FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41591

FusionGeneSummary for VPS37B_MPHOSPH9

check button Fusion gene summary
Fusion gene informationFusion gene name: VPS37B_MPHOSPH9
Fusion gene ID: 41591
HgeneTgene
Gene symbol

VPS37B

MPHOSPH9

Gene ID

79720

10198

Gene nameVPS37B, ESCRT-I subunitM-phase phosphoprotein 9
Synonyms-MPP-9|MPP9
Cytomap

12q24.31

12q24.31

Type of geneprotein-codingprotein-coding
Descriptionvacuolar protein sorting-associated protein 37BESCRT-I complex subunit VPS37BhVps37Bvacuolar protein sorting 37 homolog Bvacuolar protein sorting 37BM-phase phosphoprotein 9
Modification date2018052220180519
UniProtAcc

Q9H9H4

Q99550

Ensembl transtripts involved in fusion geneENST00000267202, ENST00000302349, 
ENST00000541076, ENST00000606320, 
ENST00000392425, ENST00000539639, 
Fusion gene scores* DoF score7 X 2 X 6=844 X 4 X 4=64
# samples 74
** MAII scorelog2(7/84*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VPS37B [Title/Abstract] AND MPHOSPH9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-24-2026-01AVPS37Bchr12

123380499

-MPHOSPH9chr12

123665757

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000267202ENST00000302349VPS37Bchr12

123380499

-MPHOSPH9chr12

123665757

-
In-frameENST00000267202ENST00000541076VPS37Bchr12

123380499

-MPHOSPH9chr12

123665757

-
In-frameENST00000267202ENST00000606320VPS37Bchr12

123380499

-MPHOSPH9chr12

123665757

-
In-frameENST00000267202ENST00000392425VPS37Bchr12

123380499

-MPHOSPH9chr12

123665757

-
5CDS-intronENST00000267202ENST00000539639VPS37Bchr12

123380499

-MPHOSPH9chr12

123665757

-

Top

FusionProtFeatures for VPS37B_MPHOSPH9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VPS37B

Q9H9H4

MPHOSPH9

Q99550

Component of the ESCRT-I complex, a regulator ofvesicular trafficking process. Required for the sorting ofendocytic ubiquitinated cargos into multivesicular bodies. May beinvolved in cell growth and differentiation.{ECO:0000269|PubMed:15218037}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMPHOSPH9chr12:123380499chr12:123665757ENST00000302349-8201109_11745951029Coiled coilOntology_term=ECO:0000255
TgeneMPHOSPH9chr12:123380499chr12:123665757ENST00000302349-820609_8045951029Coiled coilOntology_term=ECO:0000255
TgeneMPHOSPH9chr12:123380499chr12:123665757ENST00000392425-8201109_11745951032Coiled coilOntology_term=ECO:0000255
TgeneMPHOSPH9chr12:123380499chr12:123665757ENST00000392425-820609_8045951032Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVPS37Bchr12:123380499chr12:123665757ENST00000267202-14170_28037286Compositional biasNote=Pro-rich
HgeneVPS37Bchr12:123380499chr12:123665757ENST00000267202-1484_17337286DomainVPS37 C-terminal


Top

FusionGeneSequence for VPS37B_MPHOSPH9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000302349_chr12_123665757_-_471aa
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEELLGEYESLGKEHRRVKDALNTTENKLLDAYTQISDLKRMISKLEAQVKQVEHE
NMLSLRHNSRIHVRPSRANTLATSDVSRRKWLIPGAEYSIFTGQPLDTQDSNVDNQLEETCSLGHRSPLEKDSSPGSSSTSLLIKKQRET
SDTPIMRALKELDEGKIFKNWGTQTEKEDTSNINPRQTETSVNASRSPEKCAQQRQKRLNSASQRSSSLPPSNRKSSTPTKREIMLTPVT
VAYSPKRSPKENLSPGFSHLLSKNESSPIRFDILLDDLDTVPVSTLQRTNPRKQLQFLPLDDSEEKTYSEKATDNHVNHSSCPEPVPNGV
KKVSVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQTPQICEESSH

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000541076_chr12_123665757_-_474aa
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEELLGEYESLGKEHRRVKDALNTTENKLLDAYTQISDLKRMISKLEAQVKQVEHE
NMLSLRHNSRIHVRPSRANTLATSDVSRRKWLIPGAEYSIFTGQPLDTQDSNVDNQLEETCSLGHRSPLEKDSSPGSSSTSLLIKKQRET
SDTPIMRALKELDEGKIFKNWGTQTEKEDTSNINPRQTETSVNASRSPEKCAQQRQKRLNSASQRSSSLPPSNRKSSTPTKREIMLTPVT
VAYSPKRSPKENLSPGFSHLLSKNESSPIRFDILLDDLDTVPVSTLQRTNPRKQLQFLPLDDSEEKTYSEKATDNHVNHSSCPEPVPNGV
KKVSVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERI

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000606320_chr12_123665757_-_474aa
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEELLGEYESLGKEHRRVKDALNTTENKLLDAYTQISDLKRMISKLEAQVKQVEHE
NMLSLRHNSRIHVRPSRANTLATSDVSRRKWLIPGAEYSIFTGQPLDTQDSNVDNQLEETCSLGHRSPLEKDSSPGSSSTSLLIKKQRET
SDTPIMRALKELDEGKIFKNWGTQTEKEDTSNINPRQTETSVNASRSPEKCAQQRQKRLNSASQRSSSLPPSNRKSSTPTKREIMLTPVT
VAYSPKRSPKENLSPGFSHLLSKNESSPIRFDILLDDLDTVPVSTLQRTNPRKQLQFLPLDDSEEKTYSEKATDNHVNHSSCPEPVPNGV
KKVSVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERI

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000392425_chr12_123665757_-_474aa
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEELLGEYESLGKEHRRVKDALNTTENKLLDAYTQISDLKRMISKLEAQVKQVEHE
NMLSLRHNSRIHVRPSRANTLATSDVSRRKWLIPGAEYSIFTGQPLDTQDSNVDNQLEETCSLGHRSPLEKDSSPGSSSTSLLIKKQRET
SDTPIMRALKELDEGKIFKNWGTQTEKEDTSNINPRQTETSVNASRSPEKCAQQRQKRLNSASQRSSSLPPSNRKSSTPTKREIMLTPVT
VAYSPKRSPKENLSPGFSHLLSKNESSPIRFDILLDDLDTVPVSTLQRTNPRKQLQFLPLDDSEEKTYSEKATDNHVNHSSCPEPVPNGV
KKVSVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000302349_chr12_123665757_-_1413nt
ATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGAGGACGAGGGCCAGCTGACGGAG
ATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAAGGATGCATTAAATACAACTGAG
AACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCAGGTCAAGCAAGTAGAACATGAA
AATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAACTTCAGACGTCAGCAGGCGGAAA
TGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGTGGATAACCAGCTGGAGGAAACC
TGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTTGATAAAAAAGCAAAGAGAGACT
TCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGACACAGACAGAGAAAGAGGACACC
TCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCAACAGAGACAAAAGAGACTTAAT
TCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGAGATTATGCTAACACCAGTGACT
GTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAAAAATGAGAGCAGTCCAATTCGA
TTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAAGCAACTCCAGTTTCTTCCTCTA
GATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCCTGAACCGGTGCCAAATGGAGTG
AAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGTTTCAGTCACTCCACAGGGGAAT
GATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAAAGAAAAGGACCAGATTGAGGCA
GCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGACCCCTCAGATATGTGAGGAATCAAGCCAT

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000541076_chr12_123665757_-_1422nt
ATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGAGGACGAGGGCCAGCTGACGGAG
ATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAAGGATGCATTAAATACAACTGAG
AACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCAGGTCAAGCAAGTAGAACATGAA
AATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAACTTCAGACGTCAGCAGGCGGAAA
TGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGTGGATAACCAGCTGGAGGAAACC
TGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTTGATAAAAAAGCAAAGAGAGACT
TCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGACACAGACAGAGAAAGAGGACACC
TCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCAACAGAGACAAAAGAGACTTAAT
TCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGAGATTATGCTAACACCAGTGACT
GTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAAAAATGAGAGCAGTCCAATTCGA
TTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAAGCAACTCCAGTTTCTTCCTCTA
GATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCCTGAACCGGTGCCAAATGGAGTG
AAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGTTTCAGTCACTCCACAGGGGAAT
GATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAAAGAAAAGGACCAGATTGAGGCA
GCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGGAAGCCTTGGAAGATCGTTTGGAAAGGATT

