FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42111

FusionGeneSummary for WWOX_C15orf41

check button Fusion gene summary
Fusion gene informationFusion gene name: WWOX_C15orf41
Fusion gene ID: 42111
HgeneTgene
Gene symbol

WWOX

C15orf41

Gene ID

51741

84529

Gene nameWW domain containing oxidoreductasechromosome 15 open reading frame 41
SynonymsD16S432E|EIEE28|FOR|FRA16D|HHCMA56|PRO0128|SCAR12|SDR41C1|WOX1HH114
Cytomap

16q23.1-q23.2

15q14

Type of geneprotein-codingprotein-coding
DescriptionWW domain-containing oxidoreductaseWW domain-containing protein WWOXfragile site FRA16D oxidoreductaseshort chain dehydrogenase/reductase family 41C member 1uncharacterized protein C15orf41
Modification date2018052320180519
UniProtAcc

Q9NZC7

Q9Y2V0

Ensembl transtripts involved in fusion geneENST00000566780, ENST00000406884, 
ENST00000539474, ENST00000402655, 
ENST00000408984, ENST00000355860, 
ENST00000565791, ENST00000569818, 
ENST00000566621, ENST00000437989, 
ENST00000569302, ENST00000567389, 
ENST00000562877, ENST00000338183, 
ENST00000565792, ENST00000562489, 
ENST00000563167, 
Fusion gene scores* DoF score9 X 10 X 7=6306 X 3 X 5=90
# samples 146
** MAII scorelog2(14/630*10)=-2.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/90*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: WWOX [Title/Abstract] AND C15orf41 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneWWOX

GO:0030178

negative regulation of Wnt signaling pathway

19465938

HgeneWWOX

GO:0071560

cellular response to transforming growth factor beta stimulus

19366691


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-5415-01AWWOXchr16

78198186

+C15orf41chr15

37100525

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000566780ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000566780ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000566780ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000566780ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000566780ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000566780ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000566780ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000566780ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000566780ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000406884ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000406884ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000406884ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000406884ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000406884ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000406884ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000406884ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000406884ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000406884ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000539474ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000539474ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000539474ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000539474ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000539474ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000539474ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000539474ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000539474ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000539474ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000402655ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000402655ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000402655ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000402655ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000402655ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000402655ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000402655ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000402655ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000402655ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000408984ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000408984ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000408984ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000408984ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000408984ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000408984ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000408984ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000408984ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000408984ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000355860ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000355860ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000355860ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000355860ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
In-frameENST00000355860ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
Frame-shiftENST00000355860ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000355860ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000355860ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
5CDS-3UTRENST00000355860ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3CDSENST00000565791ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3CDSENST00000565791ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3CDSENST00000565791ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3CDSENST00000565791ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3CDSENST00000565791ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3CDSENST00000565791ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3UTRENST00000565791ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3UTRENST00000565791ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
3UTR-3UTRENST00000565791ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000569818ENST00000566621WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000569818ENST00000437989WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000569818ENST00000569302WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000569818ENST00000567389WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000569818ENST00000562877WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3CDSENST00000569818ENST00000338183WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000569818ENST00000565792WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000569818ENST00000562489WWOXchr16

78198186

+C15orf41chr15

37100525

+
intron-3UTRENST00000569818ENST00000563167WWOXchr16

78198186

+C15orf41chr15

37100525

+

Top

FusionProtFeatures for WWOX_C15orf41


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WWOX

Q9NZC7

C15orf41

Q9Y2V0


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWWOXchr16:78198186chr15:37100525ENST00000355860+5616_49172190DomainWW 1
HgeneWWOXchr16:78198186chr15:37100525ENST00000355860+5657_90172190DomainWW 2
HgeneWWOXchr16:78198186chr15:37100525ENST00000406884+5616_49172235DomainWW 1
HgeneWWOXchr16:78198186chr15:37100525ENST00000406884+5657_90172235DomainWW 2
HgeneWWOXchr16:78198186chr15:37100525ENST00000408984+51016_49172311DomainWW 1
HgeneWWOXchr16:78198186chr15:37100525ENST00000408984+51057_90172311DomainWW 2
HgeneWWOXchr16:78198186chr15:37100525ENST00000566780+5916_49172415DomainWW 1
HgeneWWOXchr16:78198186chr15:37100525ENST00000566780+5957_90172415DomainWW 2
HgeneWWOXchr16:78198186chr15:37100525ENST00000355860+5650_55172190MotifNuclear localization signal
HgeneWWOXchr16:78198186chr15:37100525ENST00000406884+5650_55172235MotifNuclear localization signal
HgeneWWOXchr16:78198186chr15:37100525ENST00000408984+51050_55172311MotifNuclear localization signal
HgeneWWOXchr16:78198186chr15:37100525ENST00000566780+5950_55172415MotifNuclear localization signal
HgeneWWOXchr16:78198186chr15:37100525ENST00000355860+56131_137172190Nucleotide bindingNADP
HgeneWWOXchr16:78198186chr15:37100525ENST00000406884+56131_137172235Nucleotide bindingNADP
HgeneWWOXchr16:78198186chr15:37100525ENST00000408984+510131_137172311Nucleotide bindingNADP
HgeneWWOXchr16:78198186chr15:37100525ENST00000566780+59131_137172415Nucleotide bindingNADP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWWOXchr16:78198186chr15:37100525ENST00000402655+1516_49-42312DomainWW 1
HgeneWWOXchr16:78198186chr15:37100525ENST00000402655+1557_90-42312DomainWW 2
HgeneWWOXchr16:78198186chr15:37100525ENST00000569818+1116_49-3537DomainWW 1
HgeneWWOXchr16:78198186chr15:37100525ENST00000569818+1157_90-3537DomainWW 2
HgeneWWOXchr16:78198186chr15:37100525ENST00000402655+1550_55-42312MotifNuclear localization signal
HgeneWWOXchr16:78198186chr15:37100525ENST00000569818+1150_55-3537MotifNuclear localization signal
HgeneWWOXchr16:78198186chr15:37100525ENST00000402655+15131_137-42312Nucleotide bindingNADP
HgeneWWOXchr16:78198186chr15:37100525ENST00000569818+11131_137-3537Nucleotide bindingNADP
HgeneWWOXchr16:78198186chr15:37100525ENST00000355860+56209_273172190RegionMediates targeting to the mitochondria
HgeneWWOXchr16:78198186chr15:37100525ENST00000402655+15209_273-42312RegionMediates targeting to the mitochondria
HgeneWWOXchr16:78198186chr15:37100525ENST00000406884+56209_273172235RegionMediates targeting to the mitochondria
HgeneWWOXchr16:78198186chr15:37100525ENST00000408984+510209_273172311RegionMediates targeting to the mitochondria
HgeneWWOXchr16:78198186chr15:37100525ENST00000566780+59209_273172415RegionMediates targeting to the mitochondria
HgeneWWOXchr16:78198186chr15:37100525ENST00000569818+11209_273-3537RegionMediates targeting to the mitochondria


