FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42003

FusionGeneSummary for WIPF2_ERBB2

check button Fusion gene summary
Fusion gene informationFusion gene name: WIPF2_ERBB2
Fusion gene ID: 42003
HgeneTgene
Gene symbol

WIPF2

ERBB2

Gene ID

147179

2064

Gene nameWAS/WASL interacting protein family member 2erb-b2 receptor tyrosine kinase 2
SynonymsWICH|WIRECD340|HER-2|HER-2/neu|HER2|MLN 19|NEU|NGL|TKR1
Cytomap

17q21.2

17q12

Type of geneprotein-codingprotein-coding
DescriptionWAS/WASL-interacting protein family member 2WASP-binding proteinWASP-interacting protein-related proteinWIP- and CR16-homologous proteinWIP-related proteinreceptor tyrosine-protein kinase erbB-2c-erb B2/neu proteinherstatinhuman epidermal growth factor receptor 2metastatic lymph node gene 19 proteinneuro/glioblastoma derived oncogene homologneuroblastoma/glioblastoma derived oncogene homologp185erbB2
Modification date2018052320180527
UniProtAcc

Q8TF74

P04626

Ensembl transtripts involved in fusion geneENST00000494757, ENST00000323571, 
ENST00000585043, ENST00000394103, 
ENST00000536600, ENST00000583130, 
ENST00000584601, ENST00000406381, 
ENST00000541774, ENST00000445658, 
ENST00000540147, ENST00000584450, 
ENST00000269571, ENST00000578199, 
ENST00000540042, ENST00000584888, 
Fusion gene scores* DoF score28 X 7 X 15=294017 X 14 X 7=1666
# samples 2818
** MAII scorelog2(28/2940*10)=-3.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(18/1666*10)=-3.21031958903587
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: WIPF2 [Title/Abstract] AND ERBB2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneERBB2

GO:0007165

signal transduction

10572067

TgeneERBB2

GO:0007166

cell surface receptor signaling pathway

9685399

TgeneERBB2

GO:0007169

transmembrane receptor protein tyrosine kinase signaling pathway

7514177

TgeneERBB2

GO:0014065

phosphatidylinositol 3-kinase signaling

7556068

TgeneERBB2

GO:0032886

regulation of microtubule-based process

20937854

TgeneERBB2

GO:0042060

wound healing

12646923

TgeneERBB2

GO:0043406

positive regulation of MAP kinase activity

10572067

TgeneERBB2

GO:0045785

positive regulation of cell adhesion

7556068

TgeneERBB2

GO:0045945

positive regulation of transcription by RNA polymerase III

19372587

TgeneERBB2

GO:0046777

protein autophosphorylation

7556068

TgeneERBB2

GO:0050679

positive regulation of epithelial cell proliferation

10572067

TgeneERBB2

GO:0071363

cellular response to growth factor stimulus

20010870

TgeneERBB2

GO:0090314

positive regulation of protein targeting to membrane

20010870


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-R5-A7ZE-01BWIPF2chr17

38421398

+ERBB2chr17

37872554

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
3UTR-3CDSENST00000494757ENST00000584601WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000406381WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000541774WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000445658WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000540147WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000584450WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000269571WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000578199WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-3CDSENST00000494757ENST00000540042WIPF2chr17

38421398

+ERBB2chr17

37872554

+
3UTR-intronENST00000494757ENST00000584888WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000584601WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000406381WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000541774WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000445658WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000540147WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000584450WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000269571WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000578199WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000323571ENST00000540042WIPF2chr17

38421398

+ERBB2chr17

37872554

+
5CDS-intronENST00000323571ENST00000584888WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000584601WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000406381WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000541774WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000445658WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000540147WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000584450WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000269571WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000578199WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000585043ENST00000540042WIPF2chr17

38421398

+ERBB2chr17

37872554

+
5CDS-intronENST00000585043ENST00000584888WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000584601WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000406381WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000541774WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000445658WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000540147WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000584450WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000269571WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000578199WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000394103ENST00000540042WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-intronENST00000394103ENST00000584888WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000584601WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000406381WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000541774WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000445658WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000540147WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000584450WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000269571WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000578199WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-3CDSENST00000536600ENST00000540042WIPF2chr17

38421398

+ERBB2chr17

37872554

+
intron-intronENST00000536600ENST00000584888WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000584601WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000406381WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000541774WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000445658WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000540147WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000584450WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000269571WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000578199WIPF2chr17

