FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41840

FusionGeneSummary for WDR37_FAM107B

check button Fusion gene summary
Fusion gene informationFusion gene name: WDR37_FAM107B
Fusion gene ID: 41840
HgeneTgene
Gene symbol

WDR37

FAM107B

Gene ID

22884

83641

Gene nameWD repeat domain 37family with sequence similarity 107 member B
Synonyms-C10orf45|HITS
Cytomap

10p15.3

10p13

Type of geneprotein-codingprotein-coding
DescriptionWD repeat-containing protein 37protein FAM107BFAM107B/CDNF fusionheat shock-inducible tumor small protein
Modification date2018052320180519
UniProtAcc

Q9Y2I8

Q9H098

Ensembl transtripts involved in fusion geneENST00000358220, ENST00000381329, 
ENST00000263150, ENST00000482165, 
ENST00000181796, ENST00000378470, 
ENST00000468747, ENST00000378467, 
ENST00000378465, ENST00000378458, 
ENST00000478076, ENST00000378462, 
ENST00000496330, ENST00000479731, 
ENST00000471815, 
Fusion gene scores* DoF score5 X 5 X 4=1009 X 7 X 6=378
# samples 59
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/378*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: WDR37 [Title/Abstract] AND FAM107B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-CU-A3QU-01AWDR37chr10

1142186

+FAM107Bchr10

14709690

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000358220ENST00000181796WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000378470WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000468747WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000378467WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000378465WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000378458WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000478076WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000378462WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000496330WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000479731WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000358220ENST00000471815WDR37chr10

1142186

+FAM107Bchr10

14709690

-
Frame-shitENST00000381329ENST00000181796WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000378470WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000468747WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000378467WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000378465WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000378458WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000478076WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000378462WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000496330WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000479731WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000381329ENST00000471815WDR37chr10

1142186

+FAM107Bchr10

14709690

-
In-frameENST00000263150ENST00000181796WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000378470WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000468747WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000378467WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000378465WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000378458WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000478076WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000378462WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000496330WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000479731WDR37chr10

1142186

+FAM107Bchr10

14709690

-
5CDS-intronENST00000263150ENST00000471815WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-3CDSENST00000482165ENST00000181796WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000378470WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000468747WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000378467WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000378465WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000378458WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000478076WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000378462WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000496330WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000479731WDR37chr10

1142186

+FAM107Bchr10

14709690

-
intron-intronENST00000482165ENST00000471815WDR37chr10

1142186

+FAM107Bchr10

14709690

-

Top

FusionProtFeatures for WDR37_FAM107B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WDR37

