FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42161

FusionGeneSummary for XPA_CORO2A

check button Fusion gene summary
Fusion gene informationFusion gene name: XPA_CORO2A
Fusion gene ID: 42161
HgeneTgene
Gene symbol

XPA

CORO2A

Gene ID

7507

7464

Gene nameXPA, DNA damage recognition and repair factorcoronin 2A
SynonymsXP1|XPACCLIPINB|IR10|WDR2
Cytomap

9q22.33

9q22.33

Type of geneprotein-codingprotein-coding
DescriptionDNA repair protein complementing XP-A cellsxeroderma pigmentosum group A-complementing proteinxeroderma pigmentosum, complementation group Acoronin-2AWD protein IR10WD repeat-containing protein 2WD-repeat protein 2coronin, actin binding protein, 2Acoronin-like protein B
Modification date2018052320180519
UniProtAcc

P23025

Q92828

Ensembl transtripts involved in fusion geneENST00000375128, ENST00000485042, 
ENST00000343933, ENST00000375077, 
Fusion gene scores* DoF score1 X 1 X 1=14 X 4 X 3=48
# samples 14
** MAII scorelog2(1/1*10)=3.32192809488736log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: XPA [Title/Abstract] AND CORO2A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneXPA

GO:0006281

DNA repair

1601884

HgeneXPA

GO:0009650

UV protection

1601884


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-96-A4JK-01AXPAchr9

100449378

-CORO2Achr9

100919942

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375128ENST00000343933XPAchr9

100449378

-CORO2Achr9

100919942

-
In-frameENST00000375128ENST00000375077XPAchr9

100449378

-CORO2Achr9

100919942

-
intron-3CDSENST00000485042ENST00000343933XPAchr9

100449378

-CORO2Achr9

100919942

-
intron-3CDSENST00000485042ENST00000375077XPAchr9

100449378

-CORO2Achr9

100919942

-

Top

FusionProtFeatures for XPA_CORO2A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
XPA

P23025

CORO2A

Q92828

Involved in DNA excision repair. Initiates repair bybinding to damaged sites with various affinities, depending on thephotoproduct and the transcriptional state of the region. Requiredfor UV-induced CHEK1 phosphorylation and the recruitment of CEP164to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage afterUV irradiation. {ECO:0000269|PubMed:19197159}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXPAchr9:100449378chr9:100919942ENST00000375128-4678_84185274Compositional biasNote=Poly-Glu
HgeneXPAchr9:100449378chr9:100919942ENST00000375128-4626_47185274MotifNuclear localization signal
HgeneXPAchr9:100449378chr9:100919942ENST00000375128-46105_129185274Zinc finger.
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-012485_5240526Coiled coilOntology_term=ECO:0000255
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-012485_5240526Coiled coilOntology_term=ECO:0000255
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-012123_1700526RepeatNote=WD 3
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-012171_2140526RepeatNote=WD 4
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-012215_2590526RepeatNote=WD 5
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-01224_710526RepeatNote=WD 1
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-012260_3050526RepeatNote=WD 6
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-012306_3420526RepeatNote=WD 7
TgeneCORO2Achr9:100449378chr9:100919942ENST00000343933-01272_1220526RepeatNote=WD 2
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-012123_1700526RepeatNote=WD 3
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-012171_2140526RepeatNote=WD 4
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-012215_2590526RepeatNote=WD 5
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-01224_710526RepeatNote=WD 1
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-012260_3050526RepeatNote=WD 6
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-012306_3420526RepeatNote=WD 7
TgeneCORO2Achr9:100449378chr9:100919942ENST00000375077-01272_1220526RepeatNote=WD 2

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for XPA_CORO2A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_XPA_ENST00000375128_chr9_100449378_-_CORO2A_ENST00000343933_chr9_100919942_-_711aa
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKV
VHQPGPVMEFDTVICEECGKEFMDSTLMNHFDLPTCDNCRDADDKHKLITKTEAKQETLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQMSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNV
LDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFSAGTDYKVMIWNLDTKESVITSPMST
ISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEE
DLDGSSGVLFPFTDADTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSTNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISM
IVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLL

>In-frame_XPA_ENST00000375128_chr9_100449378_-_CORO2A_ENST00000375077_chr9_100919942_-_711aa
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKV
VHQPGPVMEFDTVICEECGKEFMDSTLMNHFDLPTCDNCRDADDKHKLITKTEAKQETLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQMSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNV
LDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFSAGTDYKVMIWNLDTKESVITSPMST
ISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEE
DLDGSSGVLFPFTDADTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSTNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISM
IVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_XPA_ENST00000375128_chr9_100449378_-_CORO2A_ENST00000343933_chr9_100919942_-_2133nt
ATGGCGGCGGCCGACGGGGCTTTGCCGGAGGCGGCGGCTTTAGAGCAACCCGCGGAGCTGCCTGCCTCGGTGCGGGCGAGTATCGAGCGG
AAGCGGCAGCGGGCACTGATGCTGCGCCAGGCCCGGCTGGCTGCCCGGCCCTACTCGGCGACGGCGGCTGCGGCTACTGGAGGCATGGCT
AATGTAAAAGCAGCCCCAAAGATAATTGACACAGGAGGAGGCTTCATTTTAGAAGAGGAAGAAGAAGAAGAACAGAAAATTGGAAAAGTT
GTTCATCAACCAGGACCTGTTATGGAATTTGATTATGTAATATGCGAAGAATGTGGGAAAGAATTTATGGATTCTTATCTTATGAACCAC
TTTGATTTGCCAACTTGTGATAACTGCAGAGATGCTGATGATAAACACAAGCTTATAACCAAAACAGAGGCAAAACAAGAATATCTTCTG
AAAGACTGTGATTTAGAAAAAAGAGAGCCACCTCTTAAATTTATTGTGAAGAAGAATCCACATCATTCACAATGGGGTGATATGAAACTC
TACTTAAAGTTACAGATGTCATGGCACCCCCAGTACCGGAGCTCCAAGTTCCGTCATGTCTTTGGCAAACCAGCCAGCAAGGAGAACTGC
TACGACTCCGTGCCTATCACCCGCAGCGTTCACGACAACCACTTCTGTGCCGTGAACCCCCACTTCATTGCAGTTGTGACTGAGTGTGCT
GGTGGAGGGGCCTTCCTCGTCATCCCCCTGCACCAGACAGGGAAGTTGGACCCCCACTACCCAAAAGTCTGCGGGCACAGAGGCAACGTT
TTGGATGTCAAGTGGAACCCTTTTGATGATTTTGAGATCGCCTCCTGTTCTGAAGATGCCACAATTAAGATCTGGAGCATCCCCAAGCAG
CTGCTGACCAGGAACCTCACGGCCTACAGGAAGGAACTCGTGGGCCACGCGCGCAGAGTAGGCCTGGTGGAGTGGCACCCCACGGCCGCC
AACATCCTCTTCAGTGCTGGCTATGACTACAAGGTGATGATCTGGAACCTGGATACAAAGGAGTCTGTCATCACAAGCCCCATGAGTACG
ATTAGCTGTCACCAAGATGTGATCCTCTCCATGTCCTTCAACACCAACGGCAGCCTGTTGGCCACCACCTGCAAAGACCGCAAGATTCGG
GTTATTGACCCCCGAGCAGGGACCGTCCTCCAGGAGGCCAGCTACAAAGGGCACCGGGCCAGCAAAGTGCTGTTTCTGGGGAACCTGAAG
AAGCTGATGTCCACAGGCACATCCCGATGGAACAACCGGCAGGTGGCCTTGTGGGACCAGGATAACCTCTCTGTGCCTCTGATGGAGGAG
GACCTGGACGGCTCCTCGGGCGTGCTGTTTCCCTTCTATGACGCGGACACCAGCATGCTCTACGTGGTGGGGAAGGGAGATGGCAACATC
CGCTACTACGAGGTGAGCGCCGACAAGCCTCACCTGAGCTACCTGACTGAGTACCGCTCCTATAACCCACAGAAGGGGATCGGTGTCATG
CCAAAGAGAGGACTCGACGTGTCCTCCTGCGAGATCTTCCGCTTCTACAAGCTGATCACAACCAAAAGCCTCATCGAGCCCATCTCCATG
ATTGTGCCCCGGCGGTCAGAATCCTACCAAGAGGACATATACCCTCCAACAGCAGGGGCCCAGCCCTCCCTGACGGCCCAGGAGTGGCTC
AGCGGGATGAATCGAGACCCAATCCTGGTGTCCCTTAGGCCTGGCTCTGAGCTGCTGAGACCCCACCCACTGCCTGCAGAGAGACCTATC
TTCAATTCCATGGCCCCAGCCTCACCCCGGCTCTTGAATCAGACAGAAAAGCTGGCTGCAGAAGATGGCTGGAGGTCTTCCTCCCTGTTG
GAGGAGAAGATGCCAAGGTGGGCAGCAGAACACAGGCTGGAGGAGAAGAAAACCTGGCTGACAAATGGCTTTGACGTTTTCGAATGCCCC
CCACCAAAGACAGAGAATGAGTTGCTGCAGATGTTCTACCGGCAACAGGAGGAGATCCGAAGGCTCCGGGAGCTGTTGACCCAGCGAGAG

