FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42261

FusionGeneSummary for XYLT1_GALNT6

check button Fusion gene summary
Fusion gene informationFusion gene name: XYLT1_GALNT6
Fusion gene ID: 42261
HgeneTgene
Gene symbol

XYLT1

GALNT6

Gene ID

64131

11226

Gene namexylosyltransferase 1polypeptide N-acetylgalactosaminyltransferase 6
SynonymsDBQD2|PXYLT1|XT-I|XT1|XTI|XYLTI|xylT-IGALNAC-T6|GalNAcT6
Cytomap

16p12.3

12q13.13

Type of geneprotein-codingprotein-coding
Descriptionxylosyltransferase 1beta-D-xylosyltransferase 1peptide O-xylosyltransferase 1xylosyltransferase Ixylosyltransferase iotapolypeptide N-acetylgalactosaminyltransferase 6GalNAc transferase 6UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 6UDP-N-acetyl-alpha-D-galactosamine:polypept
Modification date2018051920180523
UniProtAcc

Q86Y38

Q8NCL4

Ensembl transtripts involved in fusion geneENST00000261381, ENST00000568226, 
ENST00000543196, ENST00000356317, 
ENST00000603203, 
Fusion gene scores* DoF score7 X 4 X 4=1123 X 3 X 2=18
# samples 63
** MAII scorelog2(6/112*10)=-0.900464326449086
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: XYLT1 [Title/Abstract] AND GALNT6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A1KU-01AXYLT1chr16

17292069

-GALNT6chr12

51771151

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261381ENST00000543196XYLT1chr16

17292069

-GALNT6chr12

51771151

-
In-frameENST00000261381ENST00000356317XYLT1chr16

17292069

-GALNT6chr12

51771151

-
5CDS-intronENST00000261381ENST00000603203XYLT1chr16

17292069

-GALNT6chr12

51771151

-
intron-3CDSENST00000568226ENST00000543196XYLT1chr16

17292069

-GALNT6chr12

51771151

-
intron-3CDSENST00000568226ENST00000356317XYLT1chr16

17292069

-GALNT6chr12

51771151

-
intron-intronENST00000568226ENST00000603203XYLT1chr16

17292069

-GALNT6chr12

51771151

-

Top

FusionProtFeatures for XYLT1_GALNT6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
XYLT1

Q86Y38

GALNT6

Q8NCL4

Catalyzes the first step in the biosynthesis ofchondroitin sulfate and dermatan sulfate proteoglycans, such asDCN. Transfers D-xylose from UDP-D-xylose to specific serineresidues of the core protein (PubMed:15461586, PubMed:17189265,PubMed:24581741, PubMed:23982343). Required for normal embryonicand postnatal skeleton development, especially of the long bones(PubMed:24581741, PubMed:23982343). Required for normal maturationof chondrocytes during bone development, and normal onset ofossification (By similarity). {ECO:0000250|UniProtKB:Q811B1,ECO:0000269|PubMed:15461586, ECO:0000269|PubMed:17189265,ECO:0000269|PubMed:23982343, ECO:0000269|PubMed:24581741}. Catalyzes the initial reaction in O-linkedoligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on theprotein receptor. May participate in synthesis of oncofetalfibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectinpeptides.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXYLT1chr16:17292069chr12:51771151ENST00000261381-512390_392429960RegionUDP-xylose binding
HgeneXYLT1chr16:17292069chr12:51771151ENST00000261381-5121_17429960Topological domainCytoplasmic
HgeneXYLT1chr16:17292069chr12:51771151ENST00000261381-51218_38429960TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneGALNT6chr16:17292069chr12:51771151ENST00000356317-212496_622163623DomainRicin B-type lectin
TgeneGALNT6chr16:17292069chr12:51771151ENST00000543196-111496_622163623DomainRicin B-type lectin
TgeneGALNT6chr16:17292069chr12:51771151ENST00000356317-212176_285163623RegionNote=Catalytic subdomain A
TgeneGALNT6chr16:17292069chr12:51771151ENST00000356317-212348_410163623RegionNote=Catalytic subdomain B
TgeneGALNT6chr16:17292069chr12:51771151ENST00000543196-111176_285163623RegionNote=Catalytic subdomain A
TgeneGALNT6chr16:17292069chr12:51771151ENST00000543196-111348_410163623RegionNote=Catalytic subdomain B