Q9Y2I8

FAM107B

Q9H098


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWDR37chr10:1142186chr10:14709690ENST00000263150+914154_194242495RepeatNote=WD 1
HgeneWDR37chr10:1142186chr10:14709690ENST00000263150+914197_236242495RepeatNote=WD 2
HgeneWDR37chr10:1142186chr10:14709690ENST00000358220+914154_194242495RepeatNote=WD 1
HgeneWDR37chr10:1142186chr10:14709690ENST00000358220+914197_236242495RepeatNote=WD 2
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000378458-0561_112-183132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000378462-0461_112-60132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000378465-0461_112-87132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000378467-0561_112-101132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000378470-0461_112-96132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000468747-0461_112-69132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000478076-0461_112-74132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000479731-0461_112-48132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000496330-0561_112-83132Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWDR37chr10:1142186chr10:14709690ENST00000263150+914279_318242495RepeatNote=WD 3
HgeneWDR37chr10:1142186chr10:14709690ENST00000263150+914321_360242495RepeatNote=WD 4
HgeneWDR37chr10:1142186chr10:14709690ENST00000263150+914365_403242495RepeatNote=WD 5
HgeneWDR37chr10:1142186chr10:14709690ENST00000263150+914406_445242495RepeatNote=WD 6
HgeneWDR37chr10:1142186chr10:14709690ENST00000263150+914452_493242495RepeatNote=WD 7
HgeneWDR37chr10:1142186chr10:14709690ENST00000358220+914279_318242495RepeatNote=WD 3
HgeneWDR37chr10:1142186chr10:14709690ENST00000358220+914321_360242495RepeatNote=WD 4
HgeneWDR37chr10:1142186chr10:14709690ENST00000358220+914365_403242495RepeatNote=WD 5
HgeneWDR37chr10:1142186chr10:14709690ENST00000358220+914406_445242495RepeatNote=WD 6
HgeneWDR37chr10:1142186chr10:14709690ENST00000358220+914452_493242495RepeatNote=WD 7
TgeneFAM107Bchr10:1142186chr10:14709690ENST00000181796-0561_112137307Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for WDR37_FAM107B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WDR37_ENST00000358220_chr10_1142186_+_FAM107B_ENST00000181796_chr10_14709690_-_412aa
MPTESASCSTARQTKQKRKSHSLSIRRTNSSEQERTGLPRDMLEGQDSKLPSSVRSTLLELFGQIEREFENLTIENLELRREIDTLNERL
AAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHT
ALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSEEEFREEPKCLELEQKMTSDSPPEDIDH
KDSTLITRSIMAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDL

>In-frame_WDR37_ENST00000263150_chr10_1142186_+_FAM107B_ENST00000181796_chr10_14709690_-_412aa
MPTESASCSTARQTKQKRKSHSLSIRRTNSSEQERTGLPRDMLEGQDSKLPSSVRSTLLELFGQIEREFENLTIENLELRREIDTLNERL
AAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHT
ALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDQTAHIWRYAVQLPTPQPVADTSEEEFREEPKCLELEQKMTSDSPPEDIDH
KDSTLITRSIMAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WDR37_ENST00000358220_chr10_1142186_+_FAM107B_ENST00000181796_chr10_14709690_-_1236nt
ATGCCCACAGAAAGCGCAAGTTGTTCGACTGCTCGCCAAACAAAACAGAAGCGCAAATCCCATAGCCTTTCTATACGAAGAACTAACAGC
TCGGAGCAGGAGAGGACGGGACTGCCAAGAGACATGTTAGAAGGACAAGATTCTAAACTGCCTTCCTCGGTTCGCAGTACACTTCTGGAA
CTGTTTGGTCAAATAGAAAGAGAATTTGAAAACCTTTATATCGAAAACTTAGAATTACGTAGAGAAATCGACACTCTTAATGAACGTTTA
GCTGCTGAAGGACAAGCGATTGATGGAGCAGAGCTGAGTAAGGGCCAACTCAAAACAAAAGCCAGTCACAGCACCAGCCAGCTCTCCCAG
AAACTGAAGACCACTTACAAGGCTTCCACCAGCAAGATTGTCTCCAGCTTTAAGACCACGACATCGAGAGCTGCCTGCCAGCTCGTGAAG
GAGTACATCGGCCACCGGGACGGCATCTGGGATGTCAGCGTGGCCAAGACACAGCCAGTGGTGCTCGGGACTGCATCAGCCGATCACACG
GCTTTGCTGTGGAGCATAGAGACAGGGAAGTGCCTAGTCAAGTACGCAGGCCACGTGGGCTCAGTAAATTCTATCAAATTTCATCCCTCA
GAGCAGTTGGCTCTCACTGCTTCTGGAGATCAGACTGCTCATATCTGGAGATACGCGGTGCAGCTGCCGACACCCCAGCCTGTTGCTGAC
ACTAGTGAAGAAGAATTTCGAGAAGAACCTAAATGCCTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCAT
AAGGACTCATATCTCATTACAAGAAGCATCATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTG
ATCAATCCTGTAAAAACCTCCCGGAACCATCAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAA
CCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGAGACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTG
GAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAGCAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAG

>In-frame_WDR37_ENST00000263150_chr10_1142186_+_FAM107B_ENST00000181796_chr10_14709690_-_1236nt
ATGCCCACAGAAAGCGCAAGTTGTTCGACTGCTCGCCAAACAAAACAGAAGCGCAAATCCCATAGCCTTTCTATACGAAGAACTAACAGC
TCGGAGCAGGAGAGGACGGGACTGCCAAGAGACATGTTAGAAGGACAAGATTCTAAACTGCCTTCCTCGGTTCGCAGTACACTTCTGGAA
CTGTTTGGTCAAATAGAAAGAGAATTTGAAAACCTTTATATCGAAAACTTAGAATTACGTAGAGAAATCGACACTCTTAATGAACGTTTA
GCTGCTGAAGGACAAGCGATTGATGGAGCAGAGCTGAGTAAGGGCCAACTCAAAACAAAAGCCAGTCACAGCACCAGCCAGCTCTCCCAG
AAACTGAAGACCACTTACAAGGCTTCCACCAGCAAGATTGTCTCCAGCTTTAAGACCACGACATCGAGAGCTGCCTGCCAGCTCGTGAAG
GAGTACATCGGCCACCGGGACGGCATCTGGGATGTCAGCGTGGCCAAGACACAGCCAGTGGTGCTCGGGACTGCATCAGCCGATCACACG
GCTTTGCTGTGGAGCATAGAGACAGGGAAGTGCCTAGTCAAGTACGCAGGCCACGTGGGCTCAGTAAATTCTATCAAATTTCATCCCTCA
GAGCAGTTGGCTCTCACTGCTTCTGGAGATCAGACTGCTCATATCTGGAGATACGCGGTGCAGCTGCCGACACCCCAGCCTGTTGCTGAC
ACTAGTGAAGAAGAATTTCGAGAAGAACCTAAATGCCTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCAT
AAGGACTCATATCTCATTACAAGAAGCATCATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTG
ATCAATCCTGTAAAAACCTCCCGGAACCATCAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAA
CCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGAGACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTG
GAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAGCAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_WDR37_ENST00000358220_chr10_1142186_+_FAM107B_ENST00000181796_chr10_14709690_-_4010nt
AGAACGATGGCCTTTCTGCGGTGTCTGCGACCGGGACCAAGGCGGAGCAAAGTCGCCGGGGGTGTGGGGTGTTCCACGCTATGTTGGGAG
TGTTCGCTTTCGAGCTTATTGCAGGAGTGACCAGGACACTACCTCCTAGAAGTAATGCCCACAGAAAGCGCAAGTTGTTCGACTGCTCGC
CAAACAAAACAGAAGCGCAAATCCCATAGCCTTTCTATACGAAGAACTAACAGCTCGGAGCAGGAGAGGACGGGACTGCCAAGAGACATG
TTAGAAGGACAAGATTCTAAACTGCCTTCCTCGGTTCGCAGTACACTTCTGGAACTGTTTGGTCAAATAGAAAGAGAATTTGAAAACCTT
