FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42703

FusionGeneSummary for ZDHHC2_LTBP1

check button Fusion gene summary
Fusion gene informationFusion gene name: ZDHHC2_LTBP1
Fusion gene ID: 42703
HgeneTgene
Gene symbol

ZDHHC2

LTBP1

Gene ID

51201

4052

Gene namezinc finger DHHC-type containing 2latent transforming growth factor beta binding protein 1
SynonymsDHHC2|ZNF372-
Cytomap

8p22

2p22.3

Type of geneprotein-codingprotein-coding
Descriptionpalmitoyltransferase ZDHHC2DHHC-2reamrecreduced expression associated with metastasis proteinreduced expression in cancer proteintestis tissue sperm-binding protein Li 56ezinc finger DHHC domain-containing protein 2zinc finger protein 372zinc finlatent-transforming growth factor beta-binding protein 1LTBP-1TGF-beta1-BP-1transforming growth factor beta-1-binding protein 1
Modification date2018052320180522
UniProtAcc

Q9UIJ5

Q14766

Ensembl transtripts involved in fusion geneENST00000262096, ENST00000404816, 
ENST00000354476, ENST00000390003, 
ENST00000418533, ENST00000402934, 
ENST00000404525, ENST00000407925, 
ENST00000272273, ENST00000498013, 
Fusion gene scores* DoF score4 X 1 X 3=126 X 6 X 4=144
# samples 37
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/144*10)=-1.04064198449735
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZDHHC2 [Title/Abstract] AND LTBP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZDHHC2

GO:0018345

protein palmitoylation

23034182


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AR-A0TU-01AZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262096ENST00000404816ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
In-frameENST00000262096ENST00000354476ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
In-frameENST00000262096ENST00000390003ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
In-frameENST00000262096ENST00000418533ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
In-frameENST00000262096ENST00000402934ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
In-frameENST00000262096ENST00000404525ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
In-frameENST00000262096ENST00000407925ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
In-frameENST00000262096ENST00000272273ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+
5CDS-intronENST00000262096ENST00000498013ZDHHC2chr8

17014362

+LTBP1chr2

33572434

+

Top

FusionProtFeatures for ZDHHC2_LTBP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZDHHC2

Q9UIJ5

LTBP1

Q14766

Palmitoyltransferase specific for GAP43 and DLG4/PSD95.{ECO:0000250}. May be involved in the assembly, secretion and targetingof TGFB1 to sites at which it is stored and/or activated. May playcritical roles in controlling and directing the activity of TGFB1.May have a structural role in the extracellular matrix (ECM).