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXYLT1chr16:17292069chr12:51771151ENST00000261381-512494_495429960RegionUDP-xylose binding
HgeneXYLT1chr16:17292069chr12:51771151ENST00000261381-512598_599429960RegionUDP-xylose binding
HgeneXYLT1chr16:17292069chr12:51771151ENST00000261381-51239_959429960Topological domainLumenal
TgeneGALNT6chr16:17292069chr12:51771151ENST00000356317-2121_8163623Topological domainCytoplasmic
TgeneGALNT6chr16:17292069chr12:51771151ENST00000356317-21229_622163623Topological domainLumenal
TgeneGALNT6chr16:17292069chr12:51771151ENST00000543196-1111_8163623Topological domainCytoplasmic
TgeneGALNT6chr16:17292069chr12:51771151ENST00000543196-11129_622163623Topological domainLumenal
TgeneGALNT6chr16:17292069chr12:51771151ENST00000356317-2129_28163623TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneGALNT6chr16:17292069chr12:51771151ENST00000543196-1119_28163623TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for XYLT1_GALNT6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_XYLT1_ENST00000261381_chr16_17292069_-_GALNT6_ENST00000543196_chr12_51771151_-_889aa
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPAPAPRRERRDLPAEPAAARGGGGGGGGGGGG
RGPQARARGGGPGEPRGQQPASRGALPARALDPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPE
LAKKPPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHARKTGGSSPETKTDQPPKCDISGKEAISALSR
AKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHV
DKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRCVDQKFRRCPPLATTSVIIV
FHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCEC
FHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKS
YFEHIGTTDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFTRRNLQAAKMA
QEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFTGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDL

>In-frame_XYLT1_ENST00000261381_chr16_17292069_-_GALNT6_ENST00000356317_chr12_51771151_-_889aa
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPAPAPRRERRDLPAEPAAARGGGGGGGGGGGG
RGPQARARGGGPGEPRGQQPASRGALPARALDPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPE
LAKKPPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHARKTGGSSPETKTDQPPKCDISGKEAISALSR
AKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHV
DKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRCVDQKFRRCPPLATTSVIIV
FHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCEC
FHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKS
YFEHIGTTDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFTRRNLQAAKMA
QEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFTGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_XYLT1_ENST00000261381_chr16_17292069_-_GALNT6_ENST00000543196_chr12_51771151_-_2667nt
ATGGTGGCGGCGCCGTGCGCCCGGAGGCTGGCCCGGCGCTCGCACTCGGCGCTGCTCGCGGCGCTCACGGTGCTGCTGCTGCAGACGCTG
GTCGTGTGGAATTTCAGCAGCCTCGACTCCGGGGCCGGGGAGCGCCGCGGGGGCGCAGCGGTCGGCGGCGGGGAGCAGCCGCCCCCGGCC
CCGGCCCCGCGCCGGGAGCGCCGGGACCTGCCCGCCGAGCCGGCTGCAGCCCGAGGAGGAGGAGGAGGCGGCGGCGGAGGAGGAGGAGGA
CGGGGGCCCCAGGCGCGGGCGCGGGGAGGCGGCCCCGGAGAACCGCGGGGACAGCAGCCGGCCAGCCGGGGGGCACTGCCCGCCCGGGCT
CTGGATCCACACCCAAGTCCGCTCATCACCCTGGAGACTCAGGATGGCTACTTTTCTCATCGGCCGAAAGAGAAAGTGCGAACAGACAGC
AACAACGAGAACTCTGTCCCCAAAGACTTTGAGAATGTCGACAACAGCAACTTCGCACCCAGGACTCAAAAGCAGAAGCACCAGCCTGAG
TTGGCGAAGAAGCCACCGAGTAGACAGAAGGAGCTTTTGAAAAGGAAGCTGGAACAGCAGGAGAAAGGAAAAGGACATACATTCCCTGGG
AAAGGCCCCGGTGAGGTGCTGCCTCCCGGGGACAGAGCCGCAGCCAACAGCAGCCACGGGAAGGATGTGTCCAGACCGCCTCATGCCAGG
AAAACTGGGGGCAGCTCCCCCGAGACCAAGTATGACCAGCCCCCTAAGTGTGACATCTCAGGCAAGGAGGCCATCTCTGCCCTGTCCCGT
GCTAAGTCCAAGCACTGCCGCCAGGAGATTGGGGAGACTTACTGCCGCCACAAGTTAGGGCTGCTGATGCCTGAGAAGGTGACTCGGTTC
TGCCCCCTCGAGGGTAAAGCCAACAAGAACGTGCAGTGGGACGAGGACTCCGTGGAGTACATGCCAGCCAACCCGGTCAGAATCGCCTTT
GTCCTGGTGGTCCACGGCCGTGCCTCTCGGCAGTTGCAGCGCATGTTCAAGGCCATCTACCACAAAGACCACTTCTACTACATCCACGTG
GACAAGCGCTCTAATTACCTGCATCGGCAAGTGCTCCAGGTCTCCAGGCAGTACAGCAATGTCCGCGTCACCCCCTGGAGAATGGCCACC
ATCTGGGGAGGAGCCAGCCTCCTGTCCACCTACCTGCAGAGCATGCGGGACCTCCTGGAGATGACCGACTGGCCCTGGGACTTCTTCATC
AACCTGAGTGCGGCCGACTACCCCATCAGGTGTGTGGACCAGAAGTTCCGGCGCTGCCCCCCACTGGCCACCACCAGCGTGATCATTGTG
TTCCACAACGAAGCCTGGTCCACACTGCTGCGAACAGTGTACAGCGTCCTACACACCACCCCTGCCATCTTGCTCAAGGAGATCATACTG
GTGGATGATGCCAGCACAGAGGAGCACCTAAAGGAGAAGCTGGAGCAGTACGTGAAGCAGCTGCAGGTGGTGAGGGTGGTGCGGCAGGAG
GAGCGGAAGGGGCTGATCACCGCCCGGCTGCTGGGGGCCAGCGTGGCACAGGCGGAGGTGCTCACGTTCCTGGATGCCCACTGTGAGTGC
TTCCACGGCTGGCTGGAGCCCCTCCTGGCTCGAATCGCTGAGGACAAGACAGTGGTGGTGAGCCCAGACATCGTCACCATCGACCTTAAT
ACTTTTGAGTTCGCCAAGCCCGTCCAGAGGGGCAGAGTCCATAGCCGAGGCAACTTTGACTGGAGCCTGACCTTCGGCTGGGAAACACTT
CCTCCACATGAGAAGCAGAGGCGCAAGGATGAAACCTACCCCATCAAATCCCCGACGTTTGCTGGTGGCCTCTTCTCCATCTCCAAGTCC
TACTTTGAGCACATCGGTACCTATGATAATCAGATGGAGATCTGGGGAGGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGTGGG
GGCCAGCTGGAGATCATCCCCTGCTCTGTCGTAGGCCATGTGTTCCGGACCAAGAGCCCCCACACCTTCCCCAAGGGCACTAGTGTCATT
GCTCGCAATCAAGTGCGCCTGGCAGAGGTCTGGATGGACAGCTACAAGAAGATTTTCTATAGGAGAAATCTGCAGGCAGCAAAGATGGCC
CAAGAGAAATCCTTCGGTGACATTTCGGAACGACTGCAGCTGAGGGAACAACTGCACTGTCACAACTTTTCCTGGTACCTGCACAATGTC
TACCCAGAGATGTTTGTTCCTGACCTGACGCCCACCTTCTATGGTGCCATCAAGAACCTCGGCACCAACCAATGCCTGGATGTGGGTGAG
AACAACCGCGGGGGGAAGCCCCTCATCATGTACTCCTGCCACGGCCTTGGCGGCAACCAGTACTTTGAGTACACAACTCAGAGGGACCTT
CGCCACAACATCGCAAAGCAGCTGTGTCTACATGTCAGCAAGGGTGCTCTGGGCCTTGGGAGCTGTCACTTCACTGGCAAGAATAGCCAG
GTCCCCAAGGACGAGGAATGGGAATTGGCCCAGGATCAGCTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCCCAGGACAAAAAG

>In-frame_XYLT1_ENST00000261381_chr16_17292069_-_GALNT6_ENST00000356317_chr12_51771151_-_2667nt
ATGGTGGCGGCGCCGTGCGCCCGGAGGCTGGCCCGGCGCTCGCACTCGGCGCTGCTCGCGGCGCTCACGGTGCTGCTGCTGCAGACGCTG
GTCGTGTGGAATTTCAGCAGCCTCGACTCCGGGGCCGGGGAGCGCCGCGGGGGCGCAGCGGTCGGCGGCGGGGAGCAGCCGCCCCCGGCC
CCGGCCCCGCGCCGGGAGCGCCGGGACCTGCCCGCCGAGCCGGCTGCAGCCCGAGGAGGAGGAGGAGGCGGCGGCGGAGGAGGAGGAGGA
CGGGGGCCCCAGGCGCGGGCGCGGGGAGGCGGCCCCGGAGAACCGCGGGGACAGCAGCCGGCCAGCCGGGGGGCACTGCCCGCCCGGGCT
CTGGATCCACACCCAAGTCCGCTCATCACCCTGGAGACTCAGGATGGCTACTTTTCTCATCGGCCGAAAGAGAAAGTGCGAACAGACAGC
AACAACGAGAACTCTGTCCCCAAAGACTTTGAGAATGTCGACAACAGCAACTTCGCACCCAGGACTCAAAAGCAGAAGCACCAGCCTGAG
TTGGCGAAGAAGCCACCGAGTAGACAGAAGGAGCTTTTGAAAAGGAAGCTGGAACAGCAGGAGAAAGGAAAAGGACATACATTCCCTGGG
AAAGGCCCCGGTGAGGTGCTGCCTCCCGGGGACAGAGCCGCAGCCAACAGCAGCCACGGGAAGGATGTGTCCAGACCGCCTCATGCCAGG
AAAACTGGGGGCAGCTCCCCCGAGACCAAGTATGACCAGCCCCCTAAGTGTGACATCTCAGGCAAGGAGGCCATCTCTGCCCTGTCCCGT
GCTAAGTCCAAGCACTGCCGCCAGGAGATTGGGGAGACTTACTGCCGCCACAAGTTAGGGCTGCTGATGCCTGAGAAGGTGACTCGGTTC
TGCCCCCTCGAGGGTAAAGCCAACAAGAACGTGCAGTGGGACGAGGACTCCGTGGAGTACATGCCAGCCAACCCGGTCAGAATCGCCTTT
GTCCTGGTGGTCCACGGCCGTGCCTCTCGGCAGTTGCAGCGCATGTTCAAGGCCATCTACCACAAAGACCACTTCTACTACATCCACGTG
GACAAGCGCTCTAATTACCTGCATCGGCAAGTGCTCCAGGTCTCCAGGCAGTACAGCAATGTCCGCGTCACCCCCTGGAGAATGGCCACC
ATCTGGGGAGGAGCCAGCCTCCTGTCCACCTACCTGCAGAGCATGCGGGACCTCCTGGAGATGACCGACTGGCCCTGGGACTTCTTCATC
AACCTGAGTGCGGCCGACTACCCCATCAGGTGTGTGGACCAGAAGTTCCGGCGCTGCCCCCCACTGGCCACCACCAGCGTGATCATTGTG
TTCCACAACGAAGCCTGGTCCACACTGCTGCGAACAGTGTACAGCGTCCTACACACCACCCCTGCCATCTTGCTCAAGGAGATCATACTG
GTGGATGATGCCAGCACAGAGGAGCACCTAAAGGAGAAGCTGGAGCAGTACGTGAAGCAGCTGCAGGTGGTGAGGGTGGTGCGGCAGGAG
GAGCGGAAGGGGCTGATCACCGCCCGGCTGCTGGGGGCCAGCGTGGCACAGGCGGAGGTGCTCACGTTCCTGGATGCCCACTGTGAGTGC
TTCCACGGCTGGCTGGAGCCCCTCCTGGCTCGAATCGCTGAGGACAAGACAGTGGTGGTGAGCCCAGACATCGTCACCATCGACCTTAAT
ACTTTTGAGTTCGCCAAGCCCGTCCAGAGGGGCAGAGTCCATAGCCGAGGCAACTTTGACTGGAGCCTGACCTTCGGCTGGGAAACACTT
CCTCCACATGAGAAGCAGAGGCGCAAGGATGAAACCTACCCCATCAAATCCCCGACGTTTGCTGGTGGCCTCTTCTCCATCTCCAAGTCC
TACTTTGAGCACATCGGTACCTATGATAATCAGATGGAGATCTGGGGAGGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGTGGG
GGCCAGCTGGAGATCATCCCCTGCTCTGTCGTAGGCCATGTGTTCCGGACCAAGAGCCCCCACACCTTCCCCAAGGGCACTAGTGTCATT