TATATCGAAAACTTAGAATTACGTAGAGAAATCGACACTCTTAATGAACGTTTAGCTGCTGAAGGACAAGCGATTGATGGAGCAGAGCTG
AGTAAGGGCCAACTCAAAACAAAAGCCAGTCACAGCACCAGCCAGCTCTCCCAGAAACTGAAGACCACTTACAAGGCTTCCACCAGCAAG
ATTGTCTCCAGCTTTAAGACCACGACATCGAGAGCTGCCTGCCAGCTCGTGAAGGAGTACATCGGCCACCGGGACGGCATCTGGGATGTC
AGCGTGGCCAAGACACAGCCAGTGGTGCTCGGGACTGCATCAGCCGATCACACGGCTTTGCTGTGGAGCATAGAGACAGGGAAGTGCCTA
GTCAAGTACGCAGGCCACGTGGGCTCAGTAAATTCTATCAAATTTCATCCCTCAGAGCAGTTGGCTCTCACTGCTTCTGGAGATCAGACT
GCTCATATCTGGAGATACGCGGTGCAGCTGCCGACACCCCAGCCTGTTGCTGACACTAGTGAAGAAGAATTTCGAGAAGAACCTAAATGC
CTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCATAAGGACTCATATCTCATTACAAGAAGCATCATGGCC
GAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTGATCAATCCTGTAAAAACCTCCCGGAACCATCAAGAT
CTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGA
GACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAG
CAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAGTTTGTGAAGGTGAAAGGCAATCTCAGGAGAACAGGC
CAAGAAGTCGCCCAAGCCCAGGAGTCCTAGGCTGAGGCTGCACCAAGACCTCGTGTGTCACCCCACAGAGCTGTCTGTGGGTGCCTTCTC
AATCTCAGGGCAAAAGCCCCTGGAGAATATTTCAGCCAGCAGAGAATTTTGACTTGCAGTAGGATTTGGTTTGATTTTCCTACGATCTGG
GTGGATGCCTTGCCTGTGACAGTTGCAGTTCCTATTCGCCAAATGAAGGGCAGTGCCCCGCACGTAAGTTGGAATGATGGACCTGTGTTC
AGAGACTTAACAGAACCAACAAGCAAAACAAGTGAGAACAGGAAAAAGGAAGAGGACACTGGAATCAATTCTTGAGAGTTGCACTACTTG
GTTTTTCTTCCATTCCAAGTTTCGTGGGACCCAGAGCCTTTTTTCTTTTAAAAGCTAAAAAACAAGTGTTTAATTCCTCTTTTTGTTATC
TGTTAGATAATTGAGATCACCTAGAAATGCGTTTAATCTGTTCACTCACTGTAAATTTTGAGGACCCAGAATTGTCTTGTTTAATTTATA
CTTTCACCCCTGTTGCAGTTAACACCAGAGAAGGAACGTGAATGTCGAGCACAGCCACTACCCTTGTTGGCACTTAATTTAGAAATAGGG
TGAGAAGTTTAAAAGCCCATCTTGATTTTATTTTCATTCCTTTTGGTTCTCTGTGTAATAATAGCAGGCTACATAGTGACATTCCAGTTC
CAAGAAGGTACATCCTGTCCATTCATTAATTGCTTTGATTACTAGGAGGGTTTCTGTTCAGTTTTGTTTTTAAATGTCTTGCTGATCTAG