>In-frame_XPA_ENST00000375128_chr9_100449378_-_CORO2A_ENST00000375077_chr9_100919942_-_2133nt
ATGGCGGCGGCCGACGGGGCTTTGCCGGAGGCGGCGGCTTTAGAGCAACCCGCGGAGCTGCCTGCCTCGGTGCGGGCGAGTATCGAGCGG
AAGCGGCAGCGGGCACTGATGCTGCGCCAGGCCCGGCTGGCTGCCCGGCCCTACTCGGCGACGGCGGCTGCGGCTACTGGAGGCATGGCT
AATGTAAAAGCAGCCCCAAAGATAATTGACACAGGAGGAGGCTTCATTTTAGAAGAGGAAGAAGAAGAAGAACAGAAAATTGGAAAAGTT
GTTCATCAACCAGGACCTGTTATGGAATTTGATTATGTAATATGCGAAGAATGTGGGAAAGAATTTATGGATTCTTATCTTATGAACCAC
TTTGATTTGCCAACTTGTGATAACTGCAGAGATGCTGATGATAAACACAAGCTTATAACCAAAACAGAGGCAAAACAAGAATATCTTCTG
AAAGACTGTGATTTAGAAAAAAGAGAGCCACCTCTTAAATTTATTGTGAAGAAGAATCCACATCATTCACAATGGGGTGATATGAAACTC
TACTTAAAGTTACAGATGTCATGGCACCCCCAGTACCGGAGCTCCAAGTTCCGTCATGTCTTTGGCAAACCAGCCAGCAAGGAGAACTGC
TACGACTCCGTGCCTATCACCCGCAGCGTTCACGACAACCACTTCTGTGCCGTGAACCCCCACTTCATTGCAGTTGTGACTGAGTGTGCT
GGTGGAGGGGCCTTCCTCGTCATCCCCCTGCACCAGACAGGGAAGTTGGACCCCCACTACCCAAAAGTCTGCGGGCACAGAGGCAACGTT
TTGGATGTCAAGTGGAACCCTTTTGATGATTTTGAGATCGCCTCCTGTTCTGAAGATGCCACAATTAAGATCTGGAGCATCCCCAAGCAG
CTGCTGACCAGGAACCTCACGGCCTACAGGAAGGAACTCGTGGGCCACGCGCGCAGAGTAGGCCTGGTGGAGTGGCACCCCACGGCCGCC
AACATCCTCTTCAGTGCTGGCTATGACTACAAGGTGATGATCTGGAACCTGGATACAAAGGAGTCTGTCATCACAAGCCCCATGAGTACG
ATTAGCTGTCACCAAGATGTGATCCTCTCCATGTCCTTCAACACCAACGGCAGCCTGTTGGCCACCACCTGCAAAGACCGCAAGATTCGG
GTTATTGACCCCCGAGCAGGGACCGTCCTCCAGGAGGCCAGCTACAAAGGGCACCGGGCCAGCAAAGTGCTGTTTCTGGGGAACCTGAAG
AAGCTGATGTCCACAGGCACATCCCGATGGAACAACCGGCAGGTGGCCTTGTGGGACCAGGATAACCTCTCTGTGCCTCTGATGGAGGAG
GACCTGGACGGCTCCTCGGGCGTGCTGTTTCCCTTCTATGACGCGGACACCAGCATGCTCTACGTGGTGGGGAAGGGAGATGGCAACATC
CGCTACTACGAGGTGAGCGCCGACAAGCCTCACCTGAGCTACCTGACTGAGTACCGCTCCTATAACCCACAGAAGGGGATCGGTGTCATG
CCAAAGAGAGGACTCGACGTGTCCTCCTGCGAGATCTTCCGCTTCTACAAGCTGATCACAACCAAAAGCCTCATCGAGCCCATCTCCATG
ATTGTGCCCCGGCGGTCAGAATCCTACCAAGAGGACATATACCCTCCAACAGCAGGGGCCCAGCCCTCCCTGACGGCCCAGGAGTGGCTC
AGCGGGATGAATCGAGACCCAATCCTGGTGTCCCTTAGGCCTGGCTCTGAGCTGCTGAGACCCCACCCACTGCCTGCAGAGAGACCTATC
TTCAATTCCATGGCCCCAGCCTCACCCCGGCTCTTGAATCAGACAGAAAAGCTGGCTGCAGAAGATGGCTGGAGGTCTTCCTCCCTGTTG
GAGGAGAAGATGCCAAGGTGGGCAGCAGAACACAGGCTGGAGGAGAAGAAAACCTGGCTGACAAATGGCTTTGACGTTTTCGAATGCCCC
CCACCAAAGACAGAGAATGAGTTGCTGCAGATGTTCTACCGGCAACAGGAGGAGATCCGAAGGCTCCGGGAGCTGTTGACCCAGCGAGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_XPA_ENST00000375128_chr9_100449378_-_CORO2A_ENST00000343933_chr9_100919942_-_5997nt
GGCTCGCCTCGGCGTGCAGTGCGCGTGCGTGGAGCTGGGAGCTAGGTCCTCGGAGTGGGCCAGAGATGGCGGCGGCCGACGGGGCTTTGC
CGGAGGCGGCGGCTTTAGAGCAACCCGCGGAGCTGCCTGCCTCGGTGCGGGCGAGTATCGAGCGGAAGCGGCAGCGGGCACTGATGCTGC
GCCAGGCCCGGCTGGCTGCCCGGCCCTACTCGGCGACGGCGGCTGCGGCTACTGGAGGCATGGCTAATGTAAAAGCAGCCCCAAAGATAA
TTGACACAGGAGGAGGCTTCATTTTAGAAGAGGAAGAAGAAGAAGAACAGAAAATTGGAAAAGTTGTTCATCAACCAGGACCTGTTATGG
AATTTGATTATGTAATATGCGAAGAATGTGGGAAAGAATTTATGGATTCTTATCTTATGAACCACTTTGATTTGCCAACTTGTGATAACT
GCAGAGATGCTGATGATAAACACAAGCTTATAACCAAAACAGAGGCAAAACAAGAATATCTTCTGAAAGACTGTGATTTAGAAAAAAGAG
AGCCACCTCTTAAATTTATTGTGAAGAAGAATCCACATCATTCACAATGGGGTGATATGAAACTCTACTTAAAGTTACAGATGTCATGGC
ACCCCCAGTACCGGAGCTCCAAGTTCCGTCATGTCTTTGGCAAACCAGCCAGCAAGGAGAACTGCTACGACTCCGTGCCTATCACCCGCA
GCGTTCACGACAACCACTTCTGTGCCGTGAACCCCCACTTCATTGCAGTTGTGACTGAGTGTGCTGGTGGAGGGGCCTTCCTCGTCATCC
CCCTGCACCAGACAGGGAAGTTGGACCCCCACTACCCAAAAGTCTGCGGGCACAGAGGCAACGTTTTGGATGTCAAGTGGAACCCTTTTG
ATGATTTTGAGATCGCCTCCTGTTCTGAAGATGCCACAATTAAGATCTGGAGCATCCCCAAGCAGCTGCTGACCAGGAACCTCACGGCCT
ACAGGAAGGAACTCGTGGGCCACGCGCGCAGAGTAGGCCTGGTGGAGTGGCACCCCACGGCCGCCAACATCCTCTTCAGTGCTGGCTATG
ACTACAAGGTGATGATCTGGAACCTGGATACAAAGGAGTCTGTCATCACAAGCCCCATGAGTACGATTAGCTGTCACCAAGATGTGATCC
TCTCCATGTCCTTCAACACCAACGGCAGCCTGTTGGCCACCACCTGCAAAGACCGCAAGATTCGGGTTATTGACCCCCGAGCAGGGACCG
TCCTCCAGGAGGCCAGCTACAAAGGGCACCGGGCCAGCAAAGTGCTGTTTCTGGGGAACCTGAAGAAGCTGATGTCCACAGGCACATCCC
GATGGAACAACCGGCAGGTGGCCTTGTGGGACCAGGATAACCTCTCTGTGCCTCTGATGGAGGAGGACCTGGACGGCTCCTCGGGCGTGC
TGTTTCCCTTCTATGACGCGGACACCAGCATGCTCTACGTGGTGGGGAAGGGAGATGGCAACATCCGCTACTACGAGGTGAGCGCCGACA
AGCCTCACCTGAGCTACCTGACTGAGTACCGCTCCTATAACCCACAGAAGGGGATCGGTGTCATGCCAAAGAGAGGACTCGACGTGTCCT
CCTGCGAGATCTTCCGCTTCTACAAGCTGATCACAACCAAAAGCCTCATCGAGCCCATCTCCATGATTGTGCCCCGGCGGTCAGAATCCT
ACCAAGAGGACATATACCCTCCAACAGCAGGGGCCCAGCCCTCCCTGACGGCCCAGGAGTGGCTCAGCGGGATGAATCGAGACCCAATCC
TGGTGTCCCTTAGGCCTGGCTCTGAGCTGCTGAGACCCCACCCACTGCCTGCAGAGAGACCTATCTTCAATTCCATGGCCCCAGCCTCAC
CCCGGCTCTTGAATCAGACAGAAAAGCTGGCTGCAGAAGATGGCTGGAGGTCTTCCTCCCTGTTGGAGGAGAAGATGCCAAGGTGGGCAG
CAGAACACAGGCTGGAGGAGAAGAAAACCTGGCTGACAAATGGCTTTGACGTTTTCGAATGCCCCCCACCAAAGACAGAGAATGAGTTGC
TGCAGATGTTCTACCGGCAACAGGAGGAGATCCGAAGGCTCCGGGAGCTGTTGACCCAGCGAGAGGTCCAGGCCAAACAGTTGGAACTGG
AGATCAAAAACTTGCGGATGGGCTCAGAGCAGCTCTGAGCAGAGACCTCTGCCCTCCTCACCCTCAGGGACACCACTCGGCTCCATGGGG
AGGTTTAGAACCAAACCACAAGTCCCCTCAAGGACAACCACTATTTCTATATTTTTTACCAGAAAACAAAACTCTCCATCGCTGAAAGAG
ATTCCAGTGGGACATGGTGCCGTTTTTCTGTTTGCCTTCTTGCAACAACAGTTTCTGAATTGACTTTGTTTTCAGATGATGCCTTCTGTT
GAATTCTGTTATTAAGGGCCCATGATGAGCTGTAACTTCTCAAGAGGAAAGAACACAGTAGAAAACTAGAGCTGGAAGGATCTAGGTTGA
CCTGTCTGTGATTTTCAAACTGTGGTCCAGAGAATAGGGGAAGACTGGGCCAGACGCAGTGGCTCATGCCTGTAATCCCAGCACTCTGGG
AGGCTGAGGTGGGCGGATTGCTTGAGGTCGGGAGTTTGAAACCAGTCTCACCAGGCGCAGTGGCTCACGCCTGTAATTCCAGCATGTTGG
GAGGCCGAGGCTGGTGGATCACGAGGTCAGCAGTTCGAGACCAGCCTGACCAACATGGTGAAACCCCATCTCTACTAAAAATACAAAAAA
ATTAGCTGGGCGTGGTGGCAGGCGCCTGTAATTCCAGCGACTTGGGAGGCTGAGGCAGGAGAATTGCTTGAAACCGGAAGGCGGGGGTTG
CAGTGAGCTGAGATTGTGCCACTGCACTCTAACCTGGGCAATAAGAGCAAAAGTCTGTCTCAAAAAAAAAAAAAAAAGAAAGAAACCAGC
CTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAATACAAAAATTAGGCAGGGCGTGGTGGTTCACGCCTATAATCCCAGAACTTTGGG
AGGCCAAGCTGGGCGGATCTTCTGAGGTCAGGAGTTCAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCCACTAAAAATAAAAAAT
TAACCAGGCATGGTGGTGCATGCCTGTAATCCCAGCTATTTGGGAGGCTGAGGCAGGAGAATCGCTTGAGCCTGGGAGGCGGAGGTTGCA
GTGAACCAAGATCATGCCACTTCACTCCAGCCTGGGTGACAGAGTGAGACTCCGTCTCAAAAAAAAAAAGTTGGCCAGCCGTGGTGGTGA
GCGTCTGTAGTCCCTGCTATTCGGGAGGCTGAGATAGGAGAATTGCTTGAACCTGGGAGGTGGAGGTTGCTATGAGCCACGATTGCGGAC
TGCACTGCAGCCTGGGTGACAGAGCGAGACTCCATCTCCAAAAAAAAAAAAAAAAAGAGAGAGAGAATAGGGGAAGACTAAGCAGGAAGG
CTGTGTCTCCCTTCCCCACACTGTATTCCAACCAGACAGCTCCCTTCTATTTTATATGTTGGGCTAGTATGAAAAACAATTCTGCTAGGA
AAAAAAAATTTTTTTAGAAGTTTGAAAGCTAGTGATTTGACCCAAGTTCCTCATTTTACAGCTGGGGAAACTAAGGCCTAGAGAGAGGCA
AGTGATATTTGTTTCATGGCAGGGCTGGGCTGAGATCCTGCTTTTCTGGGTCTGTCTTTTTGCTCTTTTGGGTCTGATGCAGTTCTCAGC
CCAAAGAGTAGAAATCTGTTGCTTCTGGCCTCAGCTGTGCCCCAGCTTACTCAGTGACCTCTTGCAAGTCCTGCCCTCTCTGGTCTCAGT
TTCTTCATCTGAACCAGGGGTACCCTGGAACAAGCTGCTCTCTGCAGGATCTGCCACCTGAAACCTTGACCTAAGAGAAAACTACCTGTG
GGGTGATCTGGGTTTGCTACAGAAACTAACGGACACTGGCAAGGGGTCAGAGGCATTCAACCCAATTCTACAACACAGGCAGGTGGTCAA
AACCAACCTTTCCAACCAGAATCAGCCTGATATGGATAGATGCTGTCCCTTATGGAGGGACGCAGACTTCAGAACTGTGCCCATGACTGC
TGACTGCCACCACCAAGGCCCTCAGGTACACAGCCTGCCTCCTGCAGGATGATGTGGGCAGATTTCAGCCCTAGTTAACAGAAGAGTCCC
CCAGGAGGTAGGGGGCCCCCATCACTGGAGACATGCCAGCAGAGCCTCTGGCCACCTAACCAGGAGGTCTTCTGAAATGACTATACGAGG
TAAAGAAGTAGTACCAGATGGTCCCAAAGTTCCCTTTTAGCCTGAAAGCTTTTCTTTGTCCCTCCTTAGTGAATCTGTGTTCCGAGCCCT
ACTCTAAAGTTCAGTGGTCAATACAATAGTCCACCAAGAGACTGGGAATGATTAGAAGTGAAATTGGTCCCTCCTTACCAAGGAGGGGCA
GATGATCTCCATTGCACAGGGCGATTAGATTCTGGAGCTGAGGTGGGGACTGCAGGAGGCCACCTAGTCTGGTAGGTTTCAACCCAAGCT
GTGTACATTAGAATTCCCTTGGGAGCGTGCAGGAAATACAGATGCCCATGCCACATTCCAGACCAACTGAAGCTGAATCTCCAGAGTAGG
GCCTGTATGGTCATATAAGCTCCACAGGTGATCTGCAGTACAGTGAAGATGGAAGACTGCATGTGTACCTATTTGCAATAAAGATGAAGA
GGACAGCAAGCTCCAGACAGGAGCTGGGACTCAACCCAGATCTCTTAAGTCCTGCCTGGTGGCTCCTTAAAAGTCCAGAAGTGTTGCCCC
AAGCCCTCCCTCAACATCTCTGGGAACCGCAGCTGCAGCACGATGGGGGTTCAGTGCCCCTGTTTGCCCCTTACCCAGCTGTGGTTTATT
CTGCTTGTATGTCTGCACAGGCCGGATGCTCGTGTTCCTTGTCTTATTCTCCATTTACTCAGTCACTGGGGCTCACTCCCGTCTGATGCA
CTAGCCAAGATTGCCTTAGTGTGCTCCAGAAAAGAAGGCCAAATCCCAGGCATTGTCAGGGCAGCAGAGCTCTACAGGATAGGCTTACCT
TTCCCACCTGTGTGGCTAGCACTTCACAGTTTACAAATTCCTCCCACCTCCACTCAGTGACACATGCTGTTCTAACACAGGTCAGGCAGG
CATTACAGTCCCCATGTTCAGAATCAAAGACCTAGCCTCAGAGAAGTGAAGAAACATCATGCCAAGGTCATTGACTGCCAAGCGGTAGAG
GTGGGGTTGCATCCAGAGAGCTTCCCGGTATGCCTCTGCACAATGCCATTCCTTGGCCAGCTCCCTCCACCCCAAGGGACCCAGACTGCA
CACTTAACAAACAGGACACAGGTGTCTTTGAACAAACTTTTTTGTATTATTATTTTTACATCTAGAATAAATTATTTAAATTATTTCACA
GCAAGGGAGAGGGATAGGTAATTTTTATCAGATATTTTTTTAAACCATCTGTTTTTTAAATTACATTTTTGTTTATGTTCTTGAGCTGAT
GTAGTGGAACTTGCCTAGCACATTCAGGTCCCAGCCAGTTGGCAGAGCATGCTCTCATCTCCTTATTCCATACCCTGGGCGTCCCCTTTC
TGTTGACTCAGGAACTTTCTGAGAATGAGGACAGCACTAGGAGATGAGCTTTGGCAGGTATCCACCTTAACGCTACAATAATTGTGCTTC
CTGAAACAAAACTTGAGATTGTATCATAGAAGGAAACAGGAAGTCAGAAATCAAATCTATGCTTTTAATTGAAACCGTGCCTGAAACAGT
TTGAATGATTGTTTTAATGTTGTTTCTGAAATTCCTTGTACCTTTGTGAAAAATAATGATAATAAATAAAAGTGAAAATAAATAGATGTG

>In-frame_XPA_ENST00000375128_chr9_100449378_-_CORO2A_ENST00000375077_chr9_100919942_-_5997nt
GGCTCGCCTCGGCGTGCAGTGCGCGTGCGTGGAGCTGGGAGCTAGGTCCTCGGAGTGGGCCAGAGATGGCGGCGGCCGACGGGGCTTTGC
CGGAGGCGGCGGCTTTAGAGCAACCCGCGGAGCTGCCTGCCTCGGTGCGGGCGAGTATCGAGCGGAAGCGGCAGCGGGCACTGATGCTGC
GCCAGGCCCGGCTGGCTGCCCGGCCCTACTCGGCGACGGCGGCTGCGGCTACTGGAGGCATGGCTAATGTAAAAGCAGCCCCAAAGATAA
TTGACACAGGAGGAGGCTTCATTTTAGAAGAGGAAGAAGAAGAAGAACAGAAAATTGGAAAAGTTGTTCATCAACCAGGACCTGTTATGG
AATTTGATTATGTAATATGCGAAGAATGTGGGAAAGAATTTATGGATTCTTATCTTATGAACCACTTTGATTTGCCAACTTGTGATAACT
GCAGAGATGCTGATGATAAACACAAGCTTATAACCAAAACAGAGGCAAAACAAGAATATCTTCTGAAAGACTGTGATTTAGAAAAAAGAG
AGCCACCTCTTAAATTTATTGTGAAGAAGAATCCACATCATTCACAATGGGGTGATATGAAACTCTACTTAAAGTTACAGATGTCATGGC
ACCCCCAGTACCGGAGCTCCAAGTTCCGTCATGTCTTTGGCAAACCAGCCAGCAAGGAGAACTGCTACGACTCCGTGCCTATCACCCGCA
GCGTTCACGACAACCACTTCTGTGCCGTGAACCCCCACTTCATTGCAGTTGTGACTGAGTGTGCTGGTGGAGGGGCCTTCCTCGTCATCC
CCCTGCACCAGACAGGGAAGTTGGACCCCCACTACCCAAAAGTCTGCGGGCACAGAGGCAACGTTTTGGATGTCAAGTGGAACCCTTTTG
ATGATTTTGAGATCGCCTCCTGTTCTGAAGATGCCACAATTAAGATCTGGAGCATCCCCAAGCAGCTGCTGACCAGGAACCTCACGGCCT
ACAGGAAGGAACTCGTGGGCCACGCGCGCAGAGTAGGCCTGGTGGAGTGGCACCCCACGGCCGCCAACATCCTCTTCAGTGCTGGCTATG
ACTACAAGGTGATGATCTGGAACCTGGATACAAAGGAGTCTGTCATCACAAGCCCCATGAGTACGATTAGCTGTCACCAAGATGTGATCC
TCTCCATGTCCTTCAACACCAACGGCAGCCTGTTGGCCACCACCTGCAAAGACCGCAAGATTCGGGTTATTGACCCCCGAGCAGGGACCG
TCCTCCAGGAGGCCAGCTACAAAGGGCACCGGGCCAGCAAAGTGCTGTTTCTGGGGAACCTGAAGAAGCTGATGTCCACAGGCACATCCC
GATGGAACAACCGGCAGGTGGCCTTGTGGGACCAGGATAACCTCTCTGTGCCTCTGATGGAGGAGGACCTGGACGGCTCCTCGGGCGTGC
TGTTTCCCTTCTATGACGCGGACACCAGCATGCTCTACGTGGTGGGGAAGGGAGATGGCAACATCCGCTACTACGAGGTGAGCGCCGACA
AGCCTCACCTGAGCTACCTGACTGAGTACCGCTCCTATAACCCACAGAAGGGGATCGGTGTCATGCCAAAGAGAGGACTCGACGTGTCCT
CCTGCGAGATCTTCCGCTTCTACAAGCTGATCACAACCAAAAGCCTCATCGAGCCCATCTCCATGATTGTGCCCCGGCGGTCAGAATCCT
ACCAAGAGGACATATACCCTCCAACAGCAGGGGCCCAGCCCTCCCTGACGGCCCAGGAGTGGCTCAGCGGGATGAATCGAGACCCAATCC
TGGTGTCCCTTAGGCCTGGCTCTGAGCTGCTGAGACCCCACCCACTGCCTGCAGAGAGACCTATCTTCAATTCCATGGCCCCAGCCTCAC
CCCGGCTCTTGAATCAGACAGAAAAGCTGGCTGCAGAAGATGGCTGGAGGTCTTCCTCCCTGTTGGAGGAGAAGATGCCAAGGTGGGCAG
CAGAACACAGGCTGGAGGAGAAGAAAACCTGGCTGACAAATGGCTTTGACGTTTTCGAATGCCCCCCACCAAAGACAGAGAATGAGTTGC
TGCAGATGTTCTACCGGCAACAGGAGGAGATCCGAAGGCTCCGGGAGCTGTTGACCCAGCGAGAGGTCCAGGCCAAACAGTTGGAACTGG
AGATCAAAAACTTGCGGATGGGCTCAGAGCAGCTCTGAGCAGAGACCTCTGCCCTCCTCACCCTCAGGGACACCACTCGGCTCCATGGGG
AGGTTTAGAACCAAACCACAAGTCCCCTCAAGGACAACCACTATTTCTATATTTTTTACCAGAAAACAAAACTCTCCATCGCTGAAAGAG
ATTCCAGTGGGACATGGTGCCGTTTTTCTGTTTGCCTTCTTGCAACAACAGTTTCTGAATTGACTTTGTTTTCAGATGATGCCTTCTGTT
GAATTCTGTTATTAAGGGCCCATGATGAGCTGTAACTTCTCAAGAGGAAAGAACACAGTAGAAAACTAGAGCTGGAAGGATCTAGGTTGA
CCTGTCTGTGATTTTCAAACTGTGGTCCAGAGAATAGGGGAAGACTGGGCCAGACGCAGTGGCTCATGCCTGTAATCCCAGCACTCTGGG
AGGCTGAGGTGGGCGGATTGCTTGAGGTCGGGAGTTTGAAACCAGTCTCACCAGGCGCAGTGGCTCACGCCTGTAATTCCAGCATGTTGG
GAGGCCGAGGCTGGTGGATCACGAGGTCAGCAGTTCGAGACCAGCCTGACCAACATGGTGAAACCCCATCTCTACTAAAAATACAAAAAA
ATTAGCTGGGCGTGGTGGCAGGCGCCTGTAATTCCAGCGACTTGGGAGGCTGAGGCAGGAGAATTGCTTGAAACCGGAAGGCGGGGGTTG
CAGTGAGCTGAGATTGTGCCACTGCACTCTAACCTGGGCAATAAGAGCAAAAGTCTGTCTCAAAAAAAAAAAAAAAAGAAAGAAACCAGC
CTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAATACAAAAATTAGGCAGGGCGTGGTGGTTCACGCCTATAATCCCAGAACTTTGGG
AGGCCAAGCTGGGCGGATCTTCTGAGGTCAGGAGTTCAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCCACTAAAAATAAAAAAT
TAACCAGGCATGGTGGTGCATGCCTGTAATCCCAGCTATTTGGGAGGCTGAGGCAGGAGAATCGCTTGAGCCTGGGAGGCGGAGGTTGCA
GTGAACCAAGATCATGCCACTTCACTCCAGCCTGGGTGACAGAGTGAGACTCCGTCTCAAAAAAAAAAAGTTGGCCAGCCGTGGTGGTGA
GCGTCTGTAGTCCCTGCTATTCGGGAGGCTGAGATAGGAGAATTGCTTGAACCTGGGAGGTGGAGGTTGCTATGAGCCACGATTGCGGAC
TGCACTGCAGCCTGGGTGACAGAGCGAGACTCCATCTCCAAAAAAAAAAAAAAAAAGAGAGAGAGAATAGGGGAAGACTAAGCAGGAAGG
CTGTGTCTCCCTTCCCCACACTGTATTCCAACCAGACAGCTCCCTTCTATTTTATATGTTGGGCTAGTATGAAAAACAATTCTGCTAGGA
AAAAAAAATTTTTTTAGAAGTTTGAAAGCTAGTGATTTGACCCAAGTTCCTCATTTTACAGCTGGGGAAACTAAGGCCTAGAGAGAGGCA
AGTGATATTTGTTTCATGGCAGGGCTGGGCTGAGATCCTGCTTTTCTGGGTCTGTCTTTTTGCTCTTTTGGGTCTGATGCAGTTCTCAGC
CCAAAGAGTAGAAATCTGTTGCTTCTGGCCTCAGCTGTGCCCCAGCTTACTCAGTGACCTCTTGCAAGTCCTGCCCTCTCTGGTCTCAGT
TTCTTCATCTGAACCAGGGGTACCCTGGAACAAGCTGCTCTCTGCAGGATCTGCCACCTGAAACCTTGACCTAAGAGAAAACTACCTGTG
GGGTGATCTGGGTTTGCTACAGAAACTAACGGACACTGGCAAGGGGTCAGAGGCATTCAACCCAATTCTACAACACAGGCAGGTGGTCAA
AACCAACCTTTCCAACCAGAATCAGCCTGATATGGATAGATGCTGTCCCTTATGGAGGGACGCAGACTTCAGAACTGTGCCCATGACTGC
TGACTGCCACCACCAAGGCCCTCAGGTACACAGCCTGCCTCCTGCAGGATGATGTGGGCAGATTTCAGCCCTAGTTAACAGAAGAGTCCC
CCAGGAGGTAGGGGGCCCCCATCACTGGAGACATGCCAGCAGAGCCTCTGGCCACCTAACCAGGAGGTCTTCTGAAATGACTATACGAGG
TAAAGAAGTAGTACCAGATGGTCCCAAAGTTCCCTTTTAGCCTGAAAGCTTTTCTTTGTCCCTCCTTAGTGAATCTGTGTTCCGAGCCCT
ACTCTAAAGTTCAGTGGTCAATACAATAGTCCACCAAGAGACTGGGAATGATTAGAAGTGAAATTGGTCCCTCCTTACCAAGGAGGGGCA
GATGATCTCCATTGCACAGGGCGATTAGATTCTGGAGCTGAGGTGGGGACTGCAGGAGGCCACCTAGTCTGGTAGGTTTCAACCCAAGCT
GTGTACATTAGAATTCCCTTGGGAGCGTGCAGGAAATACAGATGCCCATGCCACATTCCAGACCAACTGAAGCTGAATCTCCAGAGTAGG
GCCTGTATGGTCATATAAGCTCCACAGGTGATCTGCAGTACAGTGAAGATGGAAGACTGCATGTGTACCTATTTGCAATAAAGATGAAGA
GGACAGCAAGCTCCAGACAGGAGCTGGGACTCAACCCAGATCTCTTAAGTCCTGCCTGGTGGCTCCTTAAAAGTCCAGAAGTGTTGCCCC
AAGCCCTCCCTCAACATCTCTGGGAACCGCAGCTGCAGCACGATGGGGGTTCAGTGCCCCTGTTTGCCCCTTACCCAGCTGTGGTTTATT
CTGCTTGTATGTCTGCACAGGCCGGATGCTCGTGTTCCTTGTCTTATTCTCCATTTACTCAGTCACTGGGGCTCACTCCCGTCTGATGCA
CTAGCCAAGATTGCCTTAGTGTGCTCCAGAAAAGAAGGCCAAATCCCAGGCATTGTCAGGGCAGCAGAGCTCTACAGGATAGGCTTACCT
TTCCCACCTGTGTGGCTAGCACTTCACAGTTTACAAATTCCTCCCACCTCCACTCAGTGACACATGCTGTTCTAACACAGGTCAGGCAGG
CATTACAGTCCCCATGTTCAGAATCAAAGACCTAGCCTCAGAGAAGTGAAGAAACATCATGCCAAGGTCATTGACTGCCAAGCGGTAGAG
GTGGGGTTGCATCCAGAGAGCTTCCCGGTATGCCTCTGCACAATGCCATTCCTTGGCCAGCTCCCTCCACCCCAAGGGACCCAGACTGCA
CACTTAACAAACAGGACACAGGTGTCTTTGAACAAACTTTTTTGTATTATTATTTTTACATCTAGAATAAATTATTTAAATTATTTCACA
GCAAGGGAGAGGGATAGGTAATTTTTATCAGATATTTTTTTAAACCATCTGTTTTTTAAATTACATTTTTGTTTATGTTCTTGAGCTGAT
GTAGTGGAACTTGCCTAGCACATTCAGGTCCCAGCCAGTTGGCAGAGCATGCTCTCATCTCCTTATTCCATACCCTGGGCGTCCCCTTTC
TGTTGACTCAGGAACTTTCTGAGAATGAGGACAGCACTAGGAGATGAGCTTTGGCAGGTATCCACCTTAACGCTACAATAATTGTGCTTC
CTGAAACAAAACTTGAGATTGTATCATAGAAGGAAACAGGAAGTCAGAAATCAAATCTATGCTTTTAATTGAAACCGTGCCTGAAACAGT
TTGAATGATTGTTTTAATGTTGTTTCTGAAATTCCTTGTACCTTTGTGAAAAATAATGATAATAAATAAAAGTGAAAATAAATAGATGTG


Top

FusionGenePPI for XPA_CORO2A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
XPARPA4, EP300, GPN1, ERCC1, ERCC6, RPA2, XAB2, GTF2E2, RPA1, MSH2, MSH3, GTF2H1, XPC, POLR2A, DDB1, DDB2, HMGB1, PRKDC, ATM, ATR, HERC2, TRIM27, NDEL1, ERCC4, NUP43, ZNF518A, XPO1, RHOU, SPTA1CORO2ANCOR1, NR1H2, UBE2I, THAP4, CORO1A, TMEM52B, CAPZA2, DBN1, FLNA, MYH9, MYO1C, IQGAP1, SYNPO, LIMA1, ANLN, SDHAF2, MYO19, MYO18A, CORO2B, RGS3, CSN2, SLC5A8, FERD3L, BCLAF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneXPAchr9:100449378chr9:100919942ENST00000375128-464_97185274CEP164 and required for UV resistance


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for XPA_CORO2A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for XPA_CORO2A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneXPAC0268135Xeroderma pigmentosum, group A4UNIPROT
HgeneXPAC0037286Skin Neoplasms2CTD_human
HgeneXPAC1449861Micronuclei, Chromosome-Defective2CTD_human
HgeneXPAC0007117Basal cell carcinoma1CTD_human
HgeneXPAC0021841Intestinal Neoplasms1CTD_human