FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43303

FusionGeneSummary for ZNF423_NCEH1

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF423_NCEH1
Fusion gene ID: 43303
HgeneTgene
Gene symbol

ZNF423

NCEH1

Gene ID

23090

57552

Gene namezinc finger protein 423neutral cholesterol ester hydrolase 1
SynonymsEbfaz|JBTS19|NPHP14|OAZ|Roaz|ZFP423|Zfp104|hOAZAADACL1|NCEH
Cytomap

16q12.1

3q26.31

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein 423OLF-1/EBF associated zinc fingerSmad- and Olf-interacting zinc finger proteinearly B-cell factor associated zinc finger proteinolf1/EBF-associated zinc finger proteinneutral cholesterol ester hydrolase 1arylacetamide deacetylase-like 1
Modification date2018052320180523
UniProtAcc

Q2M1K9

Q6PIU2

Ensembl transtripts involved in fusion geneENST00000561648, ENST00000563137, 
ENST00000562871, ENST00000262383, 
ENST00000535559, ENST00000567169, 
ENST00000562520, 
ENST00000475381, 
ENST00000273512, ENST00000538775, 
ENST00000543711, 
Fusion gene scores* DoF score5 X 4 X 3=609 X 6 X 6=324
# samples 412
** MAII scorelog2(4/60*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/324*10)=-1.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZNF423 [Title/Abstract] AND NCEH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZNF423

GO:0045892

negative regulation of transcription, DNA-templated

10660046

HgeneZNF423

GO:0045893

positive regulation of transcription, DNA-templated

10660046


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-NF-A5CP-01AZNF423chr16

49823398

-NCEH1chr3

172351882

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000561648ENST00000475381ZNF423chr16

49823398

-NCEH1chr3

172351882

-
In-frameENST00000561648ENST00000273512ZNF423chr16

49823398

-NCEH1chr3

172351882

-
In-frameENST00000561648ENST00000538775ZNF423chr16

49823398

-NCEH1chr3

172351882

-
In-frameENST00000561648ENST00000543711ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000563137ENST00000475381ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000563137ENST00000273512ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000563137ENST00000538775ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000563137ENST00000543711ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000562871ENST00000475381ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000562871ENST00000273512ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000562871ENST00000538775ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000562871ENST00000543711ZNF423chr16

49823398

-NCEH1chr3

172351882

-
Frame-shitENST00000262383ENST00000475381ZNF423chr16

49823398

-NCEH1chr3

172351882

-
Frame-shitENST00000262383ENST00000273512ZNF423chr16

49823398

-NCEH1chr3

172351882

-
Frame-shitENST00000262383ENST00000538775ZNF423chr16

49823398

-NCEH1chr3

172351882

-
Frame-shitENST00000262383ENST00000543711ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000535559ENST00000475381ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000535559ENST00000273512ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000535559ENST00000538775ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000535559ENST00000543711ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000567169ENST00000475381ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000567169ENST00000273512ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000567169ENST00000538775ZNF423chr16

49823398

-NCEH1chr3

172351882

-
intron-3CDSENST00000567169ENST00000543711ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000562520ENST00000475381ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000562520ENST00000273512ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000562520ENST00000538775ZNF423chr16

49823398

-NCEH1chr3

172351882

-
5UTR-3CDSENST00000562520ENST00000543711ZNF423chr16

49823398

-NCEH1chr3

172351882

-

Top

FusionProtFeatures for ZNF423_NCEH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF423

Q2M1K9

NCEH1

Q6PIU2

Transcription factor that can both act as an activatoror a repressor depending on the context. Plays a central role inBMP signaling and olfactory neurogenesis. Associates with SMADs inresponse to BMP2 leading to activate transcription of BMP targetgenes. Acts as a transcriptional repressor via its interactionwith EBF1, a transcription factor involved in terminal olfactoryreceptor neurons differentiation; this interaction preventing EBF1to bind DNA and activate olfactory-specific genes. Involved inolfactory neurogenesis by participating in a developmental switchthat regulates the transition from differentiation to maturationin olfactory receptor neurons. Controls proliferation anddifferentiation of neural precursors in cerebellar vermisformation. {ECO:0000269|PubMed:10660046}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNCEH1chr16:49823398chr3:172351882ENST00000543711-24113_11570276MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-391020_1042251285Zinc fingerC2H2-type 24
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-391064_1082251285Zinc fingerC2H2-type 25%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-391120_1143251285Zinc fingerC2H2-type 26
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-391168_1190251285Zinc fingerC2H2-type 27
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-391198_1220251285Zinc fingerC2H2-type 28
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-391229_1252251285Zinc fingerC2H2-type 29
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-391259_1282251285Zinc fingerC2H2-type 30
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39138_160251285Zinc fingerC2H2-type 2
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39166_188251285Zinc fingerC2H2-type 3
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39194_216251285Zinc fingerC2H2-type 4
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39222_244251285Zinc fingerC2H2-type 5
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39263_286251285Zinc fingerC2H2-type 6
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39295_318251285Zinc fingerC2H2-type 7
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39323_345251285Zinc fingerC2H2-type 8
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39409_433251285Zinc fingerC2H2-type 9%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39441_464251285Zinc fingerC2H2-type 10
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39480_503251285Zinc fingerC2H2-type 11
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39517_540251285Zinc fingerC2H2-type 12
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39563_588251285Zinc fingerC2H2-type 13%3B atypical
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39632_654251285Zinc fingerC2H2-type 14
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39662_684251285Zinc fingerC2H2-type 15
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-3967_93251285Zinc fingerC2H2-type 1%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39692_715251285Zinc fingerC2H2-type 16
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39720_743251285Zinc fingerC2H2-type 17
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39750_773251285Zinc fingerC2H2-type 18
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39781_803251285Zinc fingerC2H2-type 19
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39807_830251285Zinc fingerC2H2-type 20
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39886_908251285Zinc fingerC2H2-type 21%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39930_952251285Zinc fingerC2H2-type 22
HgeneZNF423chr16:49823398chr3:172351882ENST00000262383-39959_981251285Zinc fingerC2H2-type 23
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-281020_1042251285Zinc fingerC2H2-type 24
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-281064_1082251285Zinc fingerC2H2-type 25%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-281120_1143251285Zinc fingerC2H2-type 26
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-281168_1190251285Zinc fingerC2H2-type 27
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-281198_1220251285Zinc fingerC2H2-type 28
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-281229_1252251285Zinc fingerC2H2-type 29
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-281259_1282251285Zinc fingerC2H2-type 30
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28138_160251285Zinc fingerC2H2-type 2
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28166_188251285Zinc fingerC2H2-type 3
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28194_216251285Zinc fingerC2H2-type 4
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28222_244251285Zinc fingerC2H2-type 5
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28263_286251285Zinc fingerC2H2-type 6
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28295_318251285Zinc fingerC2H2-type 7
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28323_345251285Zinc fingerC2H2-type 8
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28409_433251285Zinc fingerC2H2-type 9%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28441_464251285Zinc fingerC2H2-type 10
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28480_503251285Zinc fingerC2H2-type 11
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28517_540251285Zinc fingerC2H2-type 12
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28563_588251285Zinc fingerC2H2-type 13%3B atypical
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28632_654251285Zinc fingerC2H2-type 14
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28662_684251285Zinc fingerC2H2-type 15
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-2867_93251285Zinc fingerC2H2-type 1%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28692_715251285Zinc fingerC2H2-type 16
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28720_743251285Zinc fingerC2H2-type 17
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28750_773251285Zinc fingerC2H2-type 18
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28781_803251285Zinc fingerC2H2-type 19
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28807_830251285Zinc fingerC2H2-type 20
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28886_908251285Zinc fingerC2H2-type 21%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28930_952251285Zinc fingerC2H2-type 22
HgeneZNF423chr16:49823398chr3:172351882ENST00000561648-28959_981251285Zinc fingerC2H2-type 23
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-281020_1042-351225Zinc fingerC2H2-type 24
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-281064_1082-351225Zinc fingerC2H2-type 25%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-281120_1143-351225Zinc fingerC2H2-type 26
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-281168_1190-351225Zinc fingerC2H2-type 27
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-281198_1220-351225Zinc fingerC2H2-type 28
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-281229_1252-351225Zinc fingerC2H2-type 29
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-281259_1282-351225Zinc fingerC2H2-type 30
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28138_160-351225Zinc fingerC2H2-type 2
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28166_188-351225Zinc fingerC2H2-type 3
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28194_216-351225Zinc fingerC2H2-type 4
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28222_244-351225Zinc fingerC2H2-type 5
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28263_286-351225Zinc fingerC2H2-type 6
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28295_318-351225Zinc fingerC2H2-type 7
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28323_345-351225Zinc fingerC2H2-type 8
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28409_433-351225Zinc fingerC2H2-type 9%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28441_464-351225Zinc fingerC2H2-type 10
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28480_503-351225Zinc fingerC2H2-type 11
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28517_540-351225Zinc fingerC2H2-type 12
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28563_588-351225Zinc fingerC2H2-type 13%3B atypical
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28632_654-351225Zinc fingerC2H2-type 14
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28662_684-351225Zinc fingerC2H2-type 15
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-2867_93-351225Zinc fingerC2H2-type 1%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28692_715-351225Zinc fingerC2H2-type 16
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28720_743-351225Zinc fingerC2H2-type 17
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28750_773-351225Zinc fingerC2H2-type 18
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28781_803-351225Zinc fingerC2H2-type 19
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28807_830-351225Zinc fingerC2H2-type 20
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28886_908-351225Zinc fingerC2H2-type 21%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28930_952-351225Zinc fingerC2H2-type 22
HgeneZNF423chr16:49823398chr3:172351882ENST00000562520-28959_981-351225Zinc fingerC2H2-type 23
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-171020_1042-571225Zinc fingerC2H2-type 24
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-171064_1082-571225Zinc fingerC2H2-type 25%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-171120_1143-571225Zinc fingerC2H2-type 26
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-171168_1190-571225Zinc fingerC2H2-type 27
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-171198_1220-571225Zinc fingerC2H2-type 28
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-171229_1252-571225Zinc fingerC2H2-type 29
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-171259_1282-571225Zinc fingerC2H2-type 30
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17138_160-571225Zinc fingerC2H2-type 2
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17166_188-571225Zinc fingerC2H2-type 3
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17194_216-571225Zinc fingerC2H2-type 4
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17222_244-571225Zinc fingerC2H2-type 5
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17263_286-571225Zinc fingerC2H2-type 6
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17295_318-571225Zinc fingerC2H2-type 7
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17323_345-571225Zinc fingerC2H2-type 8
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17409_433-571225Zinc fingerC2H2-type 9%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17441_464-571225Zinc fingerC2H2-type 10
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17480_503-571225Zinc fingerC2H2-type 11
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17517_540-571225Zinc fingerC2H2-type 12
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17563_588-571225Zinc fingerC2H2-type 13%3B atypical
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17632_654-571225Zinc fingerC2H2-type 14
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17662_684-571225Zinc fingerC2H2-type 15
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-1767_93-571225Zinc fingerC2H2-type 1%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17692_715-571225Zinc fingerC2H2-type 16
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17720_743-571225Zinc fingerC2H2-type 17
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17750_773-571225Zinc fingerC2H2-type 18
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17781_803-571225Zinc fingerC2H2-type 19
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17807_830-571225Zinc fingerC2H2-type 20
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17886_908-571225Zinc fingerC2H2-type 21%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17930_952-571225Zinc fingerC2H2-type 22
HgeneZNF423chr16:49823398chr3:172351882ENST00000562871-17959_981-571225Zinc fingerC2H2-type 23
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-281020_1042-351225Zinc fingerC2H2-type 24
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-281064_1082-351225Zinc fingerC2H2-type 25%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-281120_1143-351225Zinc fingerC2H2-type 26
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-281168_1190-351225Zinc fingerC2H2-type 27
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-281198_1220-351225Zinc fingerC2H2-type 28
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-281229_1252-351225Zinc fingerC2H2-type 29
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-281259_1282-351225Zinc fingerC2H2-type 30
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28138_160-351225Zinc fingerC2H2-type 2
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28166_188-351225Zinc fingerC2H2-type 3
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28194_216-351225Zinc fingerC2H2-type 4
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28222_244-351225Zinc fingerC2H2-type 5
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28263_286-351225Zinc fingerC2H2-type 6
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28295_318-351225Zinc fingerC2H2-type 7
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28323_345-351225Zinc fingerC2H2-type 8
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28409_433-351225Zinc fingerC2H2-type 9%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28441_464-351225Zinc fingerC2H2-type 10
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28480_503-351225Zinc fingerC2H2-type 11
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28517_540-351225Zinc fingerC2H2-type 12
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28563_588-351225Zinc fingerC2H2-type 13%3B atypical
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28632_654-351225Zinc fingerC2H2-type 14
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28662_684-351225Zinc fingerC2H2-type 15
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-2867_93-351225Zinc fingerC2H2-type 1%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28692_715-351225Zinc fingerC2H2-type 16
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28720_743-351225Zinc fingerC2H2-type 17
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28750_773-351225Zinc fingerC2H2-type 18
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28781_803-351225Zinc fingerC2H2-type 19
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28807_830-351225Zinc fingerC2H2-type 20
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28886_908-351225Zinc fingerC2H2-type 21%3B degenerate
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28930_952-351225Zinc fingerC2H2-type 22
HgeneZNF423chr16:49823398chr3:172351882ENST00000563137-28959_981-351225Zinc fingerC2H2-type 23
TgeneNCEH1chr16:49823398chr3:172351882ENST00000475381-35113_115203409MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole
TgeneNCEH1chr16:49823398chr3:172351882ENST00000475381-351_4203409Topological domainCytoplasmic
TgeneNCEH1chr16:49823398chr3:172351882ENST00000475381-3526_408203409Topological domainLumenal
TgeneNCEH1chr16:49823398chr3:172351882ENST00000543711-241_470276Topological domainCytoplasmic
TgeneNCEH1chr16:49823398chr3:172351882ENST00000543711-2426_40870276Topological domainLumenal
TgeneNCEH1chr16:49823398chr3:172351882ENST00000475381-355_25203409TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneNCEH1chr16:49823398chr3:172351882ENST00000543711-245_2570276TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for ZNF423_NCEH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000475381_chr3_172351882_-_231aa
MHKKRVEEGEASDFSLAWDSSVTAAVYSRCQPKK_AQTTSFNLSSSSSFRF_HTILSAKCEHPNPAPLCHGEVLGGLLQRQL_LCAGNDR
_QSHFT_CGRGCCCQGPSKLDIPLACILHKELQACCTDHRQCQDCPGASSVAGCPLRPTHCRPGSAAAPPKDLHSDV_A_CPQRRWHHVC

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000273512_chr3_172351882_-_231aa
MHKKRVEEGEASDFSLAWDSSVTAAVYSRCQPKK_AQTTSFNLSSSSSFRF_HTILSAKCEHPNPAPLCHGEVLGGLLQRQL_LCAGNDR
_QSHFT_CGRGCCCQGPSKLDIPLACILHKELQACCTDHRQCQDCPGASSVAGCPLRPTHCRPGSAAAPPKDLHSDV_A_CPQRRWHHVC

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000538775_chr3_172351882_-_231aa
MHKKRVEEGEASDFSLAWDSSVTAAVYSRCQPKK_AQTTSFNLSSSSSFRF_HTILSAKCEHPNPAPLCHGEVLGGLLQRQL_LCAGNDR
_QSHFT_CGRGCCCQGPSKLDIPLACILHKELQACCTDHRQCQDCPGASSVAGCPLRPTHCRPGSAAAPPKDLHSDV_A_CPQRRWHHVC

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000543711_chr3_172351882_-_231aa
MHKKRVEEGEASDFSLAWDSSVTAAVYSRCQPKK_AQTTSFNLSSSSSFRF_HTILSAKCEHPNPAPLCHGEVLGGLLQRQL_LCAGNDR
_QSHFT_CGRGCCCQGPSKLDIPLACILHKELQACCTDHRQCQDCPGASSVAGCPLRPTHCRPGSAAAPPKDLHSDV_A_CPQRRWHHVC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000475381_chr3_172351882_-_694nt
ATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCAGACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGC
CAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGT
GAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGT
TAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAA
GAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCAT
TGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGC
CAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCAC

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000273512_chr3_172351882_-_694nt
ATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCAGACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGC
CAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGT
GAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGT
TAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAA
GAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCAT
TGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGC
CAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCAC

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000538775_chr3_172351882_-_694nt
ATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCAGACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGC
CAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGT
GAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGT
TAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAA
GAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCAT
TGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGC
CAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCAC

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000543711_chr3_172351882_-_694nt
ATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCAGACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGC
CAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGT
GAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGT
TAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAA
GAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCAT
TGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGC
CAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000475381_chr3_172351882_-_3974nt
GGAAAACTTCCTGGAGAAGGATGGATTTTACCCTGTAAAAGAAGAAAGACATGGATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCA
GACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAAT
TTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAA
GTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGC
TGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGC
CAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGAC
CTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCT
GGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTA
CATCAAGTGGCTAGATCAAAACCTGTAAAGGAGCAAAACTTCCAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGAC
ATGCACTTTTTAGTTGACTAATTCTTCCTCCCATTCCCCTCTACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATA
ACCTAATTTTTAAAAATGAATTTGACTAACTTAAGTGCAAAACATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTAT
CTTAGCCAACTATACTGATACCTACAGCTACAGAAAGCAGGACTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTT
TTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGAGTGACCTTTAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCT
TGAGTTCAGAGCAGTATTAAATGCGTGCACTTTCAGGTCAGTACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTT
TCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAAGAACAAGTTTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCT
ATCTGTAAGTCCAGTTGGATTACAGGAATACTTGAAAGTTACTTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTAT
ATATCATTAGGTTTTTGTTGTGTTTTTGGTTATGCTGTCCCCCTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGT
AAACTTTTCATTATAGAGCAAGTAAAAACAGACAAATGAAACAACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGC
AGTGTGAATATACTTGGCATAGTCAAAAAAGAAAATACATTTAATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTAT
TATTGAAAACTCAATTTTTTCACTTATATGGCTTTAAAATGGAGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTT
AATGTTAATATACATAGCTAGACTTAAGGTTTTTCAGAAAGATGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCT
TAGGGTTTTAAAACCTTCCCTACAGTTATAACCACGTGTAATTTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCAT
AAATATTTTCGTGTTTATATGCATATACAAGTTAAAATAATTAGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGT
AGCTTAGGCAAGGCACACACTGCTCATCTCCGCTTTTTAGGGTCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCAC
CTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCCAGCCAGGTCTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTG
CCAGTGGGAACATCTTTGACACAACAAGACACTCCAATTGTGATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTC
CCCGATCCATGCTACTTTTAGGGGCTGCGGAGAGCAGCAGCAGAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTT
CACTCCTGGGAAGATGGGGTATTTCCCACTTCCAGCAACGAAATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGT
AGCATTTTATGTACAAAACAGAAGTCAATGCAACAGTATGTATGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAA
TGTACTTAGGCAAGCCACTTCCCATCTCTGGGCCTCGTCTTTCCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCT
TCCACTTATAATACCAACTGTCTTGTCAGACTGGCAAATTATATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTT
ATACACAGACACCTGCATCATCGAAGGTCTTTTTTTCCTAAAAAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTC
ATATAATACTATTCTTTTTGACACCATTTGAAGGAACCAATATTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAA
ATGTATAGGCAGGGTTCCTTCAATTGGCATTTTCCCCAGAATTGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATC
TCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAAGGAAAAAAGAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTT
TAGTTTGTATTCTTATAAAAAATGTTTACACTCTGCAGATTGATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAA
AATGATAATCTTTTTGTAAAATTGTCTGTGAAATATAAACATTAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATT
AATGTTTTATTGATTTGTGAAGAATTTAAGACTATTATATAATTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTT
GCTTATTTCCCACTACGAAGGGGAAGGTAGATTTTATGAATGATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGT
AGCAAAGCATCTATCTATTCTGAATCATGTTTGGAAATAAAATTGCTCCATCTGGGAATGTGCTTTCATTTTCCCGTCTCATTTTCTGTT
TCCCATTTGAAAACAGTGTTCTCTTCTCTTCTTTCTGTATGCCAAATTGCCAGCCACAATTCTTTCCCAATCTTCTGCCCAGTGGAGTAC
TCCAGCTGTCTTTCCTTTAGAGAGGTGGTTCAGTGGCCTCCTTGATGACATTTGTTTCATGTCTGGATACAGTATGTGTTGCCCTCCTTT
GGACTGGCTAGAATATTCATAAAAGCCAGGCAGGCCCTGGGACTATTTTGGGACCTTCAATACACATGTTAGGAAAAGGATGATCATAAT
GCCAAGAGTTTGAGCTGAATTGTTTCAGCCAAAGCATCACTATCACTGAAGGCAGGTTCTCAAACTGACCTTGTCATTACAAATAAATCT

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000273512_chr3_172351882_-_3578nt
GGAAAACTTCCTGGAGAAGGATGGATTTTACCCTGTAAAAGAAGAAAGACATGGATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCA
GACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAAT
TTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAA
GTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGC
TGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGC
CAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGAC
CTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCT
GGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTA
CATCAAGTGGCTAGATCAAAACCTGTAAAGGAGCAAAACTTCCAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGAC
ATGCACTTTTTAGTTGACTAATTCTTCCTCCCATTCCCCTCTACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATA
ACCTAATTTTTAAAAATGAATTTGACTAACTTAAGTGCAAAACATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTAT
CTTAGCCAACTATACTGATACCTACAGCTACAGAAAGCAGGACTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTT
TTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGAGTGACCTTTAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCT
TGAGTTCAGAGCAGTATTAAATGCGTGCACTTTCAGGTCAGTACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTT
TCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAAGAACAAGTTTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCT
ATCTGTAAGTCCAGTTGGATTACAGGAATACTTGAAAGTTACTTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTAT
ATATCATTAGGTTTTTGTTGTGTTTTTGGTTATGCTGTCCCCCTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGT
AAACTTTTCATTATAGAGCAAGTAAAAACAGACAAATGAAACAACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGC
AGTGTGAATATACTTGGCATAGTCAAAAAAGAAAATACATTTAATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTAT
TATTGAAAACTCAATTTTTTCACTTATATGGCTTTAAAATGGAGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTT
AATGTTAATATACATAGCTAGACTTAAGGTTTTTCAGAAAGATGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCT
TAGGGTTTTAAAACCTTCCCTACAGTTATAACCACGTGTAATTTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCAT
AAATATTTTCGTGTTTATATGCATATACAAGTTAAAATAATTAGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGT
AGCTTAGGCAAGGCACACACTGCTCATCTCCGCTTTTTAGGGTCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCAC
CTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCCAGCCAGGTCTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTG
CCAGTGGGAACATCTTTGACACAACAAGACACTCCAATTGTGATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTC
CCCGATCCATGCTACTTTTAGGGGCTGCGGAGAGCAGCAGCAGAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTT
CACTCCTGGGAAGATGGGGTATTTCCCACTTCCAGCAACGAAATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGT
AGCATTTTATGTACAAAACAGAAGTCAATGCAACAGTATGTATGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAA
TGTACTTAGGCAAGCCACTTCCCATCTCTGGGCCTCGTCTTTCCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCT
TCCACTTATAATACCAACTGTCTTGTCAGACTGGCAAATTATATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTT
ATACACAGACACCTGCATCATCGAAGGTCTTTTTTTCCTAAAAAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTC
ATATAATACTATTCTTTTTGACACCATTTGAAGGAACCAATATTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAA
ATGTATAGGCAGGGTTCCTTCAATTGGCATTTTCCCCAGAATTGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATC
TCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAAGGAAAAAAGAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTT
TAGTTTGTATTCTTATAAAAAATGTTTACACTCTGCAGATTGATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAA
AATGATAATCTTTTTGTAAAATTGTCTGTGAAATATAAACATTAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATT
AATGTTTTATTGATTTGTGAAGAATTTAAGACTATTATATAATTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTT
GCTTATTTCCCACTACGAAGGGGAAGGTAGATTTTATGAATGATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGT

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000538775_chr3_172351882_-_3578nt
GGAAAACTTCCTGGAGAAGGATGGATTTTACCCTGTAAAAGAAGAAAGACATGGATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCA
GACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAAT
TTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAA
GTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGC
TGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGC
CAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGAC
CTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCT
GGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTA
CATCAAGTGGCTAGATCAAAACCTGTAAAGGAGCAAAACTTCCAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGAC
ATGCACTTTTTAGTTGACTAATTCTTCCTCCCATTCCCCTCTACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATA
ACCTAATTTTTAAAAATGAATTTGACTAACTTAAGTGCAAAACATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTAT
CTTAGCCAACTATACTGATACCTACAGCTACAGAAAGCAGGACTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTT
TTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGAGTGACCTTTAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCT
TGAGTTCAGAGCAGTATTAAATGCGTGCACTTTCAGGTCAGTACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTT
TCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAAGAACAAGTTTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCT
ATCTGTAAGTCCAGTTGGATTACAGGAATACTTGAAAGTTACTTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTAT
ATATCATTAGGTTTTTGTTGTGTTTTTGGTTATGCTGTCCCCCTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGT
AAACTTTTCATTATAGAGCAAGTAAAAACAGACAAATGAAACAACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGC
AGTGTGAATATACTTGGCATAGTCAAAAAAGAAAATACATTTAATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTAT
TATTGAAAACTCAATTTTTTCACTTATATGGCTTTAAAATGGAGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTT
AATGTTAATATACATAGCTAGACTTAAGGTTTTTCAGAAAGATGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCT
TAGGGTTTTAAAACCTTCCCTACAGTTATAACCACGTGTAATTTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCAT
AAATATTTTCGTGTTTATATGCATATACAAGTTAAAATAATTAGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGT
AGCTTAGGCAAGGCACACACTGCTCATCTCCGCTTTTTAGGGTCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCAC
CTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCCAGCCAGGTCTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTG
CCAGTGGGAACATCTTTGACACAACAAGACACTCCAATTGTGATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTC
CCCGATCCATGCTACTTTTAGGGGCTGCGGAGAGCAGCAGCAGAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTT
CACTCCTGGGAAGATGGGGTATTTCCCACTTCCAGCAACGAAATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGT
AGCATTTTATGTACAAAACAGAAGTCAATGCAACAGTATGTATGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAA
TGTACTTAGGCAAGCCACTTCCCATCTCTGGGCCTCGTCTTTCCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCT
TCCACTTATAATACCAACTGTCTTGTCAGACTGGCAAATTATATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTT
ATACACAGACACCTGCATCATCGAAGGTCTTTTTTTCCTAAAAAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTC
ATATAATACTATTCTTTTTGACACCATTTGAAGGAACCAATATTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAA
ATGTATAGGCAGGGTTCCTTCAATTGGCATTTTCCCCAGAATTGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATC
TCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAAGGAAAAAAGAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTT
TAGTTTGTATTCTTATAAAAAATGTTTACACTCTGCAGATTGATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAA
AATGATAATCTTTTTGTAAAATTGTCTGTGAAATATAAACATTAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATT
AATGTTTTATTGATTTGTGAAGAATTTAAGACTATTATATAATTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTT
GCTTATTTCCCACTACGAAGGGGAAGGTAGATTTTATGAATGATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGT

>In-frame_ZNF423_ENST00000561648_chr16_49823398_-_NCEH1_ENST00000543711_chr3_172351882_-_3578nt
GGAAAACTTCCTGGAGAAGGATGGATTTTACCCTGTAAAAGAAGAAAGACATGGATGCATAAGAAGAGGGTTGAAGAGGGGGAGGCCTCA
GACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAAT
TTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAA
GTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGC
TGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGC
CAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGAC
CTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCT
GGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTA
CATCAAGTGGCTAGATCAAAACCTGTAAAGGAGCAAAACTTCCAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGAC
ATGCACTTTTTAGTTGACTAATTCTTCCTCCCATTCCCCTCTACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATA
ACCTAATTTTTAAAAATGAATTTGACTAACTTAAGTGCAAAACATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTAT
CTTAGCCAACTATACTGATACCTACAGCTACAGAAAGCAGGACTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTT
TTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGAGTGACCTTTAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCT
TGAGTTCAGAGCAGTATTAAATGCGTGCACTTTCAGGTCAGTACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTT
TCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAAGAACAAGTTTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCT
ATCTGTAAGTCCAGTTGGATTACAGGAATACTTGAAAGTTACTTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTAT
ATATCATTAGGTTTTTGTTGTGTTTTTGGTTATGCTGTCCCCCTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGT
AAACTTTTCATTATAGAGCAAGTAAAAACAGACAAATGAAACAACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGC
AGTGTGAATATACTTGGCATAGTCAAAAAAGAAAATACATTTAATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTAT
TATTGAAAACTCAATTTTTTCACTTATATGGCTTTAAAATGGAGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTT
AATGTTAATATACATAGCTAGACTTAAGGTTTTTCAGAAAGATGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCT
TAGGGTTTTAAAACCTTCCCTACAGTTATAACCACGTGTAATTTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCAT
AAATATTTTCGTGTTTATATGCATATACAAGTTAAAATAATTAGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGT
AGCTTAGGCAAGGCACACACTGCTCATCTCCGCTTTTTAGGGTCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCAC
CTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCCAGCCAGGTCTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTG
CCAGTGGGAACATCTTTGACACAACAAGACACTCCAATTGTGATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTC
CCCGATCCATGCTACTTTTAGGGGCTGCGGAGAGCAGCAGCAGAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTT
CACTCCTGGGAAGATGGGGTATTTCCCACTTCCAGCAACGAAATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGT
AGCATTTTATGTACAAAACAGAAGTCAATGCAACAGTATGTATGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAA
TGTACTTAGGCAAGCCACTTCCCATCTCTGGGCCTCGTCTTTCCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCT
TCCACTTATAATACCAACTGTCTTGTCAGACTGGCAAATTATATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTT
ATACACAGACACCTGCATCATCGAAGGTCTTTTTTTCCTAAAAAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTC
ATATAATACTATTCTTTTTGACACCATTTGAAGGAACCAATATTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAA
ATGTATAGGCAGGGTTCCTTCAATTGGCATTTTCCCCAGAATTGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATC
TCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAAGGAAAAAAGAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTT
TAGTTTGTATTCTTATAAAAAATGTTTACACTCTGCAGATTGATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAA
AATGATAATCTTTTTGTAAAATTGTCTGTGAAATATAAACATTAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATT
AATGTTTTATTGATTTGTGAAGAATTTAAGACTATTATATAATTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTT
GCTTATTTCCCACTACGAAGGGGAAGGTAGATTTTATGAATGATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGT


Top

FusionGenePPI for ZNF423_NCEH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF423PARP1, SMAD4, SMAD1, EBF1, EBF2, EBF3, USP7, CEP290, LYN, BRCA1, MTA1, ZNF219, RBBP7, MBD3L1, ZG16BNCEH1LYPD3, EVI2A, TMEM38A, ZNRF1, SGTB, COQ9, UGT3A2, NRN1, LRRC3, TMEM231, ST3GAL6, CANT1, AMIGO1, ALG9, LMF2, STAM, BTN2A2, GLB1L2, UGT8, POMT1, C1QL1, EIF2AK3, CD1E, ITPRIP, FAM69A, TMTC3, CANX, CD151, GALNT7, CCPG1, ITGA7, FAM177A1, HYAL2, SCARB1, ST6GALNAC3, PGAP1, MTFP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF423_NCEH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF423_NCEH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneZNF423C0236733Amphetamine-Related Disorders1CTD_human
HgeneZNF423C3539071NEPHRONOPHTHISIS 141UNIPROT