TTCTTTCAGATGGAATAACCTTCCAGTCCCTTAGAGAGTGGAACTAGTCCATATAACCCAGCTTCAGTAGCAAAAGTAGAAGCCGCCACA
TCTTTTCATTTCTCCAAGAGGAGAGTGGGGAAGGTTCCCATGACCAGCTGGGCAGTCAGGATTTCTCTAGGCATTCTAATGTGAAATAAG
TGTAGACTGCTGTCAAGGAGGCTTCATCAGAAGATGTATAGCATTTGAATGTCTAATGATAATGCATATCATTAGAATCCAAGCTTTGAA
AATTTCTGATTAATGCTCATGTATTTCTTTATCTTTGTTTTTCCTTGTGAAGAAAGACTTTCACCACTGTCTGAGTGATGATGCTGTTGA
TAAGGATGATGTCGATGACTACTATATTGCATCTCTCAGGAACAGCTGATGGGAAGGGAGGGGCTGCTGAGTTCCCTTGTTCTAGCTAGC
AGCACGCTCCTCAGAGAGGGGGCCGAGTTACAGACAGCAGCCGCATTCTCATGCAAAATTAGTTTTAAACTGCTAGTGTGGGCATCGGTA
CCTTTTGCCTGGGTGATACCGAAGAATTGTTGAGGATTTAGTATGCTCCGTAGAGACAGTTCAGCCAGTCATTTCTGCATTGGAGAGACT
TCTCATACTTTCTTTGAAGACTCATAGAAAGCTGGATCTAGAGCTTTTGAATCCTTAATTAGCACAGTAGAAATTAGCTTTCTATGGGAA
TGCTTTAGTGTTAGCAGTTGACAATTAGGCCCATATTCAATCTGAATGGGAACAAAAGTAAATGCAATGATAATATACTGCTAGTTAGAG
AAACATGTTAGTTGATTATACCTGAAATGGATTATTTATCTCATCAGCAAGTATTATTTGAATAAAATGAGAAATGCTTAAGAAAAATTG
TTGCTCTACAGTAATTTGGTTTCGAAGAATGGAATGGTAACTATTTTTTCCCATCGTTCTTTTGAGAGAAGGAAGTGTGATGACTGATGA
TCTTGAAAAGCCCATTTCTGATTGCACGTTGACTGGAATTCTTTCTTTGTGTCTGTGGACTAGCGATGCTGTTTGTAAAATGAAGATTCG
GGACTGGCTCATATCTTTTTATCTAACTAGATGTCAGATCTTGAAATCTGTATTCTCGAAGCAATTCTGCCACTTGATCGTATTCACAGG
GGCCCTGGTAGGCTCCTTTAGAAGGACCATTTCTGTTCCTAGAGCTTAACTAGAATTCATTCTTCACTGAAAAAAAAAAAAGTTACTTAA
GAAAGCATTTCTTTCCTAATCTCACTCAAATCTGCAGAATTATTTGTAATTAGTAATACAAAATCTGGCCAAAAGGAGACTTGTAAATAG
CGTAAAGTGGTGTCTTATGCTAAACGGTGGAATGTATAGGCAGAGAAGCTCTTTGAAGTTGTCAGATGAGCTGGGCTCACAAGCCTGATT
CAAACAGGCTGTCGGTCTCCTCTCACCCCTTAATACTGTGCAGCCCAAACTCCTAGGACTCTTGAACATCTGAGCAGTTTTGTGCTTTGA
GCCACTTTTTGACAAAAATGGCTCCATTTTTCCACAGCGTGGTTTTCTTAAAATAGTTTAATGTTTTATAGTCTCATAGTAGTAGTGTTG
CTTTCTAAGCTATAACAGTCGACTTTATTCTTCTACTCTGAAAAATCTTGACTTGTTTGAGTGTATATAATATATATAAAGGGAGCCTTA
ATGGATTGGTTTTCATAATTTAATATTTTTTGTATTTGCTCTTGTATAATTGTTTTTAACGGAAAGTATTAAAGAATTGAGGGTGGAATT