38421398

+ERBB2chr17

37872554

+
In-frameENST00000583130ENST00000540042WIPF2chr17

38421398

+ERBB2chr17

37872554

+
5CDS-intronENST00000583130ENST00000584888WIPF2chr17

38421398

+ERBB2chr17

37872554

+

Top

FusionProtFeatures for WIPF2_ERBB2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WIPF2

Q8TF74

ERBB2

P04626

Plays an active role in the formation of cell surfaceprotrusions downstream of activated PDGFB receptors. Plays animportant role in actin-microspike formation through cooperationwith WASL. May cooperate with WASP and WASL to induce mobilizationand reorganization of the actin filament system.{ECO:0000269|PubMed:11829459, ECO:0000269|PubMed:12213210}. Protein tyrosine kinase that is part of several cellsurface receptor complexes, but that apparently needs a coreceptorfor ligand binding. Essential component of a neuregulin-receptorcomplex, although neuregulins do not interact with it alone. GP30is a potential ligand for this receptor. Regulates outgrowth andstabilization of peripheral microtubules (MTs). Upon ERBB2activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits thephosphorylation and thus the inhibition of GSK3B at cell membrane.This prevents the phosphorylation of APC and CLASP2, allowing itsassociation with the cell membrane. In turn, membrane-bound APCallows the localization of MACF1 to the cell membrane, which isrequired for microtubule capture and stabilization. {ECO:0000305}. In the nucleus is involved in transcriptionalregulation. Associates with the 5'-TCAAATTC-3' sequence in thePTGS2/COX-2 promoter and activates its transcription. Implicatedin transcriptional activation of CDKN1A; the function involvesSTAT3 and SRC. Involved in the transcription of rRNA genes by RNAPol I and enhances protein synthesis and cell growth.{ECO:0000269|PubMed:10358079, ECO:0000269|PubMed:15380516,ECO:0000269|PubMed:21555369}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for WIPF2_ERBB2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_875aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_453aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_453aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_875aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_453aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_453aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_875aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_1075aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT
HSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPTVSRLLGICLTSTVQLVTQLMPTGCLLDHVR
ENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSTGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQN
EDLGPASPLDSTFYRSLLEDDDMGDLVDAEETLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGA
GSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPETVNQPDVRPQPPSPREGPLPAARPAGATLERPK

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_453aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_453aa
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGTGSGGAALQPKGGLFQG
GVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTN
ESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECV
EECRVLQGLPRETVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_2625nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_1359nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_1359nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_2625nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_1359nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_1359nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_2625nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_3225nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATT
CTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTG
CAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGG
AAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCC
ATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATAT
GTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGG
GAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTC
GTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGAC
ATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCAC
CAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATC
CCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATT
GACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAAT
GAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAG
GAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCT
ACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCT
GGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGG
TACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAAC
CAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAG
ACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGA
GGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_1359nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_1359nt
ATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGT
AGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGT
GCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGA
GGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCT
GCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGG
ATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCA
CCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCA
CCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGA
ACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAAT
GAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACC
TCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC


* Fusion transcript sequences (Full-length transcript).
>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_3782nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGC
TGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTT
GGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACA
CCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTT
GGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCC
AAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACA
TCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGAC
CTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTG
CTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGG
GGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACT
GTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTG
CCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAG
TTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGAC
AGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTC
TGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTA
GGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGA
ATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCC
TCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCG
CCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTC
AAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCT
GCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCT
ACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAG
CAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTA
AGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGAT
TCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCC

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_4083nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGC
TGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTT
GGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACA
CCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTT
GGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCC
AAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACA
TCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGAC
CTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTG
CTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGG
GGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACT
GTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTG
CCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAG
TTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGAC
AGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTC
TGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTA
GGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGA
ATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCC
TCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCG
CCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTC
AAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCT
GCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCT
ACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAG
CAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTA
AGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGAT
TCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCC
TTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGT
ACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTT
TGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTT

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_4083nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGC
TGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTT
GGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACA
CCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTT
GGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCC
AAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACA
TCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGAC
CTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTG
CTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGG
GGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACT
GTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTG
CCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAG
TTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGAC
AGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTC
TGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTA
GGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGA
ATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCC
TCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCG
CCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTC
AAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCT
GCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCT
ACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAG
CAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTA
AGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGAT
TCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCC
TTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGT
ACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTT
TGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTT

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_3500nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGC
TGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTT
GGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACA
CCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTT
GGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCC
AAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACA
TCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGAC
CTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTG
CTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGG
GGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACT
GTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTG
CCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAG
TTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGAC
AGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTC
TGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTA
GGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGA
ATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCC
TCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCG
CCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTC
AAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCT
GCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCT

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_4083nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGC
TGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTT
GGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACA
CCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTT
GGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCC
AAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACA
TCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGAC
CTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTG
CTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGG
GGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACT
GTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTG
CCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAG
TTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGAC
AGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTC
TGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTA
GGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGA
ATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCC
TCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCG
CCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTC
AAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCT
GCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCT
ACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAG
CAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTA
AGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGAT
TCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCC
TTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGT
ACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTT
TGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTT

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_3212nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGC
TGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTT
GGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACA
CCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTT
GGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCC
AAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACA
TCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGAC
CTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTG
CTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGG
GGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACT
GTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTG
CCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAG
TTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGAC
AGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTC
TGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAATATGTGAACCAGCCAGATGTTC
GGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAG
GGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTC
AGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCA

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_4083nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGC
TGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTT
GGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACA
CCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTT
GGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCC
AAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACA
TCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGAC
CTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTG
CTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGG
GGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACT
GTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTG
CCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAG
TTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGAC
AGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTC
TGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTA
GGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGA
ATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCC
TCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCG
CCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTC
AAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCT
GCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCT
ACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAG
CAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTA
AGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGAT
TCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCC
TTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGT
ACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTT
TGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTT

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_1772nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAG
AAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGAC

>In-frame_WIPF2_ENST00000323571_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_1768nt
GGGGACGGTGGGAGCAGATCCATTTCCGGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAG
AGCTTGCCGGGGGGCGAGCAGGACAGGACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTATATGAA
TGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCA
CCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTC
TTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGC
AGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCC
AAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCC
AGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCT
CGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCC
ACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGT
CGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCT
CCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACAC
AATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGG
CCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGG
GGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCC
AGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCT
GACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATG
CCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAG
AAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGAC

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_3780nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTG
CCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGG
GATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACC
TAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGG
CACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAA
AGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATC
CACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCT
GCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCT
GGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGG
CAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGT
GTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCC
CCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTT
GGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAG
CACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTG
TCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGG
GCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAAT
GGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTC
TGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCC
CCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAA
AGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGC
CTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTAC
GGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCA
GGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAG
GAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTC
TGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_4081nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTG
CCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGG
GATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACC
TAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGG
CACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAA
AGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATC
CACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCT
GCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCT
GGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGG
CAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGT
GTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCC
CCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTT
GGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAG
CACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTG
TCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGG
GCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAAT
GGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTC
TGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCC
CCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAA
AGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGC
CTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTAC
GGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCA
GGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAG
GAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTC
TGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTT
AGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTAC
TGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTG
TTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_4081nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTG
CCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGG
GATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACC
TAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGG
CACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAA
AGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATC
CACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCT
GCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCT
GGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGG
CAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGT
GTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCC
CCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTT
GGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAG
CACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTG
TCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGG
GCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAAT
GGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTC
TGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCC
CCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAA
AGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGC
CTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTAC
GGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCA
GGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAG
GAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTC
TGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTT
AGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTAC
TGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTG
TTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_3498nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTG
CCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGG
GATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACC
TAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGG
CACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAA
AGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATC
CACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCT
GCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCT
GGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGG
CAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGT
GTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCC
CCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTT
GGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAG
CACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTG
TCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGG
GCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAAT
GGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTC
TGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCC
CCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAA
AGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGC
CTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTAC

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_4081nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTG
CCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGG
GATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACC
TAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGG
CACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAA
AGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATC
CACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCT
GCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCT
GGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGG
CAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGT
GTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCC
CCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTT
GGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAG
CACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTG
TCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGG
GCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAAT
GGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTC
TGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCC
CCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAA
AGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGC
CTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTAC
GGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCA
GGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAG
GAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTC
TGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTT
AGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTAC
TGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTG
TTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_3210nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTG
CCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGG
GATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACC
TAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGG
CACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAA
AGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATC
CACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCT
GCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCT
GGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGG
CAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGT
GTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCC
CCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTT
GGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAG
CACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTG
TCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAATATGTGAACCAGCCAGATGTTCGG
CCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGG
AAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAG
CCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACC

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_4081nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTG
CCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCATCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGG
GATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGTACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACC
TAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCCTGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGG
CACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGAATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAA
AGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGGCTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATC
CACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCT
GCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCTACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCT
GGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCGGGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGG
CAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTCTCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGT
GTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATGGGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCC
CCAGCCCCCCATCTGCACCATTGATGTCTACATGATCATGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTT
GGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGCGCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAG
CACCTTCTACCGCTCACTGCTGGAGGACGATGACATGGGGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTG
TCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGG
GCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAAT
GGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTC
TGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCC
CCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAA
AGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGC
CTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTAC
GGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCA
GGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAGGGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAG
GAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAAGGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTC
TGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGATGCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTT
AGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGAGTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTAC
TGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTATCCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTG
TTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATGGGTGTTGTATGGGGAGGCAAGTGTGGGGGGTCCTTCTCCACACCCACTTTGT

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_1770nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAA
AGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGACAA

>In-frame_WIPF2_ENST00000585043_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_1766nt
GGGTTGGCAAAAGGGGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGGCGAGAAAGAGCTTGCCGGGGGGCGAGCAGGACAGG
ACGAAGCCGGAGTGTAGGCGGCAGAGGATTCGCTCCCAGAGCAGCTGCGGCCAGGTCGGAAAGAGGCCGGGGCGGCTGGGTATATGAATG
ACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGCCAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACC
TGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACACAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTT
ACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGACCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAG
TGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCAAGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAA
GGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGCAAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAG
CGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCTCACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCG
GCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCTCCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCAC
ACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACAACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCG
AGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTCCTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCC
TCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATGGACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAA
TTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCCTAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCC
ACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAGTGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGG
TCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAG
GGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGA
CCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCC
CATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAA
AGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGACAA

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000584601_chr17_37872554_+_3742nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCA
TCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGT
ACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCC
TGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGA
ATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGG
CTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCT
GCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCT
ACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCG
GGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTC
TCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATG
GGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCA
TGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGC
GCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGG
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACC
ACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCAC
TGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATG
ACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCC
CCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTG
CCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCG
AGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACC
AGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAG
TGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAG
GGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAA
GGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGAT

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000406381_chr17_37872554_+_4043nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCA
TCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGT
ACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCC
TGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGA
ATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGG
CTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCT
GCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCT
ACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCG
GGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTC
TCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATG
GGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCA
TGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGC
GCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGG
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACC
ACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCAC
TGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATG
ACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCC
CCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTG
CCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCG
AGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACC
AGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAG
TGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAG
GGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAA
GGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGAT
GCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGA
GTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTAT
CCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000541774_chr17_37872554_+_4043nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCA
TCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGT
ACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCC
TGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGA
ATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGG
CTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCT
GCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCT
ACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCG
GGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTC
TCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATG
GGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCA
TGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGC
GCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGG
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACC
ACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCAC
TGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATG
ACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCC
CCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTG
CCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCG
AGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACC
AGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAG
TGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAG
GGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAA
GGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGAT
GCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGA
GTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTAT
CCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000445658_chr17_37872554_+_3460nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCA
TCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGT
ACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCC
TGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGA
ATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGG
CTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCT
GCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCT
ACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCG
GGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTC
TCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATG
GGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCA
TGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGC
GCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGG
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACC
ACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCAC
TGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATG
ACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCC
CCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTG
CCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCG
AGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACC
AGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000540147_chr17_37872554_+_4043nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCA
TCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGT
ACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCC
TGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGA
ATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGG
CTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCT
GCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCT
ACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCG
GGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTC
TCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATG
GGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCA
TGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGC
GCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGG
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACC
ACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCAC
TGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATG
ACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCC
CCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTG
CCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCG
AGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACC
AGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAG
TGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAG
GGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAA
GGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGAT
GCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGA
GTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTAT
CCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000584450_chr17_37872554_+_3172nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCA
TCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGT
ACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCC
TGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGA
ATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGG
CTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCT
GCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCT
ACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCG
GGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTC
TCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATG
GGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCA
TGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGC
GCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGG
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACC
ACAGGCACCGCAGCTCATCTACCAGGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGC
TGCCCGACCTGCTGGTGCCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGG
TGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAA
CCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCT

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000269571_chr17_37872554_+_4043nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCCTGTGTGGACCTGGATGACAAGGGCTGCCCCGCCGAGCAGAGAGCCAGCCCTCTGACGTCCATCA
TCTCTGCGGTGGTTGGCATTCTGCTGGTCGTGGTCTTGGGGGTGGTCTTTGGGATCCTCATCAAGCGACGGCAGCAGAAGATCCGGAAGT
ACACGATGCGGAGACTGCTGCAGGAAACGGAGCTGGTGGAGCCGCTGACACCTAGCGGAGCGATGCCCAACCAGGCGCAGATGCGGATCC
TGAAAGAGACGGAGCTGAGGAAGGTGAAGGTGCTTGGATCTGGCGCTTTTGGCACAGTCTACAAGGGCATCTGGATCCCTGATGGGGAGA
ATGTGAAAATTCCAGTGGCCATCAAAGTGTTGAGGGAAAACACATCCCCCAAAGCCAACAAAGAAATCTTAGACGAAGCATACGTGATGG
CTGGTGTGGGCTCCCCATATGTCTCCCGCCTTCTGGGCATCTGCCTGACATCCACGGTGCAGCTGGTGACACAGCTTATGCCCTATGGCT
GCCTCTTAGACCATGTCCGGGAAAACCGCGGACGCCTGGGCTCCCAGGACCTGCTGAACTGGTGTATGCAGATTGCCAAGGGGATGAGCT
ACCTGGAGGATGTGCGGCTCGTACACAGGGACTTGGCCGCTCGGAACGTGCTGGTCAAGAGTCCCAACCATGTCAAAATTACAGACTTCG
GGCTGGCTCGGCTGCTGGACATTGACGAGACAGAGTACCATGCAGATGGGGGCAAGGTGCCCATCAAGTGGATGGCGCTGGAGTCCATTC
TCCGCCGGCGGTTCACCCACCAGAGTGATGTGTGGAGTTATGGTGTGACTGTGTGGGAGCTGATGACTTTTGGGGCCAAACCTTACGATG
GGATCCCAGCCCGGGAGATCCCTGACCTGCTGGAAAAGGGGGAGCGGCTGCCCCAGCCCCCCATCTGCACCATTGATGTCTACATGATCA
TGGTCAAATGTTGGATGATTGACTCTGAATGTCGGCCAAGATTCCGGGAGTTGGTGTCTGAATTCTCCCGCATGGCCAGGGACCCCCAGC
GCTTTGTGGTCATCCAGAATGAGGACTTGGGCCCAGCCAGTCCCTTGGACAGCACCTTCTACCGCTCACTGCTGGAGGACGATGACATGG
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACC
ACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCAC
TGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATG
ACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCC
CCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTG
CCACTCTGGAAAGGCCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCG
AGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACC
AGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAG
TGTGAACCAGAAGGCCAAGTCCGCAGAAGCCCTGATGTGTCCTCAGGGAGCAGGGAAGGCCTGACTTCTGCTGGCATCAAGAGGTGGGAG
GGCCCTCCGACCACTTCCAGGGGAACCTGCCATGCCAGGAACCTGTCCTAAGGAACCTTCCTTCCTGCTTGAGTTCCCAGATGGCTGGAA
GGGGTCCAGCCTCGTTGGAAGAGGAACAGCACTGGGGAGTCTTTGTGGATTCTGAGGCCCTGCCCAATGAGACTCTAGGGTCCAGTGGAT
GCCACAGCCCAGCTTGGCCCTTTCCTTCCAGATCCTGGGTACTGAAAGCCTTAGGGAAGCTGGCCTGAGAGGGGAAGCGGCCCTAAGGGA
GTGTCTAAGAACAAAAGCGACCCATTCAGAGACTGTCCCTGAAACCTAGTACTGCCCCCCATGAGGAAGGAACAGCAATGGTGTCAGTAT
CCAGGCTTTGTACAGAGTGCTTTTCTGTTTAGTTTTTACTTTTTTTGTTTTGTTTTTTTAAAGATGAAATAAAGACCCAGGGGGAGAATG