GCTCGCAATCAAGTGCGCCTGGCAGAGGTCTGGATGGACAGCTACAAGAAGATTTTCTATAGGAGAAATCTGCAGGCAGCAAAGATGGCC
CAAGAGAAATCCTTCGGTGACATTTCGGAACGACTGCAGCTGAGGGAACAACTGCACTGTCACAACTTTTCCTGGTACCTGCACAATGTC
TACCCAGAGATGTTTGTTCCTGACCTGACGCCCACCTTCTATGGTGCCATCAAGAACCTCGGCACCAACCAATGCCTGGATGTGGGTGAG
AACAACCGCGGGGGGAAGCCCCTCATCATGTACTCCTGCCACGGCCTTGGCGGCAACCAGTACTTTGAGTACACAACTCAGAGGGACCTT
CGCCACAACATCGCAAAGCAGCTGTGTCTACATGTCAGCAAGGGTGCTCTGGGCCTTGGGAGCTGTCACTTCACTGGCAAGAATAGCCAG
GTCCCCAAGGACGAGGAATGGGAATTGGCCCAGGATCAGCTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCCCAGGACAAAAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_XYLT1_ENST00000261381_chr16_17292069_-_GALNT6_ENST00000543196_chr12_51771151_-_5884nt
GCGGCCGCGGGAGCTGCGGGGAGCGCGGGGGCGGCCCGGAGCGTGCCGGGGTCCCCGCGCCTCGCTCGCCGGCCGCGCTCCGAAGATGGT
GGCGGCGCCGTGCGCCCGGAGGCTGGCCCGGCGCTCGCACTCGGCGCTGCTCGCGGCGCTCACGGTGCTGCTGCTGCAGACGCTGGTCGT
GTGGAATTTCAGCAGCCTCGACTCCGGGGCCGGGGAGCGCCGCGGGGGCGCAGCGGTCGGCGGCGGGGAGCAGCCGCCCCCGGCCCCGGC
CCCGCGCCGGGAGCGCCGGGACCTGCCCGCCGAGCCGGCTGCAGCCCGAGGAGGAGGAGGAGGCGGCGGCGGAGGAGGAGGAGGACGGGG
GCCCCAGGCGCGGGCGCGGGGAGGCGGCCCCGGAGAACCGCGGGGACAGCAGCCGGCCAGCCGGGGGGCACTGCCCGCCCGGGCTCTGGA
TCCACACCCAAGTCCGCTCATCACCCTGGAGACTCAGGATGGCTACTTTTCTCATCGGCCGAAAGAGAAAGTGCGAACAGACAGCAACAA
CGAGAACTCTGTCCCCAAAGACTTTGAGAATGTCGACAACAGCAACTTCGCACCCAGGACTCAAAAGCAGAAGCACCAGCCTGAGTTGGC
GAAGAAGCCACCGAGTAGACAGAAGGAGCTTTTGAAAAGGAAGCTGGAACAGCAGGAGAAAGGAAAAGGACATACATTCCCTGGGAAAGG
CCCCGGTGAGGTGCTGCCTCCCGGGGACAGAGCCGCAGCCAACAGCAGCCACGGGAAGGATGTGTCCAGACCGCCTCATGCCAGGAAAAC
TGGGGGCAGCTCCCCCGAGACCAAGTATGACCAGCCCCCTAAGTGTGACATCTCAGGCAAGGAGGCCATCTCTGCCCTGTCCCGTGCTAA
GTCCAAGCACTGCCGCCAGGAGATTGGGGAGACTTACTGCCGCCACAAGTTAGGGCTGCTGATGCCTGAGAAGGTGACTCGGTTCTGCCC
CCTCGAGGGTAAAGCCAACAAGAACGTGCAGTGGGACGAGGACTCCGTGGAGTACATGCCAGCCAACCCGGTCAGAATCGCCTTTGTCCT
GGTGGTCCACGGCCGTGCCTCTCGGCAGTTGCAGCGCATGTTCAAGGCCATCTACCACAAAGACCACTTCTACTACATCCACGTGGACAA
GCGCTCTAATTACCTGCATCGGCAAGTGCTCCAGGTCTCCAGGCAGTACAGCAATGTCCGCGTCACCCCCTGGAGAATGGCCACCATCTG
GGGAGGAGCCAGCCTCCTGTCCACCTACCTGCAGAGCATGCGGGACCTCCTGGAGATGACCGACTGGCCCTGGGACTTCTTCATCAACCT
GAGTGCGGCCGACTACCCCATCAGGTGTGTGGACCAGAAGTTCCGGCGCTGCCCCCCACTGGCCACCACCAGCGTGATCATTGTGTTCCA
CAACGAAGCCTGGTCCACACTGCTGCGAACAGTGTACAGCGTCCTACACACCACCCCTGCCATCTTGCTCAAGGAGATCATACTGGTGGA