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000606320_chr12_123665757_-_1422nt
ATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGAGGACGAGGGCCAGCTGACGGAG
ATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAAGGATGCATTAAATACAACTGAG
AACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCAGGTCAAGCAAGTAGAACATGAA
AATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAACTTCAGACGTCAGCAGGCGGAAA
TGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGTGGATAACCAGCTGGAGGAAACC
TGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTTGATAAAAAAGCAAAGAGAGACT
TCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGACACAGACAGAGAAAGAGGACACC
TCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCAACAGAGACAAAAGAGACTTAAT
TCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGAGATTATGCTAACACCAGTGACT
GTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAAAAATGAGAGCAGTCCAATTCGA
TTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAAGCAACTCCAGTTTCTTCCTCTA
GATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCCTGAACCGGTGCCAAATGGAGTG
AAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGTTTCAGTCACTCCACAGGGGAAT
GATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAAAGAAAAGGACCAGATTGAGGCA
GCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGGAAGCCTTGGAAGATCGTTTGGAAAGGATT

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000392425_chr12_123665757_-_1422nt
ATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGAGGACGAGGGCCAGCTGACGGAG
ATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAAGGATGCATTAAATACAACTGAG
AACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCAGGTCAAGCAAGTAGAACATGAA
AATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAACTTCAGACGTCAGCAGGCGGAAA
TGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGTGGATAACCAGCTGGAGGAAACC
TGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTTGATAAAAAAGCAAAGAGAGACT
TCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGACACAGACAGAGAAAGAGGACACC
TCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCAACAGAGACAAAAGAGACTTAAT
TCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGAGATTATGCTAACACCAGTGACT
GTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAAAAATGAGAGCAGTCCAATTCGA
TTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAAGCAACTCCAGTTTCTTCCTCTA
GATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCCTGAACCGGTGCCAAATGGAGTG
AAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGTTTCAGTCACTCCACAGGGGAAT
GATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAAAGAAAAGGACCAGATTGAGGCA
GCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGGAAGCCTTGGAAGATCGTTTGGAAAGGATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000302349_chr12_123665757_-_1795nt
GGGCTCACAGGCTGCGGGAACTTCCTTCCCACTGCCTGTTTTCCTTGGATCGCGGTATCTCTCTTCCTGGAGGAAAAAGGCTCTTATGAC
CTCATGGCGCGCTCTCCCGAGCCGCAGTGACGTCATTAATGCGCTCACGCGTCACAGCCCAATCATAGGGCCCTTCCCCTCCCTTTAGAA
GTCCCGACTGTCCCTGACACATTCCACTCCAAGCGAGCCGCGACACTTACGTCACGTCCGCCCGCCCGCGCGGTGATGACGTCACGACCC
AGGGCTGGCGTCACGTGTCCCCCCCGCGGGGGGCGGCCCTTGAGGGCGGCGCTTCCGGTCGGCGGAGCCTGGTGGCCGCAGCGGCGGTGG
CGACGACGGCCGAGACGTGGGGATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGA
GGACGAGGGCCAGCTGACGGAGATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAA
GGATGCATTAAATACAACTGAGAACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCA
GGTCAAGCAAGTAGAACATGAAAATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAAC
TTCAGACGTCAGCAGGCGGAAATGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGT
GGATAACCAGCTGGAGGAAACCTGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTT
GATAAAAAAGCAAAGAGAGACTTCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGAC
ACAGACAGAGAAAGAGGACACCTCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCA
ACAGAGACAAAAGAGACTTAATTCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGA
GATTATGCTAACACCAGTGACTGTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAA
AAATGAGAGCAGTCCAATTCGATTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAA
GCAACTCCAGTTTCTTCCTCTAGATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCC
TGAACCGGTGCCAAATGGAGTGAAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGT
TTCAGTCACTCCACAGGGGAATGATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAA
AGAAAAGGACCAGATTGAGGCAGCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGACCCCTCA

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000541076_chr12_123665757_-_4396nt
GGGCTCACAGGCTGCGGGAACTTCCTTCCCACTGCCTGTTTTCCTTGGATCGCGGTATCTCTCTTCCTGGAGGAAAAAGGCTCTTATGAC
CTCATGGCGCGCTCTCCCGAGCCGCAGTGACGTCATTAATGCGCTCACGCGTCACAGCCCAATCATAGGGCCCTTCCCCTCCCTTTAGAA
GTCCCGACTGTCCCTGACACATTCCACTCCAAGCGAGCCGCGACACTTACGTCACGTCCGCCCGCCCGCGCGGTGATGACGTCACGACCC
AGGGCTGGCGTCACGTGTCCCCCCCGCGGGGGGCGGCCCTTGAGGGCGGCGCTTCCGGTCGGCGGAGCCTGGTGGCCGCAGCGGCGGTGG
CGACGACGGCCGAGACGTGGGGATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGA
GGACGAGGGCCAGCTGACGGAGATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAA
GGATGCATTAAATACAACTGAGAACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCA
GGTCAAGCAAGTAGAACATGAAAATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAAC
TTCAGACGTCAGCAGGCGGAAATGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGT
GGATAACCAGCTGGAGGAAACCTGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTT
GATAAAAAAGCAAAGAGAGACTTCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGAC
ACAGACAGAGAAAGAGGACACCTCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCA
ACAGAGACAAAAGAGACTTAATTCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGA
GATTATGCTAACACCAGTGACTGTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAA
AAATGAGAGCAGTCCAATTCGATTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAA
GCAACTCCAGTTTCTTCCTCTAGATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCC
TGAACCGGTGCCAAATGGAGTGAAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGT
TTCAGTCACTCCACAGGGGAATGATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAA
AGAAAAGGACCAGATTGAGGCAGCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGGAAGCCTT
GGAAGATCGTTTGGAAAGGATTAATCGAGAACTGGGTTCAGTTCGCATGACGCTAAAGAAATTCCATGTTTTGCGCACCTCTGCAAATCT
TTGAGATTTGTAGCCATTAAATTTTGAGACATTTTTGTTTGCACTAATGTATAATTATGCAGTCAGAAAAGGCAAACTATTTTGTACTGT
TTATAAGCCTTCAAACAGTAGTTTTACAATCATGCTATTCTTACACTTGCTATTTTATACTTCAAATGGCCACATATTTTCAAGATATTT
TTGTTATGCTCAGGAATCTCTTGTATATTTTACTATTTAAAAAGCATTATTTTTAAATAGTATCTGTCTCCAATTTATATCAAGAATAAG
GAAATATAAACAGAGGAAGCAGCTTGTTTCTAAACAAATAGTGTTATCCTTTTACAATTAACTGCACATCAATTTTATAGACTTGTTCTA