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000578199_chr17_37872554_+_1732nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTT
ACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAAAATTAAAACATGA

>In-frame_WIPF2_ENST00000583130_chr17_38421398_+_ERBB2_ENST00000540042_chr17_37872554_+_1728nt
AGGCAATAAGGGCTCCTGAAGGGTTGGGTGAGTTAAGGCGGCAACTCTGTGAGGAACGAGGTAATCGTGCGCAAAAAGGGAGACGGGAAC
GGAGGACCTGTTGGGAACGGCTAATTAGCAGGATGCTGTGGGTATATGAATGACCTAAAGGTACAAATAAAGACGGAGAGAGAACAGTGC
CAACTGGGAGCAGGGCAAGAATGCCAATTCCTCCTCCCCCGCCACCCCCACCTGGTCCTCCTCCACCTCCCACATTTCATCAGGCAAACA
CAGAGCAGCCCAAGCTGAGTAGAGATGAGCAGCGGGGTCGAGGCGCCCTCTTACAGGACATTTGCAAAGGGACCAAGCTGAAGAAGGTGA
CCAACATTAATGATCGGAGTGCTCCCATCCTCGAGAAGCCGAAAGGAAGCAGTGGTGGCTATGGCTCTGGAGGAGCTGCCCTGCAGCCCA
AGGGAGGTCTCTTCCAAGGAGGAGTGCTGAAGCTTCGACCTGTGGGAGCCAAGGATGGTTCAGAGAACCTAGCTGGTAAGCCAGCCCTGC
AAATCCCCAGTTCTCGAGCTGCTGCCCCAAGGCCTCCAGTATCTGCCGCCAGCGGGCGTCCTCAGGATGATACAGACAGCAGCCGGGCCT
CACTCCCAGAACTGCCCCGGATGCAGAGACCCTCTTTACCGGACCTCTCTCGGCCTAATACCACCAGCAGTACGGGCATGAAGCACAGCT
CCTCTGCCCCTCCCCCACCACCCCCAGGGCGGCGTGCCAACGCACCCCCCACACCTCTGCCTATGCACAGCAGCAAAGCCCCCGCCTACA
ACAGAGAGAAACCCTTGCCACCGACGCCTGGACAAAGGCTTCACCCTGGTCGAGAGGGACCTCCTGCTCCACCCCCAGTCAAACCACCTC
CTTCCCCTGTGAATATCAGAACAGGACCAAGTGGCCAGTCTCTGGCTCCTCCTCCTCCGCCTTACCGCCAGCCTCCTGGGGTCCCCAATG
GACCCTCTAGCCCCACTAATGAGTCAGCCCCTGAGCTGCCACAGAGACACAATTCTTTGCATAGGAAGACACCAGGGCCTGTCAGAGGCC
TAGCACCTCCTCCACCCACCTCGGCCTCCCCATCTTTACTGAGTAATAGGCCACCTCCCCCAGCCCGAGACCCTCCCAGTCGGGGAGCAG
TGGGCGAGGGCCTGGCCTGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCC
TTCGGGGCCAGGAGTGCGTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACC
CTGAGTGTCAGCCCCAGAATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCT
TCTGCGTGGCCCGCTGCCCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGC
CTTGCCCCATCAACTGCACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTT
ACTATAAAAGGGGACCAACTCTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAAAATTAAAACATGA


Top

FusionGenePPI for WIPF2_ERBB2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WIPF2DNMBP, WAS, NCK2, GRB2, ITSN2, SH3KBP1, WASL, EIF4A3, TXLNG, SLC4A1AP, HNRNPDL, ZFAND5, ZNF830, TCERG1, APBB1, WWOX, PACSIN2, NCK1, CDH1, TRIM25ERBB2SHC1, SH3BGRL, PTPN11, GRB2, MUC1, CTNNB1, ERBB2, CD82, EGF, PAK1, ERBB2IP, PICK1, PIK3R2, DLG4, ERBB4, NRG1, JUP, STAT3, SRC, JAK2, HSP90B1, CD44, GRB7, PLCG1, IL6ST, OSMR, PTK2B, HSP90AA1, ELF3, EGFR, ERBB3, HDAC6, LRIG1, STUB1, HSPA4, IGF1R, CUL5, ESR1, PPP1R13B, H2AFY, PIK3R1, PIN1, PTK6, ACTB, POLR1B, KPNB1, XPO1, CLTC, AP2B1, EEA1, APBB1, SH2B2, IRS4, SH2D1B, SOCS1, NCK2, DAB1, GRAP2, APBB3, ABL1, FGR, CHN1, FER, PLCG2, RASA1, JAK1, IRS1, STAT1, MATK, TEC, TXK, ABL2, SYK, CRK, CRKL, BLK, BMX, VAV2, SH3BP2, SHC2, ITK, SLA, MAPK8IP2, RIN1, BCAR3, TENC1, TNS3, DOK6, SH2D5, SUPT6H, ANKS1B, CLNK, DOK4, BLNK, RIN2, SHC3, PIK3R3, ANKS1A, VAV1, DOK1, SH2D3A, SLA2, SH2D2A, CISH, VAV3, MAPK8IP1, SH2B3, TLN1, SRPK1, CBL, ERRFI1, FRS3, USP2, NXF1, DTWD2, TGFBR2, NAALADL2, LPAR6, VSIG4, PTGER3, CYP17A1, GLCE, IL13RA2, KLK5, LYPD3, NAT2, PRDM14, PSMC3IP, RHOBTB2, THRSP, ANXA6, BAI1, CLCN6, GMPR2, HDLBP, IARS, MTCH1, MUCL1, PHF23, POLD2, PSAP, STK24, TCEAL2, ATP6AP1, TTC9B, UTP18, ATP1A1, EEF1G, TNPO1, PC, SURF4, TFRC, VAPB, PTDSS1, HPSE, ZNF280C, CCDC88A, ZNF622, BTC, PTK2, TGFA, BCAR1, ESRRB, CDC37, EZR, RDX, ITGAV, L1CAM, ITGB1, CHEK2, TOP1, RRM2, CDK4, CDH2, CDH1, PTPN6, PTPRR, PTPRT, PTPRU, PTPRA, PTPRH, MPZL2, SSH1, CD79B, MAS1, HAVCR2, IL4R, PPM1A, PPM1F, ILKAP, DUSP14, DUSP18, DUSP19, STYX, GAB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WIPF2_ERBB2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneERBB2P04626DB06366PertuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved
TgeneERBB2P04626DB08916AfatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved
TgeneERBB2P04626DB00072TrastuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational
TgeneERBB2P04626DB01259LapatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved|investigational
TgeneERBB2P04626DB05773Trastuzumab emtansineReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational

Top

RelatedDiseases for WIPF2_ERBB2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneERBB2C1458155Mammary Neoplasms40CTD_human
TgeneERBB2C0033578Prostatic Neoplasms3CTD_human
TgeneERBB2C0038356Stomach Neoplasms3CTD_human
TgeneERBB2C0001418Adenocarcinoma2CTD_human
TgeneERBB2C0024668Mammary Neoplasms, Experimental2CTD_human
TgeneERBB2C0919267ovarian neoplasm2CTD_human
TgeneERBB2C0007117Basal cell carcinoma1CTD_human
TgeneERBB2C0007134Renal Cell Carcinoma1CTD_human
TgeneERBB2C0009375Colonic Neoplasms1CTD_human
TgeneERBB2C0014859Esophageal Neoplasms1CTD_human
TgeneERBB2C0016978gallbladder neoplasm1CTD_human
TgeneERBB2C0017185Gastrointestinal Neoplasms1CTD_human
TgeneERBB2C0024121Lung Neoplasms1CTD_human
TgeneERBB2C0024232Lymphatic Metastasis1CTD_human
TgeneERBB2C0024667Animal Mammary Neoplasms1CTD_human
TgeneERBB2C0025149Medulloblastoma1CTD_human
TgeneERBB2C0027627Neoplasm Metastasis1CTD_human
TgeneERBB2C0027643Neoplasm Recurrence, Local1CTD_human
TgeneERBB2C0027659Neoplasms, Experimental1CTD_human
TgeneERBB2C0030354Papilloma1CTD_human
TgeneERBB2C0206698Cholangiocarcinoma1CTD_human
TgeneERBB2C0596263Carcinogenesis1CTD_human
TgeneERBB2C2931822Nasopharyngeal carcinoma1CTD_human