FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41669

FusionGeneSummary for VSIG1_MID2

check button Fusion gene summary
Fusion gene informationFusion gene name: VSIG1_MID2
Fusion gene ID: 41669
HgeneTgene
Gene symbol

VSIG1

MID2

Gene ID

340547

11043

Gene nameV-set and immunoglobulin domain containing 1midline 2
Synonyms1700062D20Rik|GPA34|dJ889N15.1FXY2|MRX101|RNF60|TRIM1
Cytomap

Xq22.3

Xq22.3

Type of geneprotein-codingprotein-coding
DescriptionV-set and immunoglobulin domain-containing protein 1cell surface A33 antigenglycoprotein A34probable E3 ubiquitin-protein ligase MID2RING finger protein 60RING-type E3 ubiquitin transferase MID2midin 2midline defect 2tripartite motif protein 1tripartite motif-containing protein 1
Modification date2018052320180519
UniProtAcc

Q86XK7

Q9UJV3

Ensembl transtripts involved in fusion geneENST00000415430, ENST00000217957, 
ENST00000485533, 
ENST00000262843, 
ENST00000443968, 
Fusion gene scores* DoF score2 X 3 X 4=243 X 4 X 5=60
# samples 75
** MAII scorelog2(7/24*10)=1.54432051622381
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VSIG1 [Title/Abstract] AND MID2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMID2

GO:0032897

negative regulation of viral transcription

18248090

TgeneMID2

GO:0043123

positive regulation of I-kappaB kinase/NF-kappaB signaling

23077300

TgeneMID2

GO:0045087

innate immune response

18248090

TgeneMID2

GO:0046597

negative regulation of viral entry into host cell

18248090

TgeneMID2

GO:1902187

negative regulation of viral release from host cell

18248090


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPAADTCGA-US-A77G-01AVSIG1chrX

107288409

+MID2chrX

107169324

+
TCGARVPRADTCGA-KK-A7B1-01AVSIG1chrX

107288409

+MID2chrX

107169324

+
TCGARVSTADTCGA-VQ-A91K-01AVSIG1chrX

107301431

+MID2chrX

107159232

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000415430ENST00000262843VSIG1chrX

107288409

+MID2chrX

107169324

+
In-frameENST00000415430ENST00000443968VSIG1chrX

107288409

+MID2chrX

107169324

+
In-frameENST00000217957ENST00000262843VSIG1chrX

107288409

+MID2chrX

107169324

+
In-frameENST00000217957ENST00000443968VSIG1chrX

107288409

+MID2chrX

107169324

+
intron-3CDSENST00000485533ENST00000262843VSIG1chrX

107288409

+MID2chrX

107169324

+
intron-3CDSENST00000485533ENST00000443968VSIG1chrX

107288409

+MID2chrX

107169324

+
Frame-shiftENST00000415430ENST00000262843VSIG1chrX

107301431

+MID2chrX

107159232

+
Frame-shiftENST00000415430ENST00000443968VSIG1chrX

107301431

+MID2chrX

107159232

+
Frame-shiftENST00000217957ENST00000262843VSIG1chrX

107301431

+MID2chrX

107159232

+
Frame-shiftENST00000217957ENST00000443968VSIG1chrX

107301431

+MID2chrX

107159232

+
intron-3CDSENST00000485533ENST00000262843VSIG1chrX

107301431

+MID2chrX

107159232

+
intron-3CDSENST00000485533ENST00000443968VSIG1chrX

107301431

+MID2chrX

107159232

+

Top

FusionProtFeatures for VSIG1_MID2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VSIG1

Q86XK7

MID2

Q9UJV3

May play a role in microtubule stabilization.{ECO:0000303|PubMed:24115387}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMID2chrX:107288409chrX:107169324ENST00000443968+710516_709502706DomainB30.2/SPRY