CATTGTAAATACAATTCAGTTTTTAAAAAATAAAGCTTAATAGCTTCCATAATGATAGACTAGTACATGCTGAATACATAAACAATTACA
GTGTACCTTGGATTTCAGTTGTGTTGAGGTTTTTAAAAAATGATAATGCAATTCGTATTTGAAACGTGTCTTAGAGTGAATATCAGAATA
GTAATAATGGACTCTTGGAAAGCTTTGAAAACTACATGAATATAACTCATTTTCTTTAAACTTTATTGTCTGTAAGAGAAAAAAGAGAGA
TTGTAATTCTCTAATTTTATCTTTTCTAAAAAAGTTAAACAATTGGAGAGCCCTCTCTGGAGGGCTCTCAGAGTAGCTCTCTGCCCATTG
TTCTGAATTAACTTGTGTCCCACCCTGGACAATAAATGGACAGATAAACCCTTTGAAATACAAGCCACCACCCCGTGAGGGATTAAGAGG
GCAGCCTGGTTTTCTTAGTGTGCATGGCTTCAGCTGTCCGTCATAGTTGTCATCTGGATATGTTCACCCCTTTCCACTCCTTCACCCTGG
CCAAAAGGAAAATATTTCCACTGTAGGTGCTGTAAGAACACTAGACTTTAGATCATCACAATCTACTGTATTTGTTAATGGACAGGGAGT
GTGTCCGGATGGAGCCTGGTGCCTTCCCCTCGGCCTTGCAGAGGGCTCCAGCCCACTGCCTCTGTGGTAGCCGCTGGCTCTCAGAAGTAG
CACGTGGGCAGGAGTCTCTCCTCTGATCCAGGAGCATTGGCAGGTTTGTGTTGGGACTGCTGGTTAAGTTGGAGCTGTGTAACTACTTAG
TTTTTGGTAGCCAATCAGAACGCAGTGCCCCACATATTCCAGCTCGGTACATGTTGATAAACAGACTCATCCAAACTTTCAAAATGGATT
CGTACTAAACATGCTCAGGTTTTAAATTTTGGTTTGCTTTTGAGCTTTTCCTCTTTATGTGGCTCTTAATAATAAGTAGTTAGAATGAAC
CAAGCCATCCCAGTTATTCCAAGCAGGCTCTCAAATGACCTTTGAGCACCCTTCACCTGGCTGGTCCCCAGGCCAGGGGTCCACAGCCCT
GCTCCCTTCTCAGCAAGGAGGGTGGCCTGTCTGACAGTGCAGTTGAACCTTTGCTCCCTACTCTGCAACTTTTGAAGACTTCAGGCTAAT
CAAAATTACTTATAATTAGAATCAAGTGCCTTTATTCTTGTTTTTTATTTTTATTTTATTTTATTTATTTATTTTTTTAGATGGAGTTTT
GCCCTTGTTGCCCAGGCTGGAGTGCAATGGCATGATCTCAGCTCACTGCAACCTCTGCCTCCCGGGTTCAAGCGATTCTCCTGCCTCAGC
CTGCTGGGTAGCTGGGATTACAGGCATCTGCCACCACGCCCGGCTAATTTTGTGTGTGTGTATATGTCTATGTGTGTGTGTGTATGTATA
TATCTTTTTTTTTTTTTTAGTAGAGATGGTGTTTCACCATATTGGCCAGGCTGGTCTCAAACTCCTGAACTCATGTGATCCGCCTGCCTT
GGCCCCTCAAAGTGCTGGGATTACAGGCATGAGCCACCACACCCGGCCTATTCTTGGTATTCTTTATTCTTGGTTTTCTAGCCTTTAGAA
AAAAAAAATCTAGTCTTGGTAAAGAAAATGTTCATTTTAATCAAGCTCCAGTACAGCTTGTGTCAAGACCTAGTAAGACCACCTTTAATG
TGTTCCTGGATATGACATTAAAAACTAACTTGAAAATTGTTAGGATATTTCCTTGTTCCCTACTTTTATTGTAAAATCTACTACATTCTT
AAGAATTAAAAAATGCCATTTCAGAAGAGATGATAGTTTTATCTTGCCAAGGAATTATCTTCTTAGTAGCCTATATTGGCTTATTCCAAA
AAAGGCGTTAACCTCCATCAAAACATCTTCTGCGCCTCTCTCTCAGCATATGCTTTGATATTTGAAGTGTGTAATAGATTGGAGCTATCA
GTCACTTATTTCTAAAAAATGTATTCTTTTTTCTTCATAGCTGTGAAGAGGGATACCAAGGAAAGTTCTTTCTGCTGTCTTTCTCTTCGG
TAATGCTTATCTTATGAACACTCAACTGAAAAAACACTCCACCTAAAAGCAGGAAAGATGGCAATTCTAAATAGCAGCTATTATCCCCGG

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000606320_chr12_123665757_-_4396nt
GGGCTCACAGGCTGCGGGAACTTCCTTCCCACTGCCTGTTTTCCTTGGATCGCGGTATCTCTCTTCCTGGAGGAAAAAGGCTCTTATGAC
CTCATGGCGCGCTCTCCCGAGCCGCAGTGACGTCATTAATGCGCTCACGCGTCACAGCCCAATCATAGGGCCCTTCCCCTCCCTTTAGAA
GTCCCGACTGTCCCTGACACATTCCACTCCAAGCGAGCCGCGACACTTACGTCACGTCCGCCCGCCCGCGCGGTGATGACGTCACGACCC
AGGGCTGGCGTCACGTGTCCCCCCCGCGGGGGGCGGCCCTTGAGGGCGGCGCTTCCGGTCGGCGGAGCCTGGTGGCCGCAGCGGCGGTGG
CGACGACGGCCGAGACGTGGGGATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGA
GGACGAGGGCCAGCTGACGGAGATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAA
GGATGCATTAAATACAACTGAGAACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCA
GGTCAAGCAAGTAGAACATGAAAATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAAC
TTCAGACGTCAGCAGGCGGAAATGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGT
GGATAACCAGCTGGAGGAAACCTGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTT
GATAAAAAAGCAAAGAGAGACTTCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGAC
ACAGACAGAGAAAGAGGACACCTCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCA
ACAGAGACAAAAGAGACTTAATTCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGA
GATTATGCTAACACCAGTGACTGTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAA
AAATGAGAGCAGTCCAATTCGATTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAA
GCAACTCCAGTTTCTTCCTCTAGATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCC
TGAACCGGTGCCAAATGGAGTGAAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGT
TTCAGTCACTCCACAGGGGAATGATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAA
AGAAAAGGACCAGATTGAGGCAGCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGGAAGCCTT
GGAAGATCGTTTGGAAAGGATTAATCGAGAACTGGGTTCAGTTCGCATGACGCTAAAGAAATTCCATGTTTTGCGCACCTCTGCAAATCT
TTGAGATTTGTAGCCATTAAATTTTGAGACATTTTTGTTTGCACTAATGTATAATTATGCAGTCAGAAAAGGCAAACTATTTTGTACTGT
TTATAAGCCTTCAAACAGTAGTTTTACAATCATGCTATTCTTACACTTGCTATTTTATACTTCAAATGGCCACATATTTTCAAGATATTT
TTGTTATGCTCAGGAATCTCTTGTATATTTTACTATTTAAAAAGCATTATTTTTAAATAGTATCTGTCTCCAATTTATATCAAGAATAAG
GAAATATAAACAGAGGAAGCAGCTTGTTTCTAAACAAATAGTGTTATCCTTTTACAATTAACTGCACATCAATTTTATAGACTTGTTCTA
CATTGTAAATACAATTCAGTTTTTAAAAAATAAAGCTTAATAGCTTCCATAATGATAGACTAGTACATGCTGAATACATAAACAATTACA
GTGTACCTTGGATTTCAGTTGTGTTGAGGTTTTTAAAAAATGATAATGCAATTCGTATTTGAAACGTGTCTTAGAGTGAATATCAGAATA
GTAATAATGGACTCTTGGAAAGCTTTGAAAACTACATGAATATAACTCATTTTCTTTAAACTTTATTGTCTGTAAGAGAAAAAAGAGAGA
TTGTAATTCTCTAATTTTATCTTTTCTAAAAAAGTTAAACAATTGGAGAGCCCTCTCTGGAGGGCTCTCAGAGTAGCTCTCTGCCCATTG
TTCTGAATTAACTTGTGTCCCACCCTGGACAATAAATGGACAGATAAACCCTTTGAAATACAAGCCACCACCCCGTGAGGGATTAAGAGG
GCAGCCTGGTTTTCTTAGTGTGCATGGCTTCAGCTGTCCGTCATAGTTGTCATCTGGATATGTTCACCCCTTTCCACTCCTTCACCCTGG
CCAAAAGGAAAATATTTCCACTGTAGGTGCTGTAAGAACACTAGACTTTAGATCATCACAATCTACTGTATTTGTTAATGGACAGGGAGT
GTGTCCGGATGGAGCCTGGTGCCTTCCCCTCGGCCTTGCAGAGGGCTCCAGCCCACTGCCTCTGTGGTAGCCGCTGGCTCTCAGAAGTAG
CACGTGGGCAGGAGTCTCTCCTCTGATCCAGGAGCATTGGCAGGTTTGTGTTGGGACTGCTGGTTAAGTTGGAGCTGTGTAACTACTTAG
TTTTTGGTAGCCAATCAGAACGCAGTGCCCCACATATTCCAGCTCGGTACATGTTGATAAACAGACTCATCCAAACTTTCAAAATGGATT
CGTACTAAACATGCTCAGGTTTTAAATTTTGGTTTGCTTTTGAGCTTTTCCTCTTTATGTGGCTCTTAATAATAAGTAGTTAGAATGAAC
CAAGCCATCCCAGTTATTCCAAGCAGGCTCTCAAATGACCTTTGAGCACCCTTCACCTGGCTGGTCCCCAGGCCAGGGGTCCACAGCCCT
GCTCCCTTCTCAGCAAGGAGGGTGGCCTGTCTGACAGTGCAGTTGAACCTTTGCTCCCTACTCTGCAACTTTTGAAGACTTCAGGCTAAT
CAAAATTACTTATAATTAGAATCAAGTGCCTTTATTCTTGTTTTTTATTTTTATTTTATTTTATTTATTTATTTTTTTAGATGGAGTTTT
GCCCTTGTTGCCCAGGCTGGAGTGCAATGGCATGATCTCAGCTCACTGCAACCTCTGCCTCCCGGGTTCAAGCGATTCTCCTGCCTCAGC
CTGCTGGGTAGCTGGGATTACAGGCATCTGCCACCACGCCCGGCTAATTTTGTGTGTGTGTATATGTCTATGTGTGTGTGTGTATGTATA
TATCTTTTTTTTTTTTTTAGTAGAGATGGTGTTTCACCATATTGGCCAGGCTGGTCTCAAACTCCTGAACTCATGTGATCCGCCTGCCTT
GGCCCCTCAAAGTGCTGGGATTACAGGCATGAGCCACCACACCCGGCCTATTCTTGGTATTCTTTATTCTTGGTTTTCTAGCCTTTAGAA
AAAAAAAATCTAGTCTTGGTAAAGAAAATGTTCATTTTAATCAAGCTCCAGTACAGCTTGTGTCAAGACCTAGTAAGACCACCTTTAATG
TGTTCCTGGATATGACATTAAAAACTAACTTGAAAATTGTTAGGATATTTCCTTGTTCCCTACTTTTATTGTAAAATCTACTACATTCTT
AAGAATTAAAAAATGCCATTTCAGAAGAGATGATAGTTTTATCTTGCCAAGGAATTATCTTCTTAGTAGCCTATATTGGCTTATTCCAAA
AAAGGCGTTAACCTCCATCAAAACATCTTCTGCGCCTCTCTCTCAGCATATGCTTTGATATTTGAAGTGTGTAATAGATTGGAGCTATCA
GTCACTTATTTCTAAAAAATGTATTCTTTTTTCTTCATAGCTGTGAAGAGGGATACCAAGGAAAGTTCTTTCTGCTGTCTTTCTCTTCGG
TAATGCTTATCTTATGAACACTCAACTGAAAAAACACTCCACCTAAAAGCAGGAAAGATGGCAATTCTAAATAGCAGCTATTATCCCCGG