TGATGCCAGCACAGAGGAGCACCTAAAGGAGAAGCTGGAGCAGTACGTGAAGCAGCTGCAGGTGGTGAGGGTGGTGCGGCAGGAGGAGCG
GAAGGGGCTGATCACCGCCCGGCTGCTGGGGGCCAGCGTGGCACAGGCGGAGGTGCTCACGTTCCTGGATGCCCACTGTGAGTGCTTCCA
CGGCTGGCTGGAGCCCCTCCTGGCTCGAATCGCTGAGGACAAGACAGTGGTGGTGAGCCCAGACATCGTCACCATCGACCTTAATACTTT
TGAGTTCGCCAAGCCCGTCCAGAGGGGCAGAGTCCATAGCCGAGGCAACTTTGACTGGAGCCTGACCTTCGGCTGGGAAACACTTCCTCC
ACATGAGAAGCAGAGGCGCAAGGATGAAACCTACCCCATCAAATCCCCGACGTTTGCTGGTGGCCTCTTCTCCATCTCCAAGTCCTACTT
TGAGCACATCGGTACCTATGATAATCAGATGGAGATCTGGGGAGGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGTGGGGGCCA
GCTGGAGATCATCCCCTGCTCTGTCGTAGGCCATGTGTTCCGGACCAAGAGCCCCCACACCTTCCCCAAGGGCACTAGTGTCATTGCTCG
CAATCAAGTGCGCCTGGCAGAGGTCTGGATGGACAGCTACAAGAAGATTTTCTATAGGAGAAATCTGCAGGCAGCAAAGATGGCCCAAGA
GAAATCCTTCGGTGACATTTCGGAACGACTGCAGCTGAGGGAACAACTGCACTGTCACAACTTTTCCTGGTACCTGCACAATGTCTACCC
AGAGATGTTTGTTCCTGACCTGACGCCCACCTTCTATGGTGCCATCAAGAACCTCGGCACCAACCAATGCCTGGATGTGGGTGAGAACAA
CCGCGGGGGGAAGCCCCTCATCATGTACTCCTGCCACGGCCTTGGCGGCAACCAGTACTTTGAGTACACAACTCAGAGGGACCTTCGCCA
CAACATCGCAAAGCAGCTGTGTCTACATGTCAGCAAGGGTGCTCTGGGCCTTGGGAGCTGTCACTTCACTGGCAAGAATAGCCAGGTCCC
CAAGGACGAGGAATGGGAATTGGCCCAGGATCAGCTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCCCAGGACAAAAAGCCAGC
CATGGCCCCCTGCAATCCCAGTGACCCCCATCAGTTGTGGCTCTTTGTCTAGGACCCAGATCATCCCCAGAGAGAGCCCCCACAAGCTCC
TCAGGAAACAGGATTGCTGATGTCTGGGAACCTGATCACCAGCTTCTCTGGAGGCCGTAAAGATGGATTTCTAAACCCACTGGGTGGCAA
GGCAGGACCTTCCTAATCCTTGCAACAACATTGGGCCCATTTTCTTTCCTTCACACCGATGGAAGAGACCATTAGGACATATATTTAGCC
TAGCGTTTTCCTGTTCTAGAAATAGAGGCTCCCAAAGTAGGGAAGGCAGCTGGGGGAGGGTTCAGGGCAGCAATGCTGAGTTCAAGAAAA
GTACTTCAGGCTGGGCACAGTGGCTCATGCCTGAAATCCTAGCACTTTGGGAAGACAATGTGGGAGAATGGCTTGAGCCCAGGAGTTCAA
GACCGGCCTGAGCAACATAGTGAGGATCCCATCTCTACGCCCACCCTCCCCCCGGCAAAAAAAAAAAGCTGGGTATGGTGGCTTATGCCT
GTAGTCGCAGCTACTCAGAAGGCTGAGGTGGGAGGATTGCTTGTTCCCCGGAGGTTGAAGCTACAGTGAGCCTTGATTGTGTCACTGCAC
TCCAGCCTGGGCAACAGGTAAGACTCTGTCTCAAAAAAAAACAAAAAAGAAGAAGAAAAGTACTTCTACAGCCATGTCCTATTCCTTGAT
CATCCAAAGCACCTGCAGAGTCCAGTGAAATGATATATTCTGGCTGGGCACAGTGGCTCACACCTGTAATCCTAGCACTTTGGGAGGCCA
AGGCAGGTGGATCACCTGAGGTCAGAAGTTTGAAACCAGCCTGGACTACATGGTGAAACTCCATCTCTACTAAAAGTACAAAAATTAGCT
GGGCATGATGGCACGCACCTGCAGTCCCAGCTACTTGGGAGGCTGAGGCAGGAGAATCACTCGAACCCAGGAGGCAGAGGTTGCAGTGAG