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZDHHC2chr8:17014362chr2:33572434ENST00000262096+11317_37431607TransmembraneHelical
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341286_132812861723DomainEGF-like 14%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341347_140112861723DomainTB 3
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341424_146612861723DomainEGF-like 15%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341467_150312861723DomainEGF-like 16%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341524_157712861723DomainTB 4
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341621_165712861723DomainEGF-like 17
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341662_170612861723DomainEGF-like 18%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301038_10789601397DomainEGF-like 8%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301079_11199601397DomainEGF-like 9%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301120_11609601397DomainEGF-like 10%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301161_12019601397DomainEGF-like 11%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301202_12439601397DomainEGF-like 12%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301244_12819601397DomainEGF-like 13%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301286_13289601397DomainEGF-like 14%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301347_14019601397DomainTB 3
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301424_14669601397DomainEGF-like 15%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301467_15039601397DomainEGF-like 16%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301524_15779601397DomainTB 4
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301621_16579601397DomainEGF-like 17
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301662_17069601397DomainEGF-like 18%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030957_9979601397DomainEGF-like 6%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030998_10379601397DomainEGF-like 7%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301038_10789061343DomainEGF-like 8%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301079_11199061343DomainEGF-like 9%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301120_11609061343DomainEGF-like 10%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301161_12019061343DomainEGF-like 11%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301202_12439061343DomainEGF-like 12%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301244_12819061343DomainEGF-like 13%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301286_13289061343DomainEGF-like 14%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301347_14019061343DomainTB 3
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301424_14669061343DomainEGF-like 15%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301467_15039061343DomainEGF-like 16%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301524_15779061343DomainTB 4
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301621_16579061343DomainEGF-like 17
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301662_17069061343DomainEGF-like 18%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030915_9569061343DomainEGF-like 5%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030957_9979061343DomainEGF-like 6%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030998_10379061343DomainEGF-like 7%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341286_132812851722DomainEGF-like 14%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341347_140112851722DomainTB 3
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341424_146612851722DomainEGF-like 15%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341467_150312851722DomainEGF-like 16%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341524_157712851722DomainTB 4
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341621_165712851722DomainEGF-like 17
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341662_170612851722DomainEGF-like 18%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301038_10789591396DomainEGF-like 8%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301079_11199591396DomainEGF-like 9%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301120_11609591396DomainEGF-like 10%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301161_12019591396DomainEGF-like 11%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301202_12439591396DomainEGF-like 12%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301244_12819591396DomainEGF-like 13%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301286_13289591396DomainEGF-like 14%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301347_14019591396DomainTB 3
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301424_14669591396DomainEGF-like 15%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301467_15039591396DomainEGF-like 16%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301524_15779591396DomainTB 4
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301621_16579591396DomainEGF-like 17
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301662_17069591396DomainEGF-like 18%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030957_9979591396DomainEGF-like 6%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030998_10379591396DomainEGF-like 7%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301174_11769601397MotifCell attachment site
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301174_11769061343MotifCell attachment site
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301174_11769591396MotifCell attachment site
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341507_172112861723RegionC-terminal domain
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+20301507_17219601397RegionC-terminal domain
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+20301507_17219061343RegionC-terminal domain
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341507_172112851722RegionC-terminal domain
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+20301507_17219591396RegionC-terminal domain

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZDHHC2chr8:17014362chr2:33572434ENST00000262096+113127_177431607DomainDHHC
HgeneZDHHC2chr8:17014362chr2:33572434ENST00000262096+113171_191431607TransmembraneHelical
HgeneZDHHC2chr8:17014362chr2:33572434ENST00000262096+113209_229431607TransmembraneHelical
HgeneZDHHC2chr8:17014362chr2:33572434ENST00000262096+11355_75431607TransmembraneHelical
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434100_13012861723Compositional biasNote=Pro-rich
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030100_1309601397Compositional biasNote=Pro-rich
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030100_1309061343Compositional biasNote=Pro-rich
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434100_13012851722Compositional biasNote=Pro-rich
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030100_1309591396Compositional biasNote=Pro-rich
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341038_107812861723DomainEGF-like 8%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341079_111912861723DomainEGF-like 9%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341120_116012861723DomainEGF-like 10%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341161_120112861723DomainEGF-like 11%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341202_124312861723DomainEGF-like 12%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341244_128112861723DomainEGF-like 13%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434187_21912861723DomainEGF-like 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434399_43112861723DomainEGF-like 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434557_60912861723DomainTB 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434626_66312861723DomainEGF-like 3%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434677_72912861723DomainTB 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434873_91012861723DomainEGF-like 4%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434915_95612861723DomainEGF-like 5%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434957_99712861723DomainEGF-like 6%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+2434998_103712861723DomainEGF-like 7%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030187_2199601397DomainEGF-like 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030399_4319601397DomainEGF-like 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030557_6099601397DomainTB 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030626_6639601397DomainEGF-like 3%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030677_7299601397DomainTB 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030873_9109601397DomainEGF-like 4%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000390003+2030915_9569601397DomainEGF-like 5%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030187_2199061343DomainEGF-like 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030399_4319061343DomainEGF-like 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030557_6099061343DomainTB 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030626_6639061343DomainEGF-like 3%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030677_7299061343DomainTB 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404525+2030873_9109061343DomainEGF-like 4%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341038_107812851722DomainEGF-like 8%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341079_111912851722DomainEGF-like 9%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341120_116012851722DomainEGF-like 10%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341161_120112851722DomainEGF-like 11%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341202_124312851722DomainEGF-like 12%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341244_128112851722DomainEGF-like 13%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434187_21912851722DomainEGF-like 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434399_43112851722DomainEGF-like 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434557_60912851722DomainTB 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434626_66312851722DomainEGF-like 3%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434677_72912851722DomainTB 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434873_91012851722DomainEGF-like 4%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434915_95612851722DomainEGF-like 5%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434957_99712851722DomainEGF-like 6%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+2434998_103712851722DomainEGF-like 7%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030187_2199591396DomainEGF-like 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030399_4319591396DomainEGF-like 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030557_6099591396DomainTB 1
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030626_6639591396DomainEGF-like 3%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030677_7299591396DomainTB 2
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030873_9109591396DomainEGF-like 4%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000407925+2030915_9569591396DomainEGF-like 5%3B calcium-binding
TgeneLTBP1chr8:17014362chr2:33572434ENST00000354476+24341174_117612861723MotifCell attachment site
TgeneLTBP1chr8:17014362chr2:33572434ENST00000404816+24341174_117612851722MotifCell attachment site


Top

FusionGeneSequence for ZDHHC2_LTBP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000404816_chr2_33572434_+_480aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDLDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENT
KDADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAES
NEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTP
EADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLC

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000354476_chr2_33572434_+_480aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDLDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENT
KDADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAES
NEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTP
EADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLC

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000390003_chr2_33572434_+_480aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDLDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENT
KDADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAES
NEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTP
EADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLC

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000418533_chr2_33572434_+_480aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDLDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENT
KDADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAES
NEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTP
EADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLC

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000402934_chr2_33572434_+_478aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENTKD
ADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNE
QIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTPEA
DPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLCLP

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000404525_chr2_33572434_+_480aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDLDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENT
KDADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAES
NEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTP
EADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLC

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000407925_chr2_33572434_+_480aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDLDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENT
KDADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAES
NEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTP
EADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLC

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000272273_chr2_33572434_+_480aa
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTS
TDLDVDVDQPKEEKKECYTNLNDASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENT
KDADECLLFGQEICKNGFCLNTRPGTECYCKQGTYTDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAES
NEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLTGEAWGMQCALCPLKDSDDTAQLCNIPVTGRRQPTGRDALVDFSEQTTP
EADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGTHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000404816_chr2_33572434_+_1440nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTG
TTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTG
GGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTAT
AAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGT
AAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGT
GTTAATACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCA
AACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGC
AAGCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGAC
TATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCA
GAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAA
AATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGAT
GTAAATGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGT
CTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000354476_chr2_33572434_+_1440nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTG
TTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTG
GGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTAT
AAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGT
AAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGT
GTTAATACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCA
AACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGC
AAGCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGAC
TATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCA
GAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAA
AATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGAT
GTAAATGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGT
CTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000390003_chr2_33572434_+_1440nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTG
TTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTG
GGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTAT
AAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGT
AAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGT
GTTAATACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCA
AACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGC
AAGCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGAC
TATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCA
GAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAA
AATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGAT
GTAAATGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGT
CTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000418533_chr2_33572434_+_1440nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTG
TTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTG
GGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTAT
AAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGT
AAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGT
GTTAATACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCA
AACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGC
AAGCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGAC
TATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCA
GAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAA
AATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGAT
GTAAATGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGT
CTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000402934_chr2_33572434_+_1434nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCC
CCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACT
GCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGAT
GCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAA
GGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAAT
ACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAA
CAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAG
ACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCT
CAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCC
GATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGT
CGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAAT
GAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000404525_chr2_33572434_+_1440nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTG
TTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTG
GGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTAT
AAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGT
AAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGT
GTTAATACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCA
AACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGC
AAGCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGAC
TATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCA
GAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAA
AATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGAT
GTAAATGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGT
CTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000407925_chr2_33572434_+_1440nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTG
TTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTG
GGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTAT
AAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGT
AAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGT
GTTAATACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCA
AACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGC
AAGCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGAC
TATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCA
GAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAA
AATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGAT
GTAAATGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGT
CTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000272273_chr2_33572434_+_1440nt
ATGGCGCCCTCGGGCCCGGGCAGCAGCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTC
GGCTGGTCCTACTACGCCTACGCCATCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGT
GAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCC
ACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTG
TTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTG
GGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTAT
AAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGT
AAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGT
GTTAATACAGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCA
AACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGC
AAGCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGAC
TATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCA
GAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAA
AATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGAT
GTAAATGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGT
CTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000404816_chr2_33572434_+_2949nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATGTAGATC
AACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAG
AATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGT
GTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTT
TTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTG
TGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACT
GCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATG
TCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCT
GCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCG
TGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAG
ACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGG
AAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACA
ACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACA
AGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCC
ATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAG
CATGGAATTGCAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCAAATGGACATTTCTCTAAAAAAC
CAGTATATATAGTCTGTTCATATGTAAAATTCAATGGAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTT
GTTTTGTTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTATATAATTTTCATTTTTTGGTTGTGCAGT
TCCTTGGCTACTGTTTTTCTTTTACTTCAGTTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATAAG
TATTGTTACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATTGTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCC
AAAACTTTGTATACACATTTGGAGAAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGCTGCTAGCA
GGTGTTAATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCTTACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000354476_chr2_33572434_+_3096nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATGTAGATC
AACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAG
AATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGT
GTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTT
TTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTG
TGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACT
GCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATG
TCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCT
GCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCG
TGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAG
ACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGG
AAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACA
ACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACA
AGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCC
ATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAG
CATGGAATTGCAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCAAATGGACATTTCTCTAAAAAAC
CAGTATATATAGTCTGTTCATATGTAAAATTCAATGGAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTT
GTTTTGTTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTATATAATTTTCATTTTTTGGTTGTGCAGT
TCCTTGGCTACTGTTTTTCTTTTACTTCAGTTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATAAG
TATTGTTACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATTGTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCC
AAAACTTTGTATACACATTTGGAGAAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGCTGCTAGCA
GGTGTTAATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCTTACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAA
TTTTTAAAAATTTGATGATCCCCAATATATCTACCATTGTATGTTAAATAAATCACCATTTTTGTAGAAAAAATTCTACCTGAGAGTAAT
TGTCAATGAGTACATGTGTATAAGTTGTATCCCACTCTCCCCACTTTTATCTTTTCCAGTGGTCTTCTGTTAATGTAGTGTCTTTTACAA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000390003_chr2_33572434_+_3096nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATGTAGATC
AACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAG
AATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGT
GTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTT
TTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTG
TGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACT
GCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATG
TCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCT
GCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCG
TGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAG
ACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGG
AAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACA
ACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACA
AGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCC
ATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAG
CATGGAATTGCAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCAAATGGACATTTCTCTAAAAAAC
CAGTATATATAGTCTGTTCATATGTAAAATTCAATGGAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTT
GTTTTGTTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTATATAATTTTCATTTTTTGGTTGTGCAGT
TCCTTGGCTACTGTTTTTCTTTTACTTCAGTTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATAAG
TATTGTTACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATTGTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCC
AAAACTTTGTATACACATTTGGAGAAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGCTGCTAGCA
GGTGTTAATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCTTACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAA
TTTTTAAAAATTTGATGATCCCCAATATATCTACCATTGTATGTTAAATAAATCACCATTTTTGTAGAAAAAATTCTACCTGAGAGTAAT
TGTCAATGAGTACATGTGTATAAGTTGTATCCCACTCTCCCCACTTTTATCTTTTCCAGTGGTCTTCTGTTAATGTAGTGTCTTTTACAA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000418533_chr2_33572434_+_3096nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATGTAGATC
AACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAG
AATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGT
GTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTT
TTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTG
TGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACT
GCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATG
TCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCT
GCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCG
TGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAG
ACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGG
AAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACA
ACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACA
AGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCC
ATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAG
CATGGAATTGCAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCAAATGGACATTTCTCTAAAAAAC
CAGTATATATAGTCTGTTCATATGTAAAATTCAATGGAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTT
GTTTTGTTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTATATAATTTTCATTTTTTGGTTGTGCAGT
TCCTTGGCTACTGTTTTTCTTTTACTTCAGTTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATAAG
TATTGTTACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATTGTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCC
AAAACTTTGTATACACATTTGGAGAAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGCTGCTAGCA
GGTGTTAATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCTTACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAA
TTTTTAAAAATTTGATGATCCCCAATATATCTACCATTGTATGTTAAATAAATCACCATTTTTGTAGAAAAAATTCTACCTGAGAGTAAT
TGTCAATGAGTACATGTGTATAAGTTGTATCCCACTCTCCCCACTTTTATCTTTTCCAGTGGTCTTCTGTTAATGTAGTGTCTTTTACAA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000402934_chr2_33572434_+_2941nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATGTAGATGTAGATCAACCCA
AAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAGAATGCT
GCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGTGTCCCA
AAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTTTTGGAC
AAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTGTGAAAC
TGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACTGCTTCT
GTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATGTCTACC
AAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCTGCTGTC
TGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCGTGACGG
GACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAGACCGTT
TTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGGAAGGTT
ACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACAACCGGA
TGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACAAGCCAA
ACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCCATATAC
TCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAGCATGGA
ATTGCAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCAAATGGACATTTCTCTAAAAAACCAGTAT
ATATAGTCTGTTCATATGTAAAATTCAATGGAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTTGTTTTG
TTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTATATAATTTTCATTTTTTGGTTGTGCAGTTCCTTG
GCTACTGTTTTTCTTTTACTTCAGTTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATAAGTATTGT
TACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATTGTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCCAAAACT
TTGTATACACATTTGGAGAAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGCTGCTAGCAGGTGTT
AATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCTTACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAATTTTTA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000404525_chr2_33572434_+_3099nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATGTAGATC
AACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAG
AATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGT
GTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTT
TTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTG
TGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACT
GCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATG
TCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCT
GCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCG
TGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAG
ACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGG
AAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACA
ACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACA
AGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCC
ATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAG
CATGGAATTGCAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCAAATGGACATTTCTCTAAAAAAC
CAGTATATATAGTCTGTTCATATGTAAAATTCAATGGAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTT
GTTTTGTTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTATATAATTTTCATTTTTTGGTTGTGCAGT
TCCTTGGCTACTGTTTTTCTTTTACTTCAGTTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATAAG
TATTGTTACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATTGTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCC
AAAACTTTGTATACACATTTGGAGAAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGCTGCTAGCA
GGTGTTAATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCTTACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAA
TTTTTAAAAATTTGATGATCCCCAATATATCTACCATTGTATGTTAAATAAATCACCATTTTTGTAGAAAAAATTCTACCTGAGAGTAAT
TGTCAATGAGTACATGTGTATAAGTTGTATCCCACTCTCCCCACTTTTATCTTTTCCAGTGGTCTTCTGTTAATGTAGTGTCTTTTACAA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000407925_chr2_33572434_+_2953nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATGTAGATC
AACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAG
AATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGT
GTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTT
TTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTG
TGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACT
GCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATG
TCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCT
GCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCG
TGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAG
ACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGG
AAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACA
ACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACA
AGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCC
ATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAG
CATGGAATTGCAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCAAATGGACATTTCTCTAAAAAAC
CAGTATATATAGTCTGTTCATATGTAAAATTCAATGGAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTT
GTTTTGTTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTATATAATTTTCATTTTTTGGTTGTGCAGT
TCCTTGGCTACTGTTTTTCTTTTACTTCAGTTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATAAG
TATTGTTACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATTGTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCC
AAAACTTTGTATACACATTTGGAGAAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGCTGCTAGCA
GGTGTTAATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCTTACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAA

>In-frame_ZDHHC2_ENST00000262096_chr8_17014362_+_LTBP1_ENST00000272273_chr2_33572434_+_2278nt
CGCAAGTTGAAGCGCGAGGGTTCCACGCGGGCTGCGGGGACGCGGGCCTCGGTGCTGCAGACTTTCTCAGGGCGCCTGGGTCGCGGCAGG
CGCGGAGTCCCGAGCGCAGCAGCTGCTCCGCCGGCCTCGCCTCCGACCCCCGCCCTGCGCCAAGCGCGGAAGCGCTCGCGACCTAACTGC
CCCGGGTGCCGGGCGCCTAGGGAGGGGCCGCCACCGCCCGCTCCGCCCCGGGGGCCTGCGCCCAGCAGCCCCCGCCTCCCCGGAATCCAG
AGGCCGAGCCGGAGGCGGCGGGGCCACGGTGGGAGCCCGCGAGGTGGCCCGAGCGAGGGCCCCGCATCCCCGCAGAGCCCGCCCGAGGGC
GCAGCCTGCCACGCCAGGGGAGGCGGCCGGGCGGCGGGGAACGGCGGGGGCGGAGCGCAGCCTCCCGACGCCGCCGCCTCACCGCCCCCC
TCCGCCTCCTCGGCCTCCGCTCGCAGCCGCCGCCTCCGCCTCCGCCGGGCTGAGGAGCCGGGAGTCCGCCGCGCCGGCTCGGGGCTGCGG
GATGGGGAGTTAGCGCCACGGCGGCGGCAGTGGCCGCAGCGCACCCCGCCGCCGCCCAGGAGCCCGTCCAGCCAGGGGTGCCGGGCCCGC
CCAGCCCGCCCCGGAGCCAGGCCCGCGGGCGGCGGCGGAGCTGGGCAGGTGGATGCGGCTGGAAGATGGCGCCCTCGGGCCCGGGCAGCA
GCGCCAGGCGGCGGTGCCGGCGGGTGCTGTACTGGATCCCGGTGGTGTTCATCACCCTCCTGCTCGGCTGGTCCTACTACGCCTACGCCA
TCCAGCTGTGCATAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGT
GCGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATGTAGATC
AACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAG
AATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGT
GTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTT
TTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTG
TGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACT
GCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATG
TCTACCAAGATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCT
GCTGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCG
TGACGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATCCAAG
ACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGG
AAGGTTACACCTGCGATTGCTTTGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGATGAGTTGAACA
ACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTTCCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACA
AGCCAAACTACTGCACTCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATCTACATAACCTAAGCCC
ATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTATACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACAGAAACAG


Top

FusionGenePPI for ZDHHC2_LTBP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZDHHC2MSX2, MAFBLTBP1TGFB1, CACNA1A, ATN1, SMURF1, FBXO6, HLA-DPA1, GINM1, ZFP41, IGFBP3, IGFBP5, MED23, ALKBH3, ZNF131, PTPN4, BCHE, KLRG2, ZNF408, KBTBD7, PCDHB11, PCDH20, PCDH12, CSN1S1, EFEMP1, MMP10, VWCE, PCDHGB4, PCDHGA5, PCDHA4, CDH5, DEFA5, MMP3, C4orf26, PCDHA12, LOXL3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZDHHC2_LTBP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZDHHC2_LTBP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneZDHHC2C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneZDHHC2C0023903Liver neoplasms1CTD_human
HgeneZDHHC2C0043094Weight Gain1CTD_human
TgeneLTBP1C0023893Liver Cirrhosis, Experimental1CTD_human