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVSIG1chrX:107288409chrX:107169324ENST00000217957+17140_22716388DomainNote=Ig-like C2-type
HgeneVSIG1chrX:107288409chrX:107169324ENST00000217957+1722_13216388DomainNote=Ig-like V-type
HgeneVSIG1chrX:107288409chrX:107169324ENST00000415430+18140_22716424DomainNote=Ig-like C2-type
HgeneVSIG1chrX:107288409chrX:107169324ENST00000415430+1822_13216424DomainNote=Ig-like V-type
HgeneVSIG1chrX:107288409chrX:107169324ENST00000217957+1722_23216388Topological domainExtracellular
HgeneVSIG1chrX:107288409chrX:107169324ENST00000217957+17254_38716388Topological domainCytoplasmic
HgeneVSIG1chrX:107288409chrX:107169324ENST00000415430+1822_23216424Topological domainExtracellular
HgeneVSIG1chrX:107288409chrX:107169324ENST00000415430+18254_38716424Topological domainCytoplasmic
HgeneVSIG1chrX:107288409chrX:107169324ENST00000217957+17233_25316388TransmembraneHelical
HgeneVSIG1chrX:107288409chrX:107169324ENST00000415430+18233_25316424TransmembraneHelical
TgeneMID2chrX:107288409chrX:107169324ENST00000262843+710233_301532736Coiled coilOntology_term=ECO:0000255
TgeneMID2chrX:107288409chrX:107169324ENST00000443968+710233_301502706Coiled coilOntology_term=ECO:0000255
TgeneMID2chrX:107288409chrX:107169324ENST00000262843+710340_399532736DomainCOS
TgeneMID2chrX:107288409chrX:107169324ENST00000262843+710398_531532736DomainNote=Fibronectin type-III
TgeneMID2chrX:107288409chrX:107169324ENST00000262843+710516_709532736DomainB30.2/SPRY
TgeneMID2chrX:107288409chrX:107169324ENST00000443968+710340_399502706DomainCOS
TgeneMID2chrX:107288409chrX:107169324ENST00000443968+710398_531502706DomainNote=Fibronectin type-III
TgeneMID2chrX:107288409chrX:107169324ENST00000262843+710137_184532736Zinc fingerB box-type 1%3B degenerate
TgeneMID2chrX:107288409chrX:107169324ENST00000262843+710190_232532736Zinc fingerB box-type 2
TgeneMID2chrX:107288409chrX:107169324ENST00000262843+71030_80532736Zinc fingerRING-type
TgeneMID2chrX:107288409chrX:107169324ENST00000443968+710137_184502706Zinc fingerB box-type 1%3B degenerate
TgeneMID2chrX:107288409chrX:107169324ENST00000443968+710190_232502706Zinc fingerB box-type 2
TgeneMID2chrX:107288409chrX:107169324ENST00000443968+71030_80502706Zinc fingerRING-type


Top

FusionGeneSequence for VSIG1_MID2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VSIG1_ENST00000415430_chrX_107288409_+_MID2_ENST00000262843_chrX_107169324_+_220aa
MVFAFWKVFLILSCLAGQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIG
IAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNK

>In-frame_VSIG1_ENST00000415430_chrX_107288409_+_MID2_ENST00000443968_chrX_107169324_+_220aa
MVFAFWKVFLILSCLAGQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIG
IAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNK

>In-frame_VSIG1_ENST00000217957_chrX_107288409_+_MID2_ENST00000262843_chrX_107169324_+_220aa
MVFAFWKVFLILSCLAGQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIG
IAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNK

>In-frame_VSIG1_ENST00000217957_chrX_107288409_+_MID2_ENST00000443968_chrX_107169324_+_220aa
MVFAFWKVFLILSCLAGQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIG
IAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VSIG1_ENST00000415430_chrX_107288409_+_MID2_ENST00000262843_chrX_107169324_+_660nt
ATGGTGTTCGCATTTTGGAAGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAATTGGATCCCAAAATGACTCACAAGAAG
TTGAAGATCTCCAATGATGGATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCACACCCCAGAGAGGTTTAGTGGCACAGGG
TGCTATGGGGCAGCAGGAAATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATGGGTTCCTCAACATGGTATGCAATTGGC
ATTGCCTACAAATCAGCTCCAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTCTCTCGCTGCAATAGTAACTTCGTGGTG
AGACACAACAACAAGGAAATGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTCCTGGATTATGACAACAATATGCTGTCT
TTCTATGACCCAGCTAACTCTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTTTGTCCAACATTTACAATCTGGAACAAA
TCCCTAATGATCCTGTCTGGCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAATGCAACTGCAGGCCTCAAGAATCCCCT

>In-frame_VSIG1_ENST00000415430_chrX_107288409_+_MID2_ENST00000443968_chrX_107169324_+_660nt
ATGGTGTTCGCATTTTGGAAGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAATTGGATCCCAAAATGACTCACAAGAAG
TTGAAGATCTCCAATGATGGATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCACACCCCAGAGAGGTTTAGTGGCACAGGG
TGCTATGGGGCAGCAGGAAATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATGGGTTCCTCAACATGGTATGCAATTGGC
ATTGCCTACAAATCAGCTCCAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTCTCTCGCTGCAATAGTAACTTCGTGGTG
AGACACAACAACAAGGAAATGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTCCTGGATTATGACAACAATATGCTGTCT
TTCTATGACCCAGCTAACTCTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTTTGTCCAACATTTACAATCTGGAACAAA
TCCCTAATGATCCTGTCTGGCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAATGCAACTGCAGGCCTCAAGAATCCCCT

>In-frame_VSIG1_ENST00000217957_chrX_107288409_+_MID2_ENST00000262843_chrX_107169324_+_660nt
ATGGTGTTCGCATTTTGGAAGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAATTGGATCCCAAAATGACTCACAAGAAG
TTGAAGATCTCCAATGATGGATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCACACCCCAGAGAGGTTTAGTGGCACAGGG
TGCTATGGGGCAGCAGGAAATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATGGGTTCCTCAACATGGTATGCAATTGGC
ATTGCCTACAAATCAGCTCCAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTCTCTCGCTGCAATAGTAACTTCGTGGTG
AGACACAACAACAAGGAAATGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTCCTGGATTATGACAACAATATGCTGTCT
TTCTATGACCCAGCTAACTCTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTTTGTCCAACATTTACAATCTGGAACAAA
TCCCTAATGATCCTGTCTGGCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAATGCAACTGCAGGCCTCAAGAATCCCCT

>In-frame_VSIG1_ENST00000217957_chrX_107288409_+_MID2_ENST00000443968_chrX_107169324_+_660nt
ATGGTGTTCGCATTTTGGAAGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAATTGGATCCCAAAATGACTCACAAGAAG
TTGAAGATCTCCAATGATGGATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCACACCCCAGAGAGGTTTAGTGGCACAGGG
TGCTATGGGGCAGCAGGAAATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATGGGTTCCTCAACATGGTATGCAATTGGC
ATTGCCTACAAATCAGCTCCAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTCTCTCGCTGCAATAGTAACTTCGTGGTG
AGACACAACAACAAGGAAATGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTCCTGGATTATGACAACAATATGCTGTCT
TTCTATGACCCAGCTAACTCTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTTTGTCCAACATTTACAATCTGGAACAAA
TCCCTAATGATCCTGTCTGGCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAATGCAACTGCAGGCCTCAAGAATCCCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_VSIG1_ENST00000415430_chrX_107288409_+_MID2_ENST00000262843_chrX_107169324_+_941nt
AAAGTCTATACGCAATAAGTAAGCCCAAAGAGGCATGTTTGCTTGGCGATGCCCAGCAGATAAGCCAGGCAAACCTCGGTGTGATCGAAG
AAGCCAATTTGAGACTCAGCCTAGTCCAGGCAAGCTACTGGCACCTGCTGCTCTCAACTAACCTCCACACAATGGTGTTCGCATTTTGGA
AGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAATTGGATCCCAAAATGACTCACAAGAAGTTGAAGATCTCCAATGATG
GATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCACACCCCAGAGAGGTTTAGTGGCACAGGGTGCTATGGGGCAGCAGGAA
ATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATGGGTTCCTCAACATGGTATGCAATTGGCATTGCCTACAAATCAGCTC
CAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTCTCTCGCTGCAATAGTAACTTCGTGGTGAGACACAACAACAAGGAAA
TGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTCCTGGATTATGACAACAATATGCTGTCTTTCTATGACCCAGCTAACT
CTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTTTGTCCAACATTTACAATCTGGAACAAATCCCTAATGATCCTGTCTG
GCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAATGCAACTGCAGGCCTCAAGAATCCCCTTATGTTTCTGGGATGAAAA
CCTGTCATTAAGTTTCAGGAGAGTATATAATTCACTGGCTCTCTAGTTCAGCAGTTCTTCCCCTCCTACACCTAAGTTAGCGTTCAATAT

>In-frame_VSIG1_ENST00000415430_chrX_107288409_+_MID2_ENST00000443968_chrX_107169324_+_941nt
AAAGTCTATACGCAATAAGTAAGCCCAAAGAGGCATGTTTGCTTGGCGATGCCCAGCAGATAAGCCAGGCAAACCTCGGTGTGATCGAAG
AAGCCAATTTGAGACTCAGCCTAGTCCAGGCAAGCTACTGGCACCTGCTGCTCTCAACTAACCTCCACACAATGGTGTTCGCATTTTGGA
AGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAATTGGATCCCAAAATGACTCACAAGAAGTTGAAGATCTCCAATGATG
GATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCACACCCCAGAGAGGTTTAGTGGCACAGGGTGCTATGGGGCAGCAGGAA
ATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATGGGTTCCTCAACATGGTATGCAATTGGCATTGCCTACAAATCAGCTC
CAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTCTCTCGCTGCAATAGTAACTTCGTGGTGAGACACAACAACAAGGAAA
TGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTCCTGGATTATGACAACAATATGCTGTCTTTCTATGACCCAGCTAACT
CTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTTTGTCCAACATTTACAATCTGGAACAAATCCCTAATGATCCTGTCTG
GCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAATGCAACTGCAGGCCTCAAGAATCCCCTTATGTTTCTGGGATGAAAA
CCTGTCATTAAGTTTCAGGAGAGTATATAATTCACTGGCTCTCTAGTTCAGCAGTTCTTCCCCTCCTACACCTAAGTTAGCGTTCAATAT

>In-frame_VSIG1_ENST00000217957_chrX_107288409_+_MID2_ENST00000262843_chrX_107169324_+_897nt
GGCGATGCCCAGCAGATAAGCCAGGCAAACCTCGGTGTGATCGAAGAAGCCAATTTGAGACTCAGCCTAGTCCAGGCAAGCTACTGGCAC
CTGCTGCTCTCAACTAACCTCCACACAATGGTGTTCGCATTTTGGAAGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAA
TTGGATCCCAAAATGACTCACAAGAAGTTGAAGATCTCCAATGATGGATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCAC
ACCCCAGAGAGGTTTAGTGGCACAGGGTGCTATGGGGCAGCAGGAAATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATG
GGTTCCTCAACATGGTATGCAATTGGCATTGCCTACAAATCAGCTCCAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTC
TCTCGCTGCAATAGTAACTTCGTGGTGAGACACAACAACAAGGAAATGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTC
CTGGATTATGACAACAATATGCTGTCTTTCTATGACCCAGCTAACTCTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTT
TGTCCAACATTTACAATCTGGAACAAATCCCTAATGATCCTGTCTGGCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAA
TGCAACTGCAGGCCTCAAGAATCCCCTTATGTTTCTGGGATGAAAACCTGTCATTAAGTTTCAGGAGAGTATATAATTCACTGGCTCTCT

>In-frame_VSIG1_ENST00000217957_chrX_107288409_+_MID2_ENST00000443968_chrX_107169324_+_897nt
GGCGATGCCCAGCAGATAAGCCAGGCAAACCTCGGTGTGATCGAAGAAGCCAATTTGAGACTCAGCCTAGTCCAGGCAAGCTACTGGCAC
CTGCTGCTCTCAACTAACCTCCACACAATGGTGTTCGCATTTTGGAAGGTCTTTCTGATCCTAAGCTGCCTTGCAGGCCAACCCTTTAAA
TTGGATCCCAAAATGACTCACAAGAAGTTGAAGATCTCCAATGATGGATTGCAGATGGAGAAGGATGAAAGCTCTCTAAAGAAGAGCCAC
ACCCCAGAGAGGTTTAGTGGCACAGGGTGCTATGGGGCAGCAGGAAATATATTCATTGACAGTGGCTGCCACTATTGGGAGGTGGTCATG
GGTTCCTCAACATGGTATGCAATTGGCATTGCCTACAAATCAGCTCCAAAGAATGAATGGATTGGCAAGAATGCCTCCTCATGGGTCTTC
TCTCGCTGCAATAGTAACTTCGTGGTGAGACACAACAACAAGGAAATGCTGGTGGATGTGCCCCCACACCTGAAGCGTCTGGGTGTCCTC
CTGGATTATGACAACAATATGCTGTCTTTCTATGACCCAGCTAACTCTCTCCATCTTCATACTTTTGATGTGACCTTCATTCTTCCAGTT
TGTCCAACATTTACAATCTGGAACAAATCCCTAATGATCCTGTCTGGCTTGCCTGCCCCAGATTTTATTGATTACCCTGAGCGGCAGGAA
TGCAACTGCAGGCCTCAAGAATCCCCTTATGTTTCTGGGATGAAAACCTGTCATTAAGTTTCAGGAGAGTATATAATTCACTGGCTCTCT


Top

FusionGenePPI for VSIG1_MID2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VSIG1UBE4A, CDS1, ATP2A3, IP6K1, RRP1, SLC25A17, DEPDC1, CYP20A1, EXOG, TTI1, FANCL, TMEM160, DAGLB, NF1, C4A, INTS7, TIMELESS, XPR1, INTS4, HUS1, GHITM, RANBP6, RTN4, NLRX1, INTS2, GPN3, MFN2, RUFY1, KIDINS220, PPP2R5E, ATR, COG4, ABCB8, COG5, SLC35F2, TBCD, AP3S1, GLMN, ALG10, MDN1, COQ5, TUBA4A, TUBGCP4, TARBP1, TNPO3, XPO7, SFXN5, GK, TUBB3, SLC22A18, URB2, UTP20, TNPO2, COG6MID2DYDC1, MID2, MID1, TRIM29, TRIM32, IGBP1, UBE2D4, UBE2N, UBE2U, UBE2D1, UBE2D2, UBE2D3, UBE2E1, UBE2E2, UBE2E3, GFI1B, DGCR6, KIF1A, MVP, SLC25A6, AQP1, BYSL, RUNX1T1, CHD2, CTSZ, DCX, GOLGA2, HOXB9, KIFC3, LGALS8, MFAP1, MOS, PSMA1, TRIM27, SDCBP, SNAI1, TCEA2, TCEB3, ZNF24, ZNF165, STX11, TOP3B, RPH3AL, ZSCAN12, ZBTB24, JOSD1, NR1D2, CALCOCO2, SPRY2, NXF1, FARS2, FAM107A, ISCU, GORASP2, PRPF31, DIEXF, SPG21, WT1-AS, SYT17, ADAMTSL4, CCHCR1, MAGOHB, FAM90A1, C19orf66, TRPV6, RCOR3, UNC45A, FAM214A, LGALS14, TRIM54, CBX8, ZNF250, DMRT3, MID1IP1, GMCL1, METTL17, AEN, OTUB2, SCNM1, ZFYVE21, LENG1, ZC2HC1C, PTCD2, UBTD1, FBXL18, TSGA10, KIAA1683, THAP7, ATRIP, FAM161A, UTP23, BRMS1L, ZGPAT, ZNF587, FBF1, DGCR6L, CCDC120, SNAP47, FRMD6, ZNF440, ZNF792, RPP25L, ZNF785, CCDC42, ZNF417, SLC25A48, ZNF564, PPP1R18, SPATA24, BCL6B, CEP57L1, TRIM42, BRCA1, UBXN1, EPN3, COX5B, ZNF774, TMEM14B, FAM115A, HIF1A, CDKN2AIP, SPAG5, TUBB, TUBA1B, TUBB4B, CEP128, ASPM, PSMD3, PSMC2, PSMD11, PSMD2, PSMB5, GMNN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VSIG1_MID2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VSIG1_MID2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMID2C3890168MENTAL RETARDATION, X-LINKED 1011UNIPROT