>In-frame_VPS37B_ENST00000267202_chr12_123380499_-_MPHOSPH9_ENST00000392425_chr12_123665757_-_2210nt
GGGCTCACAGGCTGCGGGAACTTCCTTCCCACTGCCTGTTTTCCTTGGATCGCGGTATCTCTCTTCCTGGAGGAAAAAGGCTCTTATGAC
CTCATGGCGCGCTCTCCCGAGCCGCAGTGACGTCATTAATGCGCTCACGCGTCACAGCCCAATCATAGGGCCCTTCCCCTCCCTTTAGAA
GTCCCGACTGTCCCTGACACATTCCACTCCAAGCGAGCCGCGACACTTACGTCACGTCCGCCCGCCCGCGCGGTGATGACGTCACGACCC
AGGGCTGGCGTCACGTGTCCCCCCCGCGGGGGGCGGCCCTTGAGGGCGGCGCTTCCGGTCGGCGGAGCCTGGTGGCCGCAGCGGCGGTGG
CGACGACGGCCGAGACGTGGGGATGGCGGGCGCCGGGAGCGAAGCCCGGTTCGCCGGGCTGTCGCTGGTGCAGCTCAACGAGCTGCTGGA
GGACGAGGGCCAGCTGACGGAGATGGTGCAGAAGATGGAGGAGCTTTTAGGAGAGTATGAGTCCCTTGGAAAAGAACACAGGAGAGTAAA
GGATGCATTAAATACAACTGAGAACAAATTGCTTGATGCATATACTCAGATTTCTGATTTGAAAAGAATGATTTCAAAACTTGAAGCTCA
GGTCAAGCAAGTAGAACATGAAAATATGTTAAGCCTTCGTCATAATTCTAGAATTCACGTGAGACCCTCGCGTGCCAACACACTAGCAAC
TTCAGACGTCAGCAGGCGGAAATGGCTGATTCCAGGTGCAGAGTATTCCATCTTTACTGGCCAGCCTCTGGACACCCAGGACAGTAACGT
GGATAACCAGCTGGAGGAAACCTGTAGCCTAGGGCACCGTTCACCTCTGGAAAAGGATTCTTCACCTGGAAGTTCATCAACAAGCTTGTT
GATAAAAAAGCAAAGAGAGACTTCAGACACGCCGATCATGAGAGCTTTAAAAGAACTTGATGAGGGAAAAATATTTAAAAATTGGGGGAC
ACAGACAGAGAAAGAGGACACCTCAAATATAAATCCTCGGCAAACTGAAACTTCAGTTAATGCAAGTCGTTCTCCAGAAAAGTGTGCCCA
ACAGAGACAAAAGAGACTTAATTCGGCCTCACAGAGATCATCATCTTTACCACCTTCAAATCGTAAATCAAGTACTCCAACAAAAAGAGA
GATTATGCTAACACCAGTGACTGTGGCTTATAGTCCAAAGCGATCCCCTAAAGAAAACTTGTCCCCAGGATTTAGTCATCTGCTTAGCAA
AAATGAGAGCAGTCCAATTCGATTTGATATACTTTTGGATGATTTAGATACTGTTCCTGTGTCTACATTACAACGTACCAATCCAAGAAA
GCAACTCCAGTTTCTTCCTCTAGATGACTCGGAAGAAAAAACTTATTCTGAGAAAGCCACCGATAACCATGTTAATCATAGCTCTTGCCC
TGAACCGGTGCCAAATGGAGTGAAGAAAGTATCTGTGAGAACAGCCTGGGAGAAGAATAAATCAGTTAGCTACGAACAGTGTAAGCCGGT
TTCAGTCACTCCACAGGGGAATGATTTTGAATATACAGCAAAAATTCGGACCCTAGCTGAAACAGAACGATTTTTTGATGAACTTACAAA
AGAAAAGGACCAGATTGAGGCAGCACTAAGCAGGATGCCTTCTCCTGGAGGACGAATCACTTTACAGACAAGATTAAATCAGGAAGCCTT
GGAAGATCGTTTGGAAAGGATTAATCGAGAACTGGGTTCAGTTCGCATGACGCTAAAGAAATTCCATGTTTTGCGCACCTCTGCAAATCT
TTGAGATTTGTAGCCATTAAATTTTGAGACATTTTTGTTTGCACTAATGTATAATTATGCAGTCAGAAAAGGCAAACTATTTTGTACTGT
TTATAAGCCTTCAAACAGTAGTTTTACAATCATGCTATTCTTACACTTGCTATTTTATACTTCAAATGGCCACATATTTTCAAGATATTT
TTGTTATGCTCAGGAATCTCTTGTATATTTTACTATTTAAAAAGCATTATTTTTAAATAGTATCTGTCTCCAATTTATATCAAGAATAAG
GAAATATAAACAGAGGAAGCAGCTTGTTTCTAAACAAATAGTGTTATCCTTTTACAATTAACTGCACATCAATTTTATAGACTTGTTCTA


Top

FusionGenePPI for VPS37B_MPHOSPH9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VPS37BTSG101, VPS28, SH3KBP1, CEP55, WDR12, USP14, XPO7, UNC13D, XPO1, MVB12A, AES, BYSL, ERCC1, PRKAA1, QARS, SMARCD1, NCK2, SORBS3, SH3YL1, DCUN1D1, CDC73, UBASH3B, FBF1, DNAJB1, NIF3L1, RPRD1A, WARS, YBX1, UBAP1, GRB2MPHOSPH9USP11, YWHAZ, YWHAG, SVIL, LATS2, CCDC67, KIAA0753, CCDC14, MED4, OFD1, PCM1, CEP97, CEP104, CEP162, CEP290, CEP120, CNTROB, SPICE1, CEP128, CEP135, CEP63, CEP89, CNTRL, NINL, ODF2, RPGRIP1L, POC5, CENPJ, XPO1, CDC14A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneVPS37Bchr12:123380499chr12:123665757ENST00000267202-1450_17037286IST1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VPS37B_MPHOSPH9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VPS37B_MPHOSPH9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource