821chr5:153382529ENST00000288602-1018457_717438767DomainProtein kinase
HgeneBRAFchr7:140482821chr5:153382529ENST00000288602-1018463_471438767Nucleotide bindingATP
TgeneFAM114A2chr7:140482821chr5:153382529ENST00000351797-814268_295331506Coiled coilOntology_term=ECO:0000255
TgeneFAM114A2chr7:140482821chr5:153382529ENST00000520667-915268_295331506Coiled coilOntology_term=ECO:0000255
TgeneFAM114A2chr7:140482821chr5:153382529ENST00000522858-814268_295331506Coiled coilOntology_term=ECO:0000255
TgeneFAM114A2chr7:140482821chr5:153382529ENST00000351797-814297_302331506Compositional biasNote=Poly-Glu
TgeneFAM114A2chr7:140482821chr5:153382529ENST00000520667-915297_302331506Compositional biasNote=Poly-Glu
TgeneFAM114A2chr7:140482821chr5:153382529ENST00000522858-814297_302331506Compositional biasNote=Poly-Glu


Top

FusionGeneSequence for BRAF_FAM114A2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000351797_chr5_153382529_-_613aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSITLEATEEYTSKLD
ALQQREQQLLESLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGTKFHQ
RCSTEVPLMCVNTDQLDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR
DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMARNTAHEWIRKS
LTKPLAENEEGEKQSEAENTEQVNKNSIEDIHAFAIRSLAELTACSIELFHKTAALVLHGRKQEVTAIERSQTLSQMTIVLCKELSSLSK

>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000522858_chr5_153382529_-_613aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSITLEATEEYTSKLD
ALQQREQQLLESLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGTKFHQ
RCSTEVPLMCVNTDQLDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR
DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMARNTAHEWIRKS
LTKPLAENEEGEKQSEAENTEQVNKNSIEDIHAFAIRSLAELTACSIELFHKTAALVLHGRKQEVTAIERSQTLSQMTIVLCKELSSLSK

>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000520667_chr5_153382529_-_613aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSITLEATEEYTSKLD
ALQQREQQLLESLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGTKFHQ
RCSTEVPLMCVNTDQLDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR
DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMARNTAHEWIRKS
LTKPLAENEEGEKQSEAENTEQVNKNSIEDIHAFAIRSLAELTACSIELFHKTAALVLHGRKQEVTAIERSQTLSQMTIVLCKELSSLSK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000351797_chr5_153382529_-_1839nt
ATGGCGGCGCTGAGCGGTGGCGGTGGTGGCGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGC
GCCGGCGCCGCGGCCTCTTCGGCTGCGGACCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACAT
ATAGAGGCCCTATTGGACAAATTTGGTGGGGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGAT
GCACTCCAACAAAGAGAACAACAGTTATTGGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTT
ACATCTTCTTCCTCTTCTAGCCTTTCAGTGCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAG
TCACCACAAAAACCTATCGTTAGAGTCTTCCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGT
CTAAAGAAAGCACTGATGATGAGAGGTCTAATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGG
GACACTGATATTTCCTGGCTTACTGGAGAAGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAA
ACGTTTTTCACCTTAGCATTTTGTGACTTTTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAG
CGTTGTAGTACAGAAGTTCCACTGATGTGTGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATA
CCACAGGAAGAGGCGTCCTTAGCAGAGACTGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATT
CTCACCAGTCCGTCTCCTTCAAAATCCATTCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGA
GACCGATCCTCATCAGCTCCCAATGTGCATATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGT
GATGGAGGATCAACCACAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCA
GGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGGCAAGAAATACCGCCCACGAATGGATCAGGAAGTCT
CTGACCAAGCCATTAGCAGAGAATGAAGAAGGAGAAAAACAGTCGGAAGCAGAAAATACTGAGCAAGTCAACAAAAATTCAATAGAGGAT
ATCCATGCGTTTGCAATCCGGAGCCTGGCTGAACTGACTGCCTGCTCAATTGAACTATTCCACAAAACAGCTGCATTGGTTCTGCATGGC
AGGAAGCAGGAAGTGACAGCCATAGAAAGGAGCCAAACTCTTTCCCAGATGACAATTGTGTTGTGTAAAGAGTTGTCCTCTCTGTCTAAA
GAGTTCACTACCTGCCTAACAACTGCTGGGGTCAAAGAAATGGCAGATGTCCTTAACCCATTAATCACTGCAGTATTTCTAGAGGCATCA
AACAGTGCCTCCTACATCCAGGACGCCTTTCAGCTACTCTTACCTGTGCTAGAGATCTCTCTCATTGAGAACAAGATTGAATCACACAGA

>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000522858_chr5_153382529_-_1839nt
ATGGCGGCGCTGAGCGGTGGCGGTGGTGGCGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGC
GCCGGCGCCGCGGCCTCTTCGGCTGCGGACCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACAT
ATAGAGGCCCTATTGGACAAATTTGGTGGGGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGAT
GCACTCCAACAAAGAGAACAACAGTTATTGGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTT
ACATCTTCTTCCTCTTCTAGCCTTTCAGTGCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAG
TCACCACAAAAACCTATCGTTAGAGTCTTCCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGT
CTAAAGAAAGCACTGATGATGAGAGGTCTAATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGG
GACACTGATATTTCCTGGCTTACTGGAGAAGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAA
ACGTTTTTCACCTTAGCATTTTGTGACTTTTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAG
CGTTGTAGTACAGAAGTTCCACTGATGTGTGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATA
CCACAGGAAGAGGCGTCCTTAGCAGAGACTGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATT
CTCACCAGTCCGTCTCCTTCAAAATCCATTCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGA
GACCGATCCTCATCAGCTCCCAATGTGCATATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGT
GATGGAGGATCAACCACAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCA
GGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGGCAAGAAATACCGCCCACGAATGGATCAGGAAGTCT
CTGACCAAGCCATTAGCAGAGAATGAAGAAGGAGAAAAACAGTCGGAAGCAGAAAATACTGAGCAAGTCAACAAAAATTCAATAGAGGAT
ATCCATGCGTTTGCAATCCGGAGCCTGGCTGAACTGACTGCCTGCTCAATTGAACTATTCCACAAAACAGCTGCATTGGTTCTGCATGGC
AGGAAGCAGGAAGTGACAGCCATAGAAAGGAGCCAAACTCTTTCCCAGATGACAATTGTGTTGTGTAAAGAGTTGTCCTCTCTGTCTAAA
GAGTTCACTACCTGCCTAACAACTGCTGGGGTCAAAGAAATGGCAGATGTCCTTAACCCATTAATCACTGCAGTATTTCTAGAGGCATCA
AACAGTGCCTCCTACATCCAGGACGCCTTTCAGCTACTCTTACCTGTGCTAGAGATCTCTCTCATTGAGAACAAGATTGAATCACACAGA

>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000520667_chr5_153382529_-_1839nt
ATGGCGGCGCTGAGCGGTGGCGGTGGTGGCGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGC
GCCGGCGCCGCGGCCTCTTCGGCTGCGGACCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACAT
ATAGAGGCCCTATTGGACAAATTTGGTGGGGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGAT
GCACTCCAACAAAGAGAACAACAGTTATTGGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTT
ACATCTTCTTCCTCTTCTAGCCTTTCAGTGCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAG
TCACCACAAAAACCTATCGTTAGAGTCTTCCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGT
CTAAAGAAAGCACTGATGATGAGAGGTCTAATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGG
GACACTGATATTTCCTGGCTTACTGGAGAAGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAA
ACGTTTTTCACCTTAGCATTTTGTGACTTTTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAG
CGTTGTAGTACAGAAGTTCCACTGATGTGTGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATA
CCACAGGAAGAGGCGTCCTTAGCAGAGACTGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATT
CTCACCAGTCCGTCTCCTTCAAAATCCATTCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGA
GACCGATCCTCATCAGCTCCCAATGTGCATATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGT
GATGGAGGATCAACCACAGGTTTGTCTGCTACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCA
GGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGGCAAGAAATACCGCCCACGAATGGATCAGGAAGTCT
CTGACCAAGCCATTAGCAGAGAATGAAGAAGGAGAAAAACAGTCGGAAGCAGAAAATACTGAGCAAGTCAACAAAAATTCAATAGAGGAT
ATCCATGCGTTTGCAATCCGGAGCCTGGCTGAACTGACTGCCTGCTCAATTGAACTATTCCACAAAACAGCTGCATTGGTTCTGCATGGC
AGGAAGCAGGAAGTGACAGCCATAGAAAGGAGCCAAACTCTTTCCCAGATGACAATTGTGTTGTGTAAAGAGTTGTCCTCTCTGTCTAAA
GAGTTCACTACCTGCCTAACAACTGCTGGGGTCAAAGAAATGGCAGATGTCCTTAACCCATTAATCACTGCAGTATTTCTAGAGGCATCA
AACAGTGCCTCCTACATCCAGGACGCCTTTCAGCTACTCTTACCTGTGCTAGAGATCTCTCTCATTGAGAACAAGATTGAATCACACAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000351797_chr5_153382529_-_4748nt
CGCCTCCCTTCCCCCTCCCCGCCCGACAGCGGCCGCTCGGGCCCCGGCTCTCGGTTATAAGATGGCGGCGCTGAGCGGTGGCGGTGGTGG
CGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGCGCCGGCGCCGCGGCCTCTTCGGCTGCGGA
CCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACATATAGAGGCCCTATTGGACAAATTTGGTGG
GGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGATGCACTCCAACAAAGAGAACAACAGTTATT
GGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTTACATCTTCTTCCTCTTCTAGCCTTTCAGT
GCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAGTCACCACAAAAACCTATCGTTAGAGTCTT
CCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGTCTAAAGAAAGCACTGATGATGAGAGGTCT
AATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGGGACACTGATATTTCCTGGCTTACTGGAGA
AGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAAACGTTTTTCACCTTAGCATTTTGTGACTT
TTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAGCGTTGTAGTACAGAAGTTCCACTGATGTG
TGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATACCACAGGAAGAGGCGTCCTTAGCAGAGAC
TGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATTCTCACCAGTCCGTCTCCTTCAAAATCCAT
TCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGAGACCGATCCTCATCAGCTCCCAATGTGCA
TATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGC
TACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTC
ATCCTCAGAAGACAGGAATCGAATGGCAAGAAATACCGCCCACGAATGGATCAGGAAGTCTCTGACCAAGCCATTAGCAGAGAATGAAGA
AGGAGAAAAACAGTCGGAAGCAGAAAATACTGAGCAAGTCAACAAAAATTCAATAGAGGATATCCATGCGTTTGCAATCCGGAGCCTGGC
TGAACTGACTGCCTGCTCAATTGAACTATTCCACAAAACAGCTGCATTGGTTCTGCATGGCAGGAAGCAGGAAGTGACAGCCATAGAAAG
GAGCCAAACTCTTTCCCAGATGACAATTGTGTTGTGTAAAGAGTTGTCCTCTCTGTCTAAAGAGTTCACTACCTGCCTAACAACTGCTGG
GGTCAAAGAAATGGCAGATGTCCTTAACCCATTAATCACTGCAGTATTTCTAGAGGCATCAAACAGTGCCTCCTACATCCAGGACGCCTT
TCAGCTACTCTTACCTGTGCTAGAGATCTCTCTCATTGAGAACAAGATTGAATCACACAGACATGAGCTGCAGGGCCAGAAACCTTTGTT
AGAACATTGAAGAATGGAGACGTTTTGACCTGGGACTTGTGACGGCCAAGGAATGCCACCTTATTCTGGCTACTCCTGCAGAAATGAAGG
AGTGGGGTTATTTTAGTATATAAAAATTCAGGCAGGAGAGATGGTTTAAAGAGGAAGATTGTTGCCTTCAGTGTTTGATTGAAGTATTCA
GGTTCTCACAGTATTCTTTCCAGTTGTTGTAATTCATAAATTATTTGAAAAGAAACTTTTGTAGAAAGTCCAAGAATAATAACTCTAGAT
AAAGATTAGTGGGACACTCAGGCAAAAATGTTGGTCTTTCTTTGACATGTTGCAAAATGTTATCAATTTTGTCATGGATATAATTTGCAG
CCCATGGATATAACTGGTTGATAAGCCAGAGAAAAATAATTTAGTGTTCTAAAATTCATGGCATGTGTGGTTTATTAATGCCATGTACTT
TCTCCTTTCTGGAATAAAATCTATGGCTTTAAGAAAACTGAGCATATGTAAACTCTGTGATGATTACCCTTTATCACATGAATTCTTGGA
AATAGAAAGTTTCATCTGCTTTTTTAAATTCTTAGTAGATATTTGGCATTGAGGAGAAACTTGTAGACTATTATAGCCATGTGAATTAAC
TGTAGCAAAGTGCCCTTTTTCTTCAAATTGCTCCCCCTCCCCAGGATGACACACTTCATGTCATAGCTGAACCCTACTCTACTGGATTCA
AGGCCAGTAAATGCAATTTAGAGAAGCAGTTTTATGTTTGCAGATATTCTGAGTCTCTTCAGGATGTGTTTCGTGTCTACCATATATGCA
GGATAAATTCTTTAACAGCAAACTCCAAAGGAATGTTGAAGCTGTTTTAGCAATGAGGATTTTTTTGTTTGAGTGTTGAAGTGGGCCATA
GTCCTTTAGAAATGATGTTCATTTATGATAGGATTTAACTTCTAAGGCATAGTTTATTTTTTCCTCTTTCCTTTTTGTTTGTTTTAATGT
ATTCTTTAGCATGTTTTTGATATAACTTTTATCCTCCAGATCTTAAGCTTTCTTTTGCTCTCTTCAGCAATTTAAGAGACTATTAAGCTG
TCGTCTTCCTAAAAGCTATTTTGGTATCCACTCTTTTTAAAAAAATTCTCCAACTTTGTGGTTTTTTAATGATTAAGGTAATTTGTTAGC
TCTGCCCCTCATCTTCTAAAACCTTTGTAATAAAATGTATTAATCATGTTATTTGATCCTTTCATTTACTTTTGTAAACACGAGCCCTAA
TATCTTACTTAGACCAAAAAAAAAAAAAAAAAATAGCAAAGCAAAGCCATAACATAGATTAGTATAAAGACTGTTTCTACGTAATCTTCT
TTGGGGCAGGAGTCAGTTAGTAAGCAAGGAAGAGAAATAAATTTGGTTTAAAAAGGTATACCAACAGCACTACAATGTTACTCTGCCTAT
ATTCTGTCTTAATATGATCAGAAAGTTTTTGAATATTCCTTTTTAAAGACAAATTTCACCCTTTCCAGCTTGAATATTTCTGAAGTTTCA
GAAAAACAGTTGCCTTCTGGTTACAAAGGCTGGTGTCACCAGTTCTGAATTGTTGCCTCAAGCTTGGTTGATGTGTCTGAACCTGTATCC
CTTGAGGGCAAAGTTTAGAAACTGGTCACTCTGCCTACTGTCTGTTCAGCCTCTTGTACAATGGCAGTTTGGCAGCTTTAAATCCTTAAC
CTAGAAATGTATTTAAGGTTTTTCTTTCAAGAAATGGGGTATACATATGAAGGAGAGAGTAACAACTCTTTTTATACACCTATTCAGATT
TCAGCCCTGAATTTGGCAAATTTTAGATTAGGTCTCACATAAGGTAAATATGACTCACTAACTCTTTTTTTCTCATCTTCCCCACCCCCC
CATATATATTTATTTATTTTAATGGAGTTAGGGACCACTAGTGAAATGATGAAAGGCCCAATTCTGAGTAACAATTGTCTACTCTTCACA
TAAAATATACTGAAAAAGAATTAAGATTCCTTGATCCAGTAGACATAGAGAAACATAAACATTCATGACAGATGAGTAGGTAAATTCAGG
GATCACTTTGGAACTTGCTGGATTATGGTGATGGTTTTTGGATAGTATGTGCTTCATTATTTTATTTGGGGTAGTTACAGTGTTTTAGTT
TTTTGTTAACAGCTACACTTTTGGTACTATTTTCCTTTTAAATTTTTGGTGTCTAAGATTTACCACTAATTACTAATATATGCCTTTCCA
ATTCACTTAAAACCTTAATAAGTGAAATGTTCAGGTATTGCTAGGGTAAATGTGTCTTTTCCTACTATTGAGATTTTAAAAGGCTGTGAT
TAAGAGAGACTTTATTAATTTGATCTGAAAGAAGTAGAAACCTCTATGAAACAATTTTTATTTTCCTTTGCATAATACCTTAGAAATGTG
TTAAGGACAAGCTATATTTTCCTTACTTGCTTTTGATAGTTTTTTTTTTTTTTTTTAAGCATAGATATCCAGGTTGGCAGGCCTCTGAAA
TGTGAAATTGTAATTTTTATAGATGGCATTACTATGAATCTGAAATCAGTGCTAGGTGTACAAATGTGAATTTTTCAATCCTGTAATCAA
AGAACAAGATCTTGTGGGTTCCTACTGCTGAAAAAGGATGCTTTCTTTTGTACTTGTTTTTAGTGAAAGACCTTTTTGAGGGAGAGCTAT
TTTATAGGTAGTTGCTATTGATATCTCCATTTGAGAAATAGACATTTTTCTGTATTTCTAGAGGTGTTCTGAATTTTAAACCTGAATTCT

>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000522858_chr5_153382529_-_3173nt
CGCCTCCCTTCCCCCTCCCCGCCCGACAGCGGCCGCTCGGGCCCCGGCTCTCGGTTATAAGATGGCGGCGCTGAGCGGTGGCGGTGGTGG
CGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGCGCCGGCGCCGCGGCCTCTTCGGCTGCGGA
CCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACATATAGAGGCCCTATTGGACAAATTTGGTGG
GGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGATGCACTCCAACAAAGAGAACAACAGTTATT
GGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTTACATCTTCTTCCTCTTCTAGCCTTTCAGT
GCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAGTCACCACAAAAACCTATCGTTAGAGTCTT
CCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGTCTAAAGAAAGCACTGATGATGAGAGGTCT
AATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGGGACACTGATATTTCCTGGCTTACTGGAGA
AGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAAACGTTTTTCACCTTAGCATTTTGTGACTT
TTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAGCGTTGTAGTACAGAAGTTCCACTGATGTG
TGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATACCACAGGAAGAGGCGTCCTTAGCAGAGAC
TGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATTCTCACCAGTCCGTCTCCTTCAAAATCCAT
TCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGAGACCGATCCTCATCAGCTCCCAATGTGCA
TATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGC
TACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTC
ATCCTCAGAAGACAGGAATCGAATGGCAAGAAATACCGCCCACGAATGGATCAGGAAGTCTCTGACCAAGCCATTAGCAGAGAATGAAGA
AGGAGAAAAACAGTCGGAAGCAGAAAATACTGAGCAAGTCAACAAAAATTCAATAGAGGATATCCATGCGTTTGCAATCCGGAGCCTGGC
TGAACTGACTGCCTGCTCAATTGAACTATTCCACAAAACAGCTGCATTGGTTCTGCATGGCAGGAAGCAGGAAGTGACAGCCATAGAAAG
GAGCCAAACTCTTTCCCAGATGACAATTGTGTTGTGTAAAGAGTTGTCCTCTCTGTCTAAAGAGTTCACTACCTGCCTAACAACTGCTGG
GGTCAAAGAAATGGCAGATGTCCTTAACCCATTAATCACTGCAGTATTTCTAGAGGCATCAAACAGTGCCTCCTACATCCAGGACGCCTT
TCAGCTACTCTTACCTGTGCTAGAGATCTCTCTCATTGAGAACAAGATTGAATCACACAGACATGAGCTGCAGGGCCAGAAACCTTTGTT
AGAACATTGAAGAATGGAGACGTTTTGACCTGGGACTTGTGACGGCCAAGGAATGCCACCTTATTCTGGCTACTCCTGCAGAAATGAAGG
AGTGGGGTTATTTTAGTATATAAAAATTCAGGCAGGAGAGATGGTTTAAAGAGGAAGATTGTTGCCTTCAGTGTTTGATTGAAGTATTCA
GGTTCTCACAGTATTCTTTCCAGTTGTTGTAATTCATAAATTATTTGAAAAGAAACTTTTGTAGAAAGTCCAAGAATAATAACTCTAGAT
AAAGATTAGTGGGACACTCAGGCAAAAATGTTGGTCTTTCTTTGACATGTTGCAAAATGTTATCAATTTTGTCATGGATATAATTTGCAG
CCCATGGATATAACTGGTTGATAAGCCAGAGAAAAATAATTTAGTGTTCTAAAATTCATGGCATGTGTGGTTTATTAATGCCATGTACTT
TCTCCTTTCTGGAATAAAATCTATGGCTTTAAGAAAACTGAGCATATGTAAACTCTGTGATGATTACCCTTTATCACATGAATTCTTGGA
AATAGAAAGTTTCATCTGCTTTTTTAAATTCTTAGTAGATATTTGGCATTGAGGAGAAACTTGTAGACTATTATAGCCATGTGAATTAAC
TGTAGCAAAGTGCCCTTTTTCTTCAAATTGCTCCCCCTCCCCAGGATGACACACTTCATGTCATAGCTGAACCCTACTCTACTGGATTCA
AGGCCAGTAAATGCAATTTAGAGAAGCAGTTTTATGTTTGCAGATATTCTGAGTCTCTTCAGGATGTGTTTCGTGTCTACCATATATGCA
GGATAAATTCTTTAACAGCAAACTCCAAAGGAATGTTGAAGCTGTTTTAGCAATGAGGATTTTTTTGTTTGAGTGTTGAAGTGGGCCATA
GTCCTTTAGAAATGATGTTCATTTATGATAGGATTTAACTTCTAAGGCATAGTTTATTTTTTCCTCTTTCCTTTTTGTTTGTTTTAATGT
ATTCTTTAGCATGTTTTTGATATAACTTTTATCCTCCAGATCTTAAGCTTTCTTTTGCTCTCTTCAGCAATTTAAGAGACTATTAAGCTG
TCGTCTTCCTAAAAGCTATTTTGGTATCCACTCTTTTTAAAAAAATTCTCCAACTTTGTGGTTTTTTAATGATTAAGGTAATTTGTTAGC
TCTGCCCCTCATCTTCTAAAACCTTTGTAATAAAATGTATTAATCATGTTATTTGATCCTTTCATTTACTTTTGTAAACACGAGCCCTAA

>In-frame_BRAF_ENST00000288602_chr7_140482821_-_FAM114A2_ENST00000520667_chr5_153382529_-_2377nt
CGCCTCCCTTCCCCCTCCCCGCCCGACAGCGGCCGCTCGGGCCCCGGCTCTCGGTTATAAGATGGCGGCGCTGAGCGGTGGCGGTGGTGG
CGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGCGCCGGCGCCGCGGCCTCTTCGGCTGCGGA
CCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACATATAGAGGCCCTATTGGACAAATTTGGTGG
GGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGATGCACTCCAACAAAGAGAACAACAGTTATT
GGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTTACATCTTCTTCCTCTTCTAGCCTTTCAGT
GCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAGTCACCACAAAAACCTATCGTTAGAGTCTT
CCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGTCTAAAGAAAGCACTGATGATGAGAGGTCT
AATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGGGACACTGATATTTCCTGGCTTACTGGAGA
AGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAAACGTTTTTCACCTTAGCATTTTGTGACTT
TTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAGCGTTGTAGTACAGAAGTTCCACTGATGTG
TGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATACCACAGGAAGAGGCGTCCTTAGCAGAGAC
TGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATTCTCACCAGTCCGTCTCCTTCAAAATCCAT
TCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGAGACCGATCCTCATCAGCTCCCAATGTGCA
TATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGC
TACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCAGGACCTCAGCGAGAAAGGAAGTCATCTTC
ATCCTCAGAAGACAGGAATCGAATGGCAAGAAATACCGCCCACGAATGGATCAGGAAGTCTCTGACCAAGCCATTAGCAGAGAATGAAGA
AGGAGAAAAACAGTCGGAAGCAGAAAATACTGAGCAAGTCAACAAAAATTCAATAGAGGATATCCATGCGTTTGCAATCCGGAGCCTGGC
TGAACTGACTGCCTGCTCAATTGAACTATTCCACAAAACAGCTGCATTGGTTCTGCATGGCAGGAAGCAGGAAGTGACAGCCATAGAAAG
GAGCCAAACTCTTTCCCAGATGACAATTGTGTTGTGTAAAGAGTTGTCCTCTCTGTCTAAAGAGTTCACTACCTGCCTAACAACTGCTGG
GGTCAAAGAAATGGCAGATGTCCTTAACCCATTAATCACTGCAGTATTTCTAGAGGCATCAAACAGTGCCTCCTACATCCAGGACGCCTT
TCAGCTACTCTTACCTGTGCTAGAGATCTCTCTCATTGAGAACAAGATTGAATCACACAGACATGAGCTGCAGGGCCAGAAACCTTTGTT
AGAACATTGAAGAATGGAGACGTTTTGACCTGGGACTTGTGACGGCCAAGGAATGCCACCTTATTCTGGCTACTCCTGCAGAAATGAAGG
AGTGGGGTTATTTTAGTATATAAAAATTCAGGCAGGAGAGATGGTTTAAAGAGGAAGATTGTTGCCTTCAGTGTTTGATTGAAGTATTCA
GGTTCTCACAGTATTCTTTCCAGTTGTTGTAATTCATAAATTATTTGAAAAGAAACTTTTGTAGAAAGTCCAAGAATAATAACTCTAGAT
AAAGATTAGTGGGACACTCAGGCAAAAATGTTGGTCTTTCTTTGACATGTTGCAAAATGTTATCAATTTTGTCATGGATATAATTTGCAG
CCCATGGATATAACTGGTTGATAAGCCAGAGAAAAATAATTTAGTGTTCTAAAATTCATGGCATGTGTGGTTTATTAATGCCATGTACTT


Top

FusionGenePPI for BRAF_FAM114A2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BRAFYWHAB, YWHAG, YWHAQ, YWHAZ, SFN, HRAS, AKT1, MAPK3, RAP1GAP, RAF1, MRAS, RAP1A, PAK2, TERF1, CCDC88A, NEDD4L, MAP2K1, RNF149, KSR1, BRAP, PRKCE, RPS6KB2, HSP90AA1, BRAF, YWHAE, HSPA5, MAP2K2, HSPA1A, HSPA8, YWHAH, HSPA9, ARAF, CDC37, HSP90AB1, PHKB, LIMK1, IQGAP1, MAPK1, BAD, LIPF, MUS81, FBXW7, FGFR2, BRCA2, VHL, FNTA, HDAC2, PIK3CA, EGFR, PTEN, FNIP1, FNIP2, RAB3GAP1, KRAS, KIAA0141, FKBPL, ARMCX3, KCNC4, RPTOR, CYLD, NRASFAM114A2ELAVL1, COPS5, APP, TMEM51, CD274, KIR3DL1, SCN2B, EWSR1, KIR3DL2, EPHA1, LRRC4, CPNE5, TMEM206, SIGLECL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BRAF_FAM114A2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneBRAFP15056DB08881VemurafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
HgeneBRAFP15056DB08896RegorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
HgeneBRAFP15056DB00398SorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational
HgeneBRAFP15056DB08912DabrafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational

Top

RelatedDiseases for BRAF_FAM114A2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBRAFC0025202melanoma21CTD_human
HgeneBRAFC1527249Colorectal Cancer8UNIPROT
HgeneBRAFC1275081Cardio-facio-cutaneous syndrome6CTD_human;ORPHANET;UNIPROT
HgeneBRAFC0009404Colorectal Neoplasms4CTD_human
HgeneBRAFC0040136Thyroid Neoplasm4CTD_human
HgeneBRAFC0024305Lymphoma, Non-Hodgkin3UNIPROT
HgeneBRAFC0684249Carcinoma of lung3UNIPROT
HgeneBRAFC3150970NOONAN SYNDROME 73CTD_human;UNIPROT
HgeneBRAFC0152013Adenocarcinoma of lung (disorder)2CTD_human
HgeneBRAFC0002448Ameloblastoma1CTD_human
HgeneBRAFC0004114Astrocytoma1CTD_human
HgeneBRAFC0010276Craniopharyngioma1CTD_human;ORPHANET
HgeneBRAFC0017638Glioma1CTD_human
HgeneBRAFC0022665Kidney Neoplasm1CTD_human
HgeneBRAFC0023903Liver neoplasms1CTD_human
HgeneBRAFC0024694Mandibular Neoplasms1CTD_human
HgeneBRAFC0028326Noonan Syndrome1CTD_human;ORPHANET
HgeneBRAFC0033578Prostatic Neoplasms1CTD_human
HgeneBRAFC0036920Sezary Syndrome1CTD_human
HgeneBRAFC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneBRAFC0206686Adrenocortical carcinoma1CTD_human
HgeneBRAFC0206754Neuroendocrine Tumors1CTD_human
HgeneBRAFC0238463Papillary thyroid carcinoma1CTD_human;ORPHANET
HgeneBRAFC0587248Costello syndrome (disorder)1CTD_human
HgeneBRAFC0596263Carcinogenesis1CTD_human
HgeneBRAFC0920269Microsatellite Instability1CTD_human
HgeneBRAFC2239176Liver carcinoma1CTD_human