Top

FusionGeneSequence for WWOX_C15orf41


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_215aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRL
AFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWIWARLSHL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_646nt
ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGC
TGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCA
TACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTG
GCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGG
GATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACAT
GTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTA
TTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_2782nt
GTCCTGGCCCGAAACTGGATGCGCACGCCCCTTCCCTGCGGCGGGGAGGCTGACAAGGCTCCGCTCTATCTCTAGCGCCTCGGAGCGCTC
TCCGGCTTTGCTGTCTAGCCCGGCGGCAGCGCGATCTCTTAGGCACTTTCACCGCCTTCCTCTCCAGGCCCTGCCCCTTTGACGCCGGCC
GTCGCGATATTGCGGAGACTGGATTTCAGCTTCGTGGTCGGCGGAGCGGCCCCTGGAGGGCGCAGTGCGCAGGCGTGAGCGGTCGGGCCC
CGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCCACAG
TCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAG
GACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGAT
TTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCA
AGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAG
GGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGT
GCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGT
CATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCAC
CTTATGCCACAGCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGGTGAATCCGGAAGCAATTTTACTTTCCTGCAC
TGTAAGATCCTGGCAACATCTGCCCTGAACTTCAGCTGAACTCTTGCTGCCCGTAGTCACACCACTACCTCTTTAGACAAACATATCAAG
AGTTTCTGTTTTCCTTCATCCCTTGCTGATGTGAACAGCCAAGAACTACAGACACAACCCACTCATTATCAGCATTTCTGTCTCTGTCAA
ACAATTAGTTTATAGATAGTCATAATCTTTCTTTCTTCCGGATGGTTTATCCTTGTATGCTGAACAAAAGAAAAAATGTGAAGACTGAAA
GGTGTGATTTTTCAATTCTCCTCCCAGTTACCGAATCACCCTCTTATTTTTTTTTCCCTAAGCCTCCGTTCACTGTCTCTCCCTCTCCCT
TTCTCTTCATGTGCACTCACAGAGACCCAGCATTGCATTACCATCGTGGAATAATCTAGCGCAAACCTAGGAAAGCTGAAGCCACAAAGT
CCAAAGCCACCTTTGTACTCACCTGCAGAGCTCCAGAAGACCTTGATGGCAGCCTGCCTATGCTGTGTGTTTGCTATATTCAATCTTTAC
GGCTTCCTGACTTCTGTGACAGTAAGCCAAGTGCAAAAATACACTTGATGAGAATTTCCTCTTTTAATAATGTTATTTGAACACCACATA
TTTTAGATTTATCTTATTTGAAAGTATTAGTTCCATTGTGCCTGGAAACCACACTCCTTTAGATTGGGGGCCGAGAGGCGACAACCCAAC
ATTGAGGAGAGTTTATTTTTAAACATGGCTAGTTGTCAGTATGTACGTGAGCTAGTATTTTTATGAGTCGAGTTTTTTAAAGGCACATTC
TGTATACTGCTTAGTATATGCATTTTATACCATGTAATTATAAAACACTCGAGTAAGTTCAGCATTAGAAATGTTTAGCTTTGTATGAAC
TGAGTGTGCCAGAAATAAACCTGGAGCAATTTTTAAATAAGCAAAATAAAGGAGATTTTTCTATTTGTTCACTTTAATTTATTCACTTTT
GTGTACTTTTATGTACTGCAAATCAGATTTCAGTCTAAAGCGAAACATCAGTAAGTTAATAATAAACCTATCTTTTGGGAAGTTGAATAT
TAATCTGTACCCAAAACGTATTTAGTAAAATATTTGCCCCCGCCACCCTGCCATGCTGACATAACAACTTTTATAATGTTGAATAGATGA
TATGGGAAATACTAATAACAACAATGTAATTTTTGCAGACAGCTTTAACTTATATACATTGCTTGATTTTTTTCAAAAGACTAAATATGT
CATTTATACTTTGTTTATTTTCTACCAAAGAAGGTTTGTAAAAATATGCCTGCTGCTTTTCCTTTTGAAGGACACAAACCTGGTCCCAAC
ATGTGTGGATTTTAACTCTGAGTGGGGTGCATTAAATCAAAAGAGAGAGGCAGAAGATGAAATGCTAAAGAAGGGTCAGGCAAACTTCTG
TTTCAGTATAAAATTCATCATGCAGGCTTCTGAGTGAAATAGAATGATTTGAAACCACTACTGTATTGCCTGGATACACACACACACACA
CACACACACTTTATACAAAAATGTTAAAAGCAGGTTTCCTGGCATGTTCTAAACTGTTTTTTCTTTAGGAATAAATTACATTTATCTGCA

>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_2389nt
GTCCTGGCCCGAAACTGGATGCGCACGCCCCTTCCCTGCGGCGGGGAGGCTGACAAGGCTCCGCTCTATCTCTAGCGCCTCGGAGCGCTC
TCCGGCTTTGCTGTCTAGCCCGGCGGCAGCGCGATCTCTTAGGCACTTTCACCGCCTTCCTCTCCAGGCCCTGCCCCTTTGACGCCGGCC
GTCGCGATATTGCGGAGACTGGATTTCAGCTTCGTGGTCGGCGGAGCGGCCCCTGGAGGGCGCAGTGCGCAGGCGTGAGCGGTCGGGCCC
CGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCCACAG
TCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAG
GACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGAT
TTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCA
AGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAG
GGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGT
GCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGT
CATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCAC
CTTATGCCACAGCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGAGACCCAGCATTGCATTACCATCGTGGAATAA
TCTAGCGCAAACCTAGGAAAGCTGAAGCCACAAAGTCCAAAGCCACCTTTGTACTCACCTGCAGAGCTCCAGAAGACCTTGATGGCAGCC
TGCCTATGCTGTGTGTTTGCTATATTCAATCTTTACGGCTTCCTGACTTCTGTGACAGTAAGCCAAGTGCAAAAATACACTTGATGAGAA
TTTCCTCTTTTAATAATGTTATTTGAACACCACATATTTTAGATTTATCTTATTTGAAAGTATTAGTTCCATTGTGCCTGGAAACCACAC
TCCTTTAGATTGGGGGCCGAGAGGCGACAACCCAACATTGAGGAGAGTTTATTTTTAAACATGGCTAGTTGTCAGTATGTACGTGAGCTA
GTATTTTTATGAGTCGAGTTTTTTAAAGGCACATTCTGTATACTGCTTAGTATATGCATTTTATACCATGTAATTATAAAACACTCGAGT
AAGTTCAGCATTAGAAATGTTTAGCTTTGTATGAACTGAGTGTGCCAGAAATAAACCTGGAGCAATTTTTAAATAAGCAAAATAAAGGAG
ATTTTTCTATTTGTTCACTTTAATTTATTCACTTTTGTGTACTTTTATGTACTGCAAATCAGATTTCAGTCTAAAGCGAAACATCAGTAA
GTTAATAATAAACCTATCTTTTGGGAAGTTGAATATTAATCTGTACCCAAAACGTATTTAGTAAAATATTTGCCCCCGCCACCCTGCCAT
GCTGACATAACAACTTTTATAATGTTGAATAGATGATATGGGAAATACTAATAACAACAATGTAATTTTTGCAGACAGCTTTAACTTATA
TACATTGCTTGATTTTTTTCAAAAGACTAAATATGTCATTTATACTTTGTTTATTTTCTACCAAAGAAGGTTTGTAAAAATATGCCTGCT
GCTTTTCCTTTTGAAGGACACAAACCTGGTCCCAACATGTGTGGATTTTAACTCTGAGTGGGGTGCATTAAATCAAAAGAGAGAGGCAGA
AGATGAAATGCTAAAGAAGGGTCAGGCAAACTTCTGTTTCAGTATAAAATTCATCATGCAGGCTTCTGAGTGAAATAGAATGATTTGAAA
CCACTACTGTATTGCCTGGATACACACACACACACACACACACACTTTATACAAAAATGTTAAAAGCAGGTTTCCTGGCATGTTCTAAAC
TGTTTTTTCTTTAGGAATAAATTACATTTATCTGCACAGATGTTGAAAATCCTGTTAAACCCTTGTCAAGGATTTGTTTATTTTACATTA

>In-frame_WWOX_ENST00000566780_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_1012nt
GTCCTGGCCCGAAACTGGATGCGCACGCCCCTTCCCTGCGGCGGGGAGGCTGACAAGGCTCCGCTCTATCTCTAGCGCCTCGGAGCGCTC
TCCGGCTTTGCTGTCTAGCCCGGCGGCAGCGCGATCTCTTAGGCACTTTCACCGCCTTCCTCTCCAGGCCCTGCCCCTTTGACGCCGGCC
GTCGCGATATTGCGGAGACTGGATTTCAGCTTCGTGGTCGGCGGAGCGGCCCCTGGAGGGCGCAGTGCGCAGGCGTGAGCGGTCGGGCCC
CGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCCACAG
TCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAG
GACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGAT
TTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCA
AGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAG
GGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGT
GCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGT
CATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCAC

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_2541nt
GCAGTGCGCAGGCGTGAGCGGTCGGGCCCCGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCG
GGCGATAGGGGGGCCAGGTGCCTCCACAGTCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGC
CTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAA
CTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATA
TAAATAAAAGAACCACCTACTTGGACCCAAGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACG
GCAGCACCACTGCCATGGAAATTCTCCAGGGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCG
AAACCGCCAAGTCTTTTGCCCTCCATGGTGCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTT
TAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTC
AAAGCCTGTTTCCCCACGAACATTGTCACCTTATGCCACAGCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGGTG
AATCCGGAAGCAATTTTACTTTCCTGCACTGTAAGATCCTGGCAACATCTGCCCTGAACTTCAGCTGAACTCTTGCTGCCCGTAGTCACA
CCACTACCTCTTTAGACAAACATATCAAGAGTTTCTGTTTTCCTTCATCCCTTGCTGATGTGAACAGCCAAGAACTACAGACACAACCCA
CTCATTATCAGCATTTCTGTCTCTGTCAAACAATTAGTTTATAGATAGTCATAATCTTTCTTTCTTCCGGATGGTTTATCCTTGTATGCT
GAACAAAAGAAAAAATGTGAAGACTGAAAGGTGTGATTTTTCAATTCTCCTCCCAGTTACCGAATCACCCTCTTATTTTTTTTTCCCTAA
GCCTCCGTTCACTGTCTCTCCCTCTCCCTTTCTCTTCATGTGCACTCACAGAGACCCAGCATTGCATTACCATCGTGGAATAATCTAGCG
CAAACCTAGGAAAGCTGAAGCCACAAAGTCCAAAGCCACCTTTGTACTCACCTGCAGAGCTCCAGAAGACCTTGATGGCAGCCTGCCTAT
GCTGTGTGTTTGCTATATTCAATCTTTACGGCTTCCTGACTTCTGTGACAGTAAGCCAAGTGCAAAAATACACTTGATGAGAATTTCCTC
TTTTAATAATGTTATTTGAACACCACATATTTTAGATTTATCTTATTTGAAAGTATTAGTTCCATTGTGCCTGGAAACCACACTCCTTTA
GATTGGGGGCCGAGAGGCGACAACCCAACATTGAGGAGAGTTTATTTTTAAACATGGCTAGTTGTCAGTATGTACGTGAGCTAGTATTTT
TATGAGTCGAGTTTTTTAAAGGCACATTCTGTATACTGCTTAGTATATGCATTTTATACCATGTAATTATAAAACACTCGAGTAAGTTCA
GCATTAGAAATGTTTAGCTTTGTATGAACTGAGTGTGCCAGAAATAAACCTGGAGCAATTTTTAAATAAGCAAAATAAAGGAGATTTTTC
TATTTGTTCACTTTAATTTATTCACTTTTGTGTACTTTTATGTACTGCAAATCAGATTTCAGTCTAAAGCGAAACATCAGTAAGTTAATA
ATAAACCTATCTTTTGGGAAGTTGAATATTAATCTGTACCCAAAACGTATTTAGTAAAATATTTGCCCCCGCCACCCTGCCATGCTGACA
TAACAACTTTTATAATGTTGAATAGATGATATGGGAAATACTAATAACAACAATGTAATTTTTGCAGACAGCTTTAACTTATATACATTG
CTTGATTTTTTTCAAAAGACTAAATATGTCATTTATACTTTGTTTATTTTCTACCAAAGAAGGTTTGTAAAAATATGCCTGCTGCTTTTC
CTTTTGAAGGACACAAACCTGGTCCCAACATGTGTGGATTTTAACTCTGAGTGGGGTGCATTAAATCAAAAGAGAGAGGCAGAAGATGAA
ATGCTAAAGAAGGGTCAGGCAAACTTCTGTTTCAGTATAAAATTCATCATGCAGGCTTCTGAGTGAAATAGAATGATTTGAAACCACTAC
TGTATTGCCTGGATACACACACACACACACACACACACTTTATACAAAAATGTTAAAAGCAGGTTTCCTGGCATGTTCTAAACTGTTTTT
TCTTTAGGAATAAATTACATTTATCTGCACAGATGTTGAAAATCCTGTTAAACCCTTGTCAAGGATTTGTTTATTTTACATTAAACAAAT

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_2148nt
GCAGTGCGCAGGCGTGAGCGGTCGGGCCCCGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCG
GGCGATAGGGGGGCCAGGTGCCTCCACAGTCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGC
CTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAA
CTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATA
TAAATAAAAGAACCACCTACTTGGACCCAAGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACG
GCAGCACCACTGCCATGGAAATTCTCCAGGGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCG
AAACCGCCAAGTCTTTTGCCCTCCATGGTGCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTT
TAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTC
AAAGCCTGTTTCCCCACGAACATTGTCACCTTATGCCACAGCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGAGA
CCCAGCATTGCATTACCATCGTGGAATAATCTAGCGCAAACCTAGGAAAGCTGAAGCCACAAAGTCCAAAGCCACCTTTGTACTCACCTG
CAGAGCTCCAGAAGACCTTGATGGCAGCCTGCCTATGCTGTGTGTTTGCTATATTCAATCTTTACGGCTTCCTGACTTCTGTGACAGTAA
GCCAAGTGCAAAAATACACTTGATGAGAATTTCCTCTTTTAATAATGTTATTTGAACACCACATATTTTAGATTTATCTTATTTGAAAGT
ATTAGTTCCATTGTGCCTGGAAACCACACTCCTTTAGATTGGGGGCCGAGAGGCGACAACCCAACATTGAGGAGAGTTTATTTTTAAACA
TGGCTAGTTGTCAGTATGTACGTGAGCTAGTATTTTTATGAGTCGAGTTTTTTAAAGGCACATTCTGTATACTGCTTAGTATATGCATTT
TATACCATGTAATTATAAAACACTCGAGTAAGTTCAGCATTAGAAATGTTTAGCTTTGTATGAACTGAGTGTGCCAGAAATAAACCTGGA
GCAATTTTTAAATAAGCAAAATAAAGGAGATTTTTCTATTTGTTCACTTTAATTTATTCACTTTTGTGTACTTTTATGTACTGCAAATCA
GATTTCAGTCTAAAGCGAAACATCAGTAAGTTAATAATAAACCTATCTTTTGGGAAGTTGAATATTAATCTGTACCCAAAACGTATTTAG
TAAAATATTTGCCCCCGCCACCCTGCCATGCTGACATAACAACTTTTATAATGTTGAATAGATGATATGGGAAATACTAATAACAACAAT
GTAATTTTTGCAGACAGCTTTAACTTATATACATTGCTTGATTTTTTTCAAAAGACTAAATATGTCATTTATACTTTGTTTATTTTCTAC
CAAAGAAGGTTTGTAAAAATATGCCTGCTGCTTTTCCTTTTGAAGGACACAAACCTGGTCCCAACATGTGTGGATTTTAACTCTGAGTGG
GGTGCATTAAATCAAAAGAGAGAGGCAGAAGATGAAATGCTAAAGAAGGGTCAGGCAAACTTCTGTTTCAGTATAAAATTCATCATGCAG
GCTTCTGAGTGAAATAGAATGATTTGAAACCACTACTGTATTGCCTGGATACACACACACACACACACACACACTTTATACAAAAATGTT
AAAAGCAGGTTTCCTGGCATGTTCTAAACTGTTTTTTCTTTAGGAATAAATTACATTTATCTGCACAGATGTTGAAAATCCTGTTAAACC

>In-frame_WWOX_ENST00000406884_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_771nt
GCAGTGCGCAGGCGTGAGCGGTCGGGCCCCGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCG
GGCGATAGGGGGGCCAGGTGCCTCCACAGTCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGC
CTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAA
CTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATA
TAAATAAAAGAACCACCTACTTGGACCCAAGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACG
GCAGCACCACTGCCATGGAAATTCTCCAGGGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCG
AAACCGCCAAGTCTTTTGCCCTCCATGGTGCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTT
TAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTC

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_2501nt
GGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCCACAGTCAGCCATGGC
AGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGCTGGGT
TTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCATACGG
ATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTGGCGTT
TACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGGGATTT
CACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACATGTGAT
CTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTATTGGT
ATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATGCCACA
GCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGGTGAATCCGGAAGCAATTTTACTTTCCTGCACTGTAAGATCCT
GGCAACATCTGCCCTGAACTTCAGCTGAACTCTTGCTGCCCGTAGTCACACCACTACCTCTTTAGACAAACATATCAAGAGTTTCTGTTT
TCCTTCATCCCTTGCTGATGTGAACAGCCAAGAACTACAGACACAACCCACTCATTATCAGCATTTCTGTCTCTGTCAAACAATTAGTTT
ATAGATAGTCATAATCTTTCTTTCTTCCGGATGGTTTATCCTTGTATGCTGAACAAAAGAAAAAATGTGAAGACTGAAAGGTGTGATTTT
TCAATTCTCCTCCCAGTTACCGAATCACCCTCTTATTTTTTTTTCCCTAAGCCTCCGTTCACTGTCTCTCCCTCTCCCTTTCTCTTCATG
TGCACTCACAGAGACCCAGCATTGCATTACCATCGTGGAATAATCTAGCGCAAACCTAGGAAAGCTGAAGCCACAAAGTCCAAAGCCACC
TTTGTACTCACCTGCAGAGCTCCAGAAGACCTTGATGGCAGCCTGCCTATGCTGTGTGTTTGCTATATTCAATCTTTACGGCTTCCTGAC
TTCTGTGACAGTAAGCCAAGTGCAAAAATACACTTGATGAGAATTTCCTCTTTTAATAATGTTATTTGAACACCACATATTTTAGATTTA
TCTTATTTGAAAGTATTAGTTCCATTGTGCCTGGAAACCACACTCCTTTAGATTGGGGGCCGAGAGGCGACAACCCAACATTGAGGAGAG
TTTATTTTTAAACATGGCTAGTTGTCAGTATGTACGTGAGCTAGTATTTTTATGAGTCGAGTTTTTTAAAGGCACATTCTGTATACTGCT
TAGTATATGCATTTTATACCATGTAATTATAAAACACTCGAGTAAGTTCAGCATTAGAAATGTTTAGCTTTGTATGAACTGAGTGTGCCA
GAAATAAACCTGGAGCAATTTTTAAATAAGCAAAATAAAGGAGATTTTTCTATTTGTTCACTTTAATTTATTCACTTTTGTGTACTTTTA
TGTACTGCAAATCAGATTTCAGTCTAAAGCGAAACATCAGTAAGTTAATAATAAACCTATCTTTTGGGAAGTTGAATATTAATCTGTACC
CAAAACGTATTTAGTAAAATATTTGCCCCCGCCACCCTGCCATGCTGACATAACAACTTTTATAATGTTGAATAGATGATATGGGAAATA
CTAATAACAACAATGTAATTTTTGCAGACAGCTTTAACTTATATACATTGCTTGATTTTTTTCAAAAGACTAAATATGTCATTTATACTT
TGTTTATTTTCTACCAAAGAAGGTTTGTAAAAATATGCCTGCTGCTTTTCCTTTTGAAGGACACAAACCTGGTCCCAACATGTGTGGATT
TTAACTCTGAGTGGGGTGCATTAAATCAAAAGAGAGAGGCAGAAGATGAAATGCTAAAGAAGGGTCAGGCAAACTTCTGTTTCAGTATAA
AATTCATCATGCAGGCTTCTGAGTGAAATAGAATGATTTGAAACCACTACTGTATTGCCTGGATACACACACACACACACACACACACTT
TATACAAAAATGTTAAAAGCAGGTTTCCTGGCATGTTCTAAACTGTTTTTTCTTTAGGAATAAATTACATTTATCTGCACAGATGTTGAA

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_2108nt
GGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCCACAGTCAGCCATGGC
AGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGCTGGGT
TTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCATACGG
ATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTGGCGTT
TACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGGGATTT
CACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACATGTGAT
CTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTATTGGT
ATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATGCCACA
GCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGAGACCCAGCATTGCATTACCATCGTGGAATAATCTAGCGCAAA
CCTAGGAAAGCTGAAGCCACAAAGTCCAAAGCCACCTTTGTACTCACCTGCAGAGCTCCAGAAGACCTTGATGGCAGCCTGCCTATGCTG
TGTGTTTGCTATATTCAATCTTTACGGCTTCCTGACTTCTGTGACAGTAAGCCAAGTGCAAAAATACACTTGATGAGAATTTCCTCTTTT
AATAATGTTATTTGAACACCACATATTTTAGATTTATCTTATTTGAAAGTATTAGTTCCATTGTGCCTGGAAACCACACTCCTTTAGATT
GGGGGCCGAGAGGCGACAACCCAACATTGAGGAGAGTTTATTTTTAAACATGGCTAGTTGTCAGTATGTACGTGAGCTAGTATTTTTATG
AGTCGAGTTTTTTAAAGGCACATTCTGTATACTGCTTAGTATATGCATTTTATACCATGTAATTATAAAACACTCGAGTAAGTTCAGCAT
TAGAAATGTTTAGCTTTGTATGAACTGAGTGTGCCAGAAATAAACCTGGAGCAATTTTTAAATAAGCAAAATAAAGGAGATTTTTCTATT
TGTTCACTTTAATTTATTCACTTTTGTGTACTTTTATGTACTGCAAATCAGATTTCAGTCTAAAGCGAAACATCAGTAAGTTAATAATAA
ACCTATCTTTTGGGAAGTTGAATATTAATCTGTACCCAAAACGTATTTAGTAAAATATTTGCCCCCGCCACCCTGCCATGCTGACATAAC
AACTTTTATAATGTTGAATAGATGATATGGGAAATACTAATAACAACAATGTAATTTTTGCAGACAGCTTTAACTTATATACATTGCTTG
ATTTTTTTCAAAAGACTAAATATGTCATTTATACTTTGTTTATTTTCTACCAAAGAAGGTTTGTAAAAATATGCCTGCTGCTTTTCCTTT
TGAAGGACACAAACCTGGTCCCAACATGTGTGGATTTTAACTCTGAGTGGGGTGCATTAAATCAAAAGAGAGAGGCAGAAGATGAAATGC
TAAAGAAGGGTCAGGCAAACTTCTGTTTCAGTATAAAATTCATCATGCAGGCTTCTGAGTGAAATAGAATGATTTGAAACCACTACTGTA
TTGCCTGGATACACACACACACACACACACACACTTTATACAAAAATGTTAAAAGCAGGTTTCCTGGCATGTTCTAAACTGTTTTTTCTT
TAGGAATAAATTACATTTATCTGCACAGATGTTGAAAATCCTGTTAAACCCTTGTCAAGGATTTGTTTATTTTACATTAAACAAATTTAT

>In-frame_WWOX_ENST00000408984_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_731nt
GGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCCACAGTCAGCCATGGC
AGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCACCAAGGACGGCTGGGT
TTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGGAGATTTGCCATACGG
ATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGACCCAAGACTGGCGTT
TACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCTCCAGGGCCGGGATTT
CACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCATGGTGCACATGTGAT
CTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCTTAGTCATCTATTGGT
ATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTGTCACCTTATGCCACA

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000566621_chr15_37100525_+_2516nt
GCCCCGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCC
ACAGTCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCAC
CAAGGACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGG
AGATTTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGA
CCCAAGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCT
CCAGGGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCA
TGGTGCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCT
TAGTCATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTG
TCACCTTATGCCACAGCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGGTGAATCCGGAAGCAATTTTACTTTCCT
GCACTGTAAGATCCTGGCAACATCTGCCCTGAACTTCAGCTGAACTCTTGCTGCCCGTAGTCACACCACTACCTCTTTAGACAAACATAT
CAAGAGTTTCTGTTTTCCTTCATCCCTTGCTGATGTGAACAGCCAAGAACTACAGACACAACCCACTCATTATCAGCATTTCTGTCTCTG
TCAAACAATTAGTTTATAGATAGTCATAATCTTTCTTTCTTCCGGATGGTTTATCCTTGTATGCTGAACAAAAGAAAAAATGTGAAGACT
GAAAGGTGTGATTTTTCAATTCTCCTCCCAGTTACCGAATCACCCTCTTATTTTTTTTTCCCTAAGCCTCCGTTCACTGTCTCTCCCTCT
CCCTTTCTCTTCATGTGCACTCACAGAGACCCAGCATTGCATTACCATCGTGGAATAATCTAGCGCAAACCTAGGAAAGCTGAAGCCACA
AAGTCCAAAGCCACCTTTGTACTCACCTGCAGAGCTCCAGAAGACCTTGATGGCAGCCTGCCTATGCTGTGTGTTTGCTATATTCAATCT
TTACGGCTTCCTGACTTCTGTGACAGTAAGCCAAGTGCAAAAATACACTTGATGAGAATTTCCTCTTTTAATAATGTTATTTGAACACCA
CATATTTTAGATTTATCTTATTTGAAAGTATTAGTTCCATTGTGCCTGGAAACCACACTCCTTTAGATTGGGGGCCGAGAGGCGACAACC
CAACATTGAGGAGAGTTTATTTTTAAACATGGCTAGTTGTCAGTATGTACGTGAGCTAGTATTTTTATGAGTCGAGTTTTTTAAAGGCAC
ATTCTGTATACTGCTTAGTATATGCATTTTATACCATGTAATTATAAAACACTCGAGTAAGTTCAGCATTAGAAATGTTTAGCTTTGTAT
GAACTGAGTGTGCCAGAAATAAACCTGGAGCAATTTTTAAATAAGCAAAATAAAGGAGATTTTTCTATTTGTTCACTTTAATTTATTCAC
TTTTGTGTACTTTTATGTACTGCAAATCAGATTTCAGTCTAAAGCGAAACATCAGTAAGTTAATAATAAACCTATCTTTTGGGAAGTTGA
ATATTAATCTGTACCCAAAACGTATTTAGTAAAATATTTGCCCCCGCCACCCTGCCATGCTGACATAACAACTTTTATAATGTTGAATAG
ATGATATGGGAAATACTAATAACAACAATGTAATTTTTGCAGACAGCTTTAACTTATATACATTGCTTGATTTTTTTCAAAAGACTAAAT
ATGTCATTTATACTTTGTTTATTTTCTACCAAAGAAGGTTTGTAAAAATATGCCTGCTGCTTTTCCTTTTGAAGGACACAAACCTGGTCC
CAACATGTGTGGATTTTAACTCTGAGTGGGGTGCATTAAATCAAAAGAGAGAGGCAGAAGATGAAATGCTAAAGAAGGGTCAGGCAAACT
TCTGTTTCAGTATAAAATTCATCATGCAGGCTTCTGAGTGAAATAGAATGATTTGAAACCACTACTGTATTGCCTGGATACACACACACA
CACACACACACACTTTATACAAAAATGTTAAAAGCAGGTTTCCTGGCATGTTCTAAACTGTTTTTTCTTTAGGAATAAATTACATTTATC

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000437989_chr15_37100525_+_2123nt
GCCCCGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCC
ACAGTCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCAC
CAAGGACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGG
AGATTTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGA
CCCAAGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCT
CCAGGGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCA
TGGTGCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCT
TAGTCATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTG
TCACCTTATGCCACAGCATAGCTTGACCCTGAAGATCCTGGAAGAGAAGCTGGGAGGAAAAGAGACCCAGCATTGCATTACCATCGTGGA
ATAATCTAGCGCAAACCTAGGAAAGCTGAAGCCACAAAGTCCAAAGCCACCTTTGTACTCACCTGCAGAGCTCCAGAAGACCTTGATGGC
AGCCTGCCTATGCTGTGTGTTTGCTATATTCAATCTTTACGGCTTCCTGACTTCTGTGACAGTAAGCCAAGTGCAAAAATACACTTGATG
AGAATTTCCTCTTTTAATAATGTTATTTGAACACCACATATTTTAGATTTATCTTATTTGAAAGTATTAGTTCCATTGTGCCTGGAAACC
ACACTCCTTTAGATTGGGGGCCGAGAGGCGACAACCCAACATTGAGGAGAGTTTATTTTTAAACATGGCTAGTTGTCAGTATGTACGTGA
GCTAGTATTTTTATGAGTCGAGTTTTTTAAAGGCACATTCTGTATACTGCTTAGTATATGCATTTTATACCATGTAATTATAAAACACTC
GAGTAAGTTCAGCATTAGAAATGTTTAGCTTTGTATGAACTGAGTGTGCCAGAAATAAACCTGGAGCAATTTTTAAATAAGCAAAATAAA
GGAGATTTTTCTATTTGTTCACTTTAATTTATTCACTTTTGTGTACTTTTATGTACTGCAAATCAGATTTCAGTCTAAAGCGAAACATCA
GTAAGTTAATAATAAACCTATCTTTTGGGAAGTTGAATATTAATCTGTACCCAAAACGTATTTAGTAAAATATTTGCCCCCGCCACCCTG
CCATGCTGACATAACAACTTTTATAATGTTGAATAGATGATATGGGAAATACTAATAACAACAATGTAATTTTTGCAGACAGCTTTAACT
TATATACATTGCTTGATTTTTTTCAAAAGACTAAATATGTCATTTATACTTTGTTTATTTTCTACCAAAGAAGGTTTGTAAAAATATGCC
TGCTGCTTTTCCTTTTGAAGGACACAAACCTGGTCCCAACATGTGTGGATTTTAACTCTGAGTGGGGTGCATTAAATCAAAAGAGAGAGG
CAGAAGATGAAATGCTAAAGAAGGGTCAGGCAAACTTCTGTTTCAGTATAAAATTCATCATGCAGGCTTCTGAGTGAAATAGAATGATTT
GAAACCACTACTGTATTGCCTGGATACACACACACACACACACACACACTTTATACAAAAATGTTAAAAGCAGGTTTCCTGGCATGTTCT
AAACTGTTTTTTCTTTAGGAATAAATTACATTTATCTGCACAGATGTTGAAAATCCTGTTAAACCCTTGTCAAGGATTTGTTTATTTTAC

>In-frame_WWOX_ENST00000355860_chr16_78198186_+_C15orf41_ENST00000562877_chr15_37100525_+_746nt
GCCCCGACGCGCGCGGGTCTCGTTTGGAGCGGGAGTGAGTTCCTGAGCGAGTGGACCCGGCAGCGGGCGATAGGGGGGCCAGGTGCCTCC
ACAGTCAGCCATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGGAGAGAACCAC
CAAGGACGGCTGGGTTTACTACGCCAATCACACCGAGGAGAAGACTCAGTGGGAACATCCAAAAACTGGAAAAAGAAAACGAGTGGCAGG
AGATTTGCCATACGGATGGGAACAAGAAACTGATGAGAACGGACAAGTGTTTTTTGTTGACCATATAAATAAAAGAACCACCTACTTGGA
CCCAAGACTGGCGTTTACTGTGGATGATAATCCGACCAAGCCAACCACCCGGCAAAGATACGACGGCAGCACCACTGCCATGGAAATTCT
CCAGGGCCGGGATTTCACTGGCAAAGTGGTTGTGGTCACTGGAGCTAATTCAGGAATAGGGTTCGAAACCGCCAAGTCTTTTGCCCTCCA
TGGTGCACATGTGATCTTGGCCTGCAGGAACATGGCAAGGGCGAGTGAAGCAGTGTCACGCATTTTAGAAGAATGGATTTGGGCCAGGCT
TAGTCATCTATTGGTATGGATTTATCCAGGAGCTGGACTGCAACCGGGAAAGGGGCATCCTGCTCAAAGCCTGTTTCCCCACGAACATTG


Top

FusionGenePPI for WWOX_C15orf41


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WWOXTP53, CPSF6, TNK2, ERBB4, MDM2, TP63, MAPK8, LMNA, POLR2A, POLR2B, SMARCC1, TCERG1, CPSF1, CPSF2, CPSF3, NUDT21, FIP1L1, CPSF7, HNRNPK, RPRD2, PABPC1, SF3A1, SF3B1, SF3B3, SFPQ, SYMPK, WIPF2, WDR33, WBP2, SF3B2, KHSRP, CSTF3, HSPA4, DHX15, KRT4, MIA3, OTUD7B, PRPF8, ACIN1, PATL1, P4HA1, DSP, ANXA1, HSPA1A, PRRC2A, SERPINB3, COIL, PGD, DIAPH3, CSNK2A1, SNRNP200, DAZAP1, RPRD1B, HSPA8, ENAH, PABPC4, IGF2BP1, HSD17B10, HDLBP, DVL2, SF3A3, CCT2, SNRPD2, SMARCA4, CDC5L, YWHAZ, UBAP2, CANX, SNRPD1, JUP, RARA, PRMT5, U2SURP, TGM3, TDRD3, PKLR, NOLC1, YLPM1, WASL, CSTF2, MATR3, TOE1, BCL9, CRNN, HIST2H2AA3, DVL3, P3H1, PRPF3, CSNK2A2, SCAF4, DSG3, RBMX, CYFIP1, USP6NL, DDX6, XRN2, IVL, XAB2, AMOTL1, MPDZ, DDX3Y, HNRNPUL1, DHX9, POLR2E, FBRS, WDR77, SEC23A, ZMAT5, DGCR14, LZTS2, NOSIP, DCAF7, GEMIN5, PRPF40A, EIF4A3, INPPL1, LSM4, DDX17, IGF2BP3, RC3H1, MPP5, POLR2C, FARSA, HNRNPH3, DHX30, RPRD1A, ZG16B, NONO, PREB, PABPC3, LONP2, ATN1, GABARAPL2, HNRNPR, HNRNPCL1, CYFIP2, ELAVL1, ITCH, DRG1, SNRPD3, RPAP3, DROSHA, HNRNPU, SMN2, CAD, CCT7, PTPN14, PPP1CA, HNRNPA3, DDX39B, SCGB2A1, KRT75, DDX21, SPG20, CSDE1, HNRNPF, SRSF10, SEC23IP, ATP2A1, DIAPH1, LCN1, DOCK7, CXorf57, SF3A2, HSPB1, TARDBP, SF3B6, A2ML1, AMOT, THOC6, KIF2A, LUC7L3, MYH7, MYH1, MYH4, MYH16, DDX1, ENO1, TP73, CCT6A, SMARCE1, ANXA2, ACLY, SCAF8, ALDH3A1, PPIB, EDC4, RPL6, USP39, EIF3A, H2AFZ, RPL30, KDM3B, FUS, SERPINB5, DVL1, RAPGEF2, DHX36, HN1L, POLR2G, BAIAP2, WDR91, DCTPP1, IQSEC1, PRDX5, LZTS3, RPS15AP21, SRSF3, ZNF598, LACRT, IGF2BP2, PAICS, KIAA1522, SLC4A1AP, ATXN2, THRAP3, RBM39, CAPZA1, SEC24C, NOP56, SRPK1, DKC1, IK, HADHA, OGT, PRPF31, DIDO1, ATAD3A, PDCD7, HUWE1, ATM, TRIM28, HIF1A, LATS1, FAM189B, TMEM171, FAM189A2, WBP1, TMEM92, LDLRAD4, CLNK, BTRC, NUP133, CDH1, FKBP15, SERPINA5, ARRDC3, NME2, GORASP1, ZBTB33, LYZ, TRIM25, BRCA1C15orf41ASF1B, HIST1H3A, ASF1A, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneWWOXchr16:78198186chr15:37100525ENST00000355860+56125_414172190MAPT
HgeneWWOXchr16:78198186chr15:37100525ENST00000402655+15125_414-42312MAPT
HgeneWWOXchr16:78198186chr15:37100525ENST00000406884+56125_414172235MAPT
HgeneWWOXchr16:78198186chr15:37100525ENST00000408984+510125_414172311MAPT
HgeneWWOXchr16:78198186chr15:37100525ENST00000566780+59125_414172415MAPT
HgeneWWOXchr16:78198186chr15:37100525ENST00000569818+11125_414-3537MAPT


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WWOX_C15orf41


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WWOX_C15orf41


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneWWOXC0007137Squamous cell carcinoma1CTD_human
HgeneWWOXC0038356Stomach Neoplasms1CTD_human
HgeneWWOXC0042076Urologic Neoplasms1CTD_human
HgeneWWOXC0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneWWOXC1458155Mammary Neoplasms1CTD_human
HgeneWWOXC3280452SPINOCEREBELLAR ATAXIA, AUTOSOMAL RECESSIVE 121ORPHANET;UNIPROT
HgeneWWOXC3495559Juvenile arthritis1CTD_human
HgeneWWOXC4015519EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 281UNIPROT
TgeneC15orf41C3810185ANEMIA, CONGENITAL DYSERYTHROPOIETIC, TYPE Ib1UNIPROT