CCAAGACAGCACCATTGCACCCCAGCCTGAGCAACAAGAGCGAAACTCCATCTCAGGAAAAAAAAAAAAAAAAAAAGTATATTCTAACAG
ACAGATCAGAGGTCTAAGAGATCCTCCCTTGCTATTATTACCTGAAGTCTGTAGAACTGTTTACAGATATCTCCTTGACAGGTGTCCTTT
ATCTTACTTTATCTGTACAGTAATCCTGTGAGAAAGACAGGACAGAAACCACTGTGCCTATTTTACAGATACGAAAACTGAGACACAGGT
AAAGGGGCTTGTCTGTAGTCCCATAGCTAGCAGATGGCTGGAGCCAAGACTGAGGCTCGTTCTTCAATGCTGAGCCAGGGCTCCTTCCGC
TGCACCACAAGAACGCTAGACCACTCGCCACCAGCCTTCTCATTCCCTCTTCCTCCATTCTAATCATTTCTAGCTGGCTGGCCTCCACAG
AGCATAGGAAAACAGCCAGGGCCGGGCACGGTGGCTCATGCCTGTAATCTCAACACTCTGGGAGGCCGAGCCGGGTGGATAACCTGAGGT
CAGGAATTCGAGACCAGCCTGGCCAACATGGTAAAACCCCATCTCTACTAAAAATATAAAAATTAGCCAGGCATGGTGGCGCACACCTGT
AATCCCAGCTACTCAAGAGGCTGAGGCAGGAGAATTGCTTAAATCTGGGAGGCGGAAGTTGCAGTGAGCCAAGATCGCGCCACTGAACTC
CAGCCTAGGCAACAAGAGCAAAACTCCATCTCCAAAAAAAAGAAAGGAAAAACAGGGCCAGGTAGCCATTGTGGAGAGAGCACACTTAGG
AATCCTGGGATGTTAGTGTTAAAAGAAAGCTCCTGGAGCCAGTGATTCTCAGGTTTGTCCCAGAACCCTTTTTTCTAAGCCCCATATAAA
AGGTAGATTAAAAAAACAAAGTAGCATGAGTGAAATTGAGAGAGGGACAGGTAATGCCTTCCAGCCCCTAACTTCTAACAATCTGGAAGC
ACAACGTGAAAATCACGTAGCCCAACCCTATCATTTTCATATTATGAAACTGAGTCCAGGTAAGTGAATCTGTCCAAGGTCACCCAGCAA
GGTATCAGTAGCCCTGAGGGTAAGGACTCTGATAAGGCTCGGGAGGGTCCTGGAAAGCCTGAGGCGGCAGGAAGAGTGTGCAGAGTTGAG
CGTGTCTGGAAGGCTGATCCACTGCTGGGCCCACATCAAAGCCCCCATGGGGAGCAGACCCGACTGCACATGGCTCTTTTGCTGGAAGAA
GAGCATGGCTGCGCAGAGGACTAAAATTTCATCTGGGAAGGCTTCTTTTGACTGTCAGTAGCAGGATGTCACCAGATGAGGGTGCTATGG
GACCACAGCTGTCTTTGTTCCCATTGCAACTCAACCCTGCGGGAGGCCGCCTACATCCCTGAGAGCCTTCTGGAGCCTACAGAGGAGACA
TTGGCCAGCCAAAAGGAAAGGAGTGGCCAGGGTACGACCTGGAGTAGGGAAGGGAAAAAGTTCCCGGAAAGAAGAGAATTGGATGAGAGG
TCTCAGTGGAAATAAAGGTTTTCTGGCATTGGTCAAGGAAACTCGCGTTGTGTTCTCTTACCTGTGTTGTCCCTTAGCTGAATCAGTTGA
TTTGGGCTATGAAGAACCACACACATCTGAAAAGTTCTGTTACAGCCACTGTCTCATGTCCCCAAACATTCTCTGGCCCTAAATCTAGCT
TATGTATTGTGTCAAGCACGTGGAGACGTGAGACGTCAAACGAGGTCCTGTCCCCGTGGAACTCACACGCTAAATGTAAGCAAATCATAG
CAAGCCTGGAGATGCTCCAAGAGGTGCTGGATGAGTTAGAAGGAGCAATTCCTTCCACTTAGGGAATCAGATAAGGCCTCACAAAGATGG
CAATGTTTGACCTAAGACCTCGGAAGATGAGTCCTCAGATGGGAAGGGCTCAATAAGCAGAGTTGTTACACAGGCAGCAGCCTGGCAGGA
GCAAAGCCACAGAGGACATGTGGCCCCAGTGGGTCTGAGAAACCCAGAGGACATTGGGGTGAGGGAGTGACTGGTGTAGAAGCTGGAAGA
TCAGAGTTACATCATGAATTTCAGGGGCCCTAGGCACTTTAGCCTTCACGGAGCTCTTGCTCCATTCAAAAAAAAATTAATGTTATGACT

>In-frame_XYLT1_ENST00000261381_chr16_17292069_-_GALNT6_ENST00000356317_chr12_51771151_-_3378nt
GCGGCCGCGGGAGCTGCGGGGAGCGCGGGGGCGGCCCGGAGCGTGCCGGGGTCCCCGCGCCTCGCTCGCCGGCCGCGCTCCGAAGATGGT
GGCGGCGCCGTGCGCCCGGAGGCTGGCCCGGCGCTCGCACTCGGCGCTGCTCGCGGCGCTCACGGTGCTGCTGCTGCAGACGCTGGTCGT
GTGGAATTTCAGCAGCCTCGACTCCGGGGCCGGGGAGCGCCGCGGGGGCGCAGCGGTCGGCGGCGGGGAGCAGCCGCCCCCGGCCCCGGC
CCCGCGCCGGGAGCGCCGGGACCTGCCCGCCGAGCCGGCTGCAGCCCGAGGAGGAGGAGGAGGCGGCGGCGGAGGAGGAGGAGGACGGGG
GCCCCAGGCGCGGGCGCGGGGAGGCGGCCCCGGAGAACCGCGGGGACAGCAGCCGGCCAGCCGGGGGGCACTGCCCGCCCGGGCTCTGGA
TCCACACCCAAGTCCGCTCATCACCCTGGAGACTCAGGATGGCTACTTTTCTCATCGGCCGAAAGAGAAAGTGCGAACAGACAGCAACAA
CGAGAACTCTGTCCCCAAAGACTTTGAGAATGTCGACAACAGCAACTTCGCACCCAGGACTCAAAAGCAGAAGCACCAGCCTGAGTTGGC
GAAGAAGCCACCGAGTAGACAGAAGGAGCTTTTGAAAAGGAAGCTGGAACAGCAGGAGAAAGGAAAAGGACATACATTCCCTGGGAAAGG
CCCCGGTGAGGTGCTGCCTCCCGGGGACAGAGCCGCAGCCAACAGCAGCCACGGGAAGGATGTGTCCAGACCGCCTCATGCCAGGAAAAC
TGGGGGCAGCTCCCCCGAGACCAAGTATGACCAGCCCCCTAAGTGTGACATCTCAGGCAAGGAGGCCATCTCTGCCCTGTCCCGTGCTAA
GTCCAAGCACTGCCGCCAGGAGATTGGGGAGACTTACTGCCGCCACAAGTTAGGGCTGCTGATGCCTGAGAAGGTGACTCGGTTCTGCCC
CCTCGAGGGTAAAGCCAACAAGAACGTGCAGTGGGACGAGGACTCCGTGGAGTACATGCCAGCCAACCCGGTCAGAATCGCCTTTGTCCT
GGTGGTCCACGGCCGTGCCTCTCGGCAGTTGCAGCGCATGTTCAAGGCCATCTACCACAAAGACCACTTCTACTACATCCACGTGGACAA
GCGCTCTAATTACCTGCATCGGCAAGTGCTCCAGGTCTCCAGGCAGTACAGCAATGTCCGCGTCACCCCCTGGAGAATGGCCACCATCTG
GGGAGGAGCCAGCCTCCTGTCCACCTACCTGCAGAGCATGCGGGACCTCCTGGAGATGACCGACTGGCCCTGGGACTTCTTCATCAACCT
GAGTGCGGCCGACTACCCCATCAGGTGTGTGGACCAGAAGTTCCGGCGCTGCCCCCCACTGGCCACCACCAGCGTGATCATTGTGTTCCA
CAACGAAGCCTGGTCCACACTGCTGCGAACAGTGTACAGCGTCCTACACACCACCCCTGCCATCTTGCTCAAGGAGATCATACTGGTGGA
TGATGCCAGCACAGAGGAGCACCTAAAGGAGAAGCTGGAGCAGTACGTGAAGCAGCTGCAGGTGGTGAGGGTGGTGCGGCAGGAGGAGCG
GAAGGGGCTGATCACCGCCCGGCTGCTGGGGGCCAGCGTGGCACAGGCGGAGGTGCTCACGTTCCTGGATGCCCACTGTGAGTGCTTCCA
CGGCTGGCTGGAGCCCCTCCTGGCTCGAATCGCTGAGGACAAGACAGTGGTGGTGAGCCCAGACATCGTCACCATCGACCTTAATACTTT
TGAGTTCGCCAAGCCCGTCCAGAGGGGCAGAGTCCATAGCCGAGGCAACTTTGACTGGAGCCTGACCTTCGGCTGGGAAACACTTCCTCC
ACATGAGAAGCAGAGGCGCAAGGATGAAACCTACCCCATCAAATCCCCGACGTTTGCTGGTGGCCTCTTCTCCATCTCCAAGTCCTACTT
TGAGCACATCGGTACCTATGATAATCAGATGGAGATCTGGGGAGGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGTGGGGGCCA
GCTGGAGATCATCCCCTGCTCTGTCGTAGGCCATGTGTTCCGGACCAAGAGCCCCCACACCTTCCCCAAGGGCACTAGTGTCATTGCTCG
CAATCAAGTGCGCCTGGCAGAGGTCTGGATGGACAGCTACAAGAAGATTTTCTATAGGAGAAATCTGCAGGCAGCAAAGATGGCCCAAGA
GAAATCCTTCGGTGACATTTCGGAACGACTGCAGCTGAGGGAACAACTGCACTGTCACAACTTTTCCTGGTACCTGCACAATGTCTACCC
AGAGATGTTTGTTCCTGACCTGACGCCCACCTTCTATGGTGCCATCAAGAACCTCGGCACCAACCAATGCCTGGATGTGGGTGAGAACAA
CCGCGGGGGGAAGCCCCTCATCATGTACTCCTGCCACGGCCTTGGCGGCAACCAGTACTTTGAGTACACAACTCAGAGGGACCTTCGCCA
CAACATCGCAAAGCAGCTGTGTCTACATGTCAGCAAGGGTGCTCTGGGCCTTGGGAGCTGTCACTTCACTGGCAAGAATAGCCAGGTCCC
CAAGGACGAGGAATGGGAATTGGCCCAGGATCAGCTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCCCAGGACAAAAAGCCAGC
CATGGCCCCCTGCAATCCCAGTGACCCCCATCAGTTGTGGCTCTTTGTCTAGGACCCAGATCATCCCCAGAGAGAGCCCCCACAAGCTCC
TCAGGAAACAGGATTGCTGATGTCTGGGAACCTGATCACCAGCTTCTCTGGAGGCCGTAAAGATGGATTTCTAAACCCACTGGGTGGCAA
GGCAGGACCTTCCTAATCCTTGCAACAACATTGGGCCCATTTTCTTTCCTTCACACCGATGGAAGAGACCATTAGGACATATATTTAGCC
TAGCGTTTTCCTGTTCTAGAAATAGAGGCTCCCAAAGTAGGGAAGGCAGCTGGGGGAGGGTTCAGGGCAGCAATGCTGAGTTCAAGAAAA
GTACTTCAGGCTGGGCACAGTGGCTCATGCCTGAAATCCTAGCACTTTGGGAAGACAATGTGGGAGAATGGCTTGAGCCCAGGAGTTCAA
GACCGGCCTGAGCAACATAGTGAGGATCCCATCTCTACGCCCACCCTCCCCCCGGCAAAAAAAAAAAGCTGGGTATGGTGGCTTATGCCT
GTAGTCGCAGCTACTCAGAAGGCTGAGGTGGGAGGATTGCTTGTTCCCCGGAGGTTGAAGCTACAGTGAGCCTTGATTGTGTCACTGCAC


Top

FusionGenePPI for XYLT1_GALNT6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
XYLT1MYC, ADH1C, MEF2AGALNT6TMEM9, TAF9, ALDOA, SLC5A6, NDUFAF6, ATP2B3, ASPHD2, NDUFB6, SLC30A1, NDUFB8, ATP2B2, NDUFA12, EDEM1, NDUFS6, GAS6, FAM20B, B4GALT3, NDUFB5, NDUFS4, RMND1, SLC9A1, SLC39A10, PLXNA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for XYLT1_GALNT6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for XYLT1_GALNT6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneXYLT1C4014294DESBUQUOIS DYSPLASIA 22UNIPROT
HgeneXYLT1C0033847Pseudoxanthoma Elasticum1CTD_human;UNIPROT
HgeneXYLT1C0236969Substance-Related Disorders1CTD_human