>In-frame_WDR37_ENST00000263150_chr10_1142186_+_FAM107B_ENST00000181796_chr10_14709690_-_4017nt
GCGGTGTCCTGCGCGTCTTCGGGTCAGTACGGGGGGCCGCGTCGTAGGGACTCACTGGCGGTGCGCGACCTGGGCTGGCTCCGGGGGTGG
CGGGCGCAGCTGCTGTGACAGCTTATTGCAGGAGTGACCAGGACACTACCTCCTAGAAGTAATGCCCACAGAAAGCGCAAGTTGTTCGAC
TGCTCGCCAAACAAAACAGAAGCGCAAATCCCATAGCCTTTCTATACGAAGAACTAACAGCTCGGAGCAGGAGAGGACGGGACTGCCAAG
AGACATGTTAGAAGGACAAGATTCTAAACTGCCTTCCTCGGTTCGCAGTACACTTCTGGAACTGTTTGGTCAAATAGAAAGAGAATTTGA
AAACCTTTATATCGAAAACTTAGAATTACGTAGAGAAATCGACACTCTTAATGAACGTTTAGCTGCTGAAGGACAAGCGATTGATGGAGC
AGAGCTGAGTAAGGGCCAACTCAAAACAAAAGCCAGTCACAGCACCAGCCAGCTCTCCCAGAAACTGAAGACCACTTACAAGGCTTCCAC
CAGCAAGATTGTCTCCAGCTTTAAGACCACGACATCGAGAGCTGCCTGCCAGCTCGTGAAGGAGTACATCGGCCACCGGGACGGCATCTG
GGATGTCAGCGTGGCCAAGACACAGCCAGTGGTGCTCGGGACTGCATCAGCCGATCACACGGCTTTGCTGTGGAGCATAGAGACAGGGAA
GTGCCTAGTCAAGTACGCAGGCCACGTGGGCTCAGTAAATTCTATCAAATTTCATCCCTCAGAGCAGTTGGCTCTCACTGCTTCTGGAGA
TCAGACTGCTCATATCTGGAGATACGCGGTGCAGCTGCCGACACCCCAGCCTGTTGCTGACACTAGTGAAGAAGAATTTCGAGAAGAACC
TAAATGCCTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCATAAGGACTCATATCTCATTACAAGAAGCAT
CATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTGATCAATCCTGTAAAAACCTCCCGGAACCA
TCAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAG
AAAACGAGACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAA
GTTGGAGCAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAGTTTGTGAAGGTGAAAGGCAATCTCAGGAG
AACAGGCCAAGAAGTCGCCCAAGCCCAGGAGTCCTAGGCTGAGGCTGCACCAAGACCTCGTGTGTCACCCCACAGAGCTGTCTGTGGGTG
CCTTCTCAATCTCAGGGCAAAAGCCCCTGGAGAATATTTCAGCCAGCAGAGAATTTTGACTTGCAGTAGGATTTGGTTTGATTTTCCTAC
GATCTGGGTGGATGCCTTGCCTGTGACAGTTGCAGTTCCTATTCGCCAAATGAAGGGCAGTGCCCCGCACGTAAGTTGGAATGATGGACC
TGTGTTCAGAGACTTAACAGAACCAACAAGCAAAACAAGTGAGAACAGGAAAAAGGAAGAGGACACTGGAATCAATTCTTGAGAGTTGCA
CTACTTGGTTTTTCTTCCATTCCAAGTTTCGTGGGACCCAGAGCCTTTTTTCTTTTAAAAGCTAAAAAACAAGTGTTTAATTCCTCTTTT
TGTTATCTGTTAGATAATTGAGATCACCTAGAAATGCGTTTAATCTGTTCACTCACTGTAAATTTTGAGGACCCAGAATTGTCTTGTTTA
ATTTATACTTTCACCCCTGTTGCAGTTAACACCAGAGAAGGAACGTGAATGTCGAGCACAGCCACTACCCTTGTTGGCACTTAATTTAGA
AATAGGGTGAGAAGTTTAAAAGCCCATCTTGATTTTATTTTCATTCCTTTTGGTTCTCTGTGTAATAATAGCAGGCTACATAGTGACATT
CCAGTTCCAAGAAGGTACATCCTGTCCATTCATTAATTGCTTTGATTACTAGGAGGGTTTCTGTTCAGTTTTGTTTTTAAATGTCTTGCT
GATCTAGTTCTTTCAGATGGAATAACCTTCCAGTCCCTTAGAGAGTGGAACTAGTCCATATAACCCAGCTTCAGTAGCAAAAGTAGAAGC
CGCCACATCTTTTCATTTCTCCAAGAGGAGAGTGGGGAAGGTTCCCATGACCAGCTGGGCAGTCAGGATTTCTCTAGGCATTCTAATGTG
AAATAAGTGTAGACTGCTGTCAAGGAGGCTTCATCAGAAGATGTATAGCATTTGAATGTCTAATGATAATGCATATCATTAGAATCCAAG
CTTTGAAAATTTCTGATTAATGCTCATGTATTTCTTTATCTTTGTTTTTCCTTGTGAAGAAAGACTTTCACCACTGTCTGAGTGATGATG
CTGTTGATAAGGATGATGTCGATGACTACTATATTGCATCTCTCAGGAACAGCTGATGGGAAGGGAGGGGCTGCTGAGTTCCCTTGTTCT
AGCTAGCAGCACGCTCCTCAGAGAGGGGGCCGAGTTACAGACAGCAGCCGCATTCTCATGCAAAATTAGTTTTAAACTGCTAGTGTGGGC
ATCGGTACCTTTTGCCTGGGTGATACCGAAGAATTGTTGAGGATTTAGTATGCTCCGTAGAGACAGTTCAGCCAGTCATTTCTGCATTGG
AGAGACTTCTCATACTTTCTTTGAAGACTCATAGAAAGCTGGATCTAGAGCTTTTGAATCCTTAATTAGCACAGTAGAAATTAGCTTTCT
ATGGGAATGCTTTAGTGTTAGCAGTTGACAATTAGGCCCATATTCAATCTGAATGGGAACAAAAGTAAATGCAATGATAATATACTGCTA
GTTAGAGAAACATGTTAGTTGATTATACCTGAAATGGATTATTTATCTCATCAGCAAGTATTATTTGAATAAAATGAGAAATGCTTAAGA
AAAATTGTTGCTCTACAGTAATTTGGTTTCGAAGAATGGAATGGTAACTATTTTTTCCCATCGTTCTTTTGAGAGAAGGAAGTGTGATGA
CTGATGATCTTGAAAAGCCCATTTCTGATTGCACGTTGACTGGAATTCTTTCTTTGTGTCTGTGGACTAGCGATGCTGTTTGTAAAATGA
AGATTCGGGACTGGCTCATATCTTTTTATCTAACTAGATGTCAGATCTTGAAATCTGTATTCTCGAAGCAATTCTGCCACTTGATCGTAT
TCACAGGGGCCCTGGTAGGCTCCTTTAGAAGGACCATTTCTGTTCCTAGAGCTTAACTAGAATTCATTCTTCACTGAAAAAAAAAAAAGT
TACTTAAGAAAGCATTTCTTTCCTAATCTCACTCAAATCTGCAGAATTATTTGTAATTAGTAATACAAAATCTGGCCAAAAGGAGACTTG
TAAATAGCGTAAAGTGGTGTCTTATGCTAAACGGTGGAATGTATAGGCAGAGAAGCTCTTTGAAGTTGTCAGATGAGCTGGGCTCACAAG
CCTGATTCAAACAGGCTGTCGGTCTCCTCTCACCCCTTAATACTGTGCAGCCCAAACTCCTAGGACTCTTGAACATCTGAGCAGTTTTGT
GCTTTGAGCCACTTTTTGACAAAAATGGCTCCATTTTTCCACAGCGTGGTTTTCTTAAAATAGTTTAATGTTTTATAGTCTCATAGTAGT
AGTGTTGCTTTCTAAGCTATAACAGTCGACTTTATTCTTCTACTCTGAAAAATCTTGACTTGTTTGAGTGTATATAATATATATAAAGGG
AGCCTTAATGGATTGGTTTTCATAATTTAATATTTTTTGTATTTGCTCTTGTATAATTGTTTTTAACGGAAAGTATTAAAGAATTGAGGG


Top

FusionGenePPI for WDR37_FAM107B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WDR37EWSR1, MOV10, NXF1, CCT3, CCT7, HSPA8, CCT6B, CCT6A, CLUH, TCP1, PACS2, PACS1, SETD2, CCDC101, LRRC46, KRAS, RBM14-RBM4, IQCF1, CCT4, CCT2, TRIM25FAM107BELAVL1, BAG3, U2AF2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WDR37_FAM107B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WDR37_FAM107B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource