FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41589

FusionGeneSummary for VPS37A_WDR78

check button Fusion gene summary
Fusion gene informationFusion gene name: VPS37A_WDR78
Fusion gene ID: 41589
HgeneTgene
Gene symbol

VPS37A

WDR78

Gene ID

137492

79819

Gene nameVPS37A, ESCRT-I subunitWD repeat domain 78
SynonymsHCRP1|PQBP2|SPG53DIC4
Cytomap

8p22

1p31.3

Type of geneprotein-codingprotein-coding
Descriptionvacuolar protein sorting-associated protein 37AESCRT-I complex subunit VPS37Ahepatocellular carcinoma-related protein 1polyglutamine binding protein 2vacuolar protein sorting 37 homolog AWD repeat-containing protein 78
Modification date2018052220180523
UniProtAcc

Q8NEZ2

Q5VTH9

Ensembl transtripts involved in fusion geneENST00000324849, ENST00000324815, 
ENST00000521829, ENST00000521005, 
ENST00000521162, 
ENST00000371026, 
ENST00000431318, ENST00000371023, 
ENST00000371022, ENST00000488333, 
ENST00000493572, 
Fusion gene scores* DoF score4 X 4 X 2=322 X 2 X 2=8
# samples 42
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: VPS37A [Title/Abstract] AND WDR78 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-AB2O-01AVPS37Achr8

17104878

+WDR78chr1

67337192

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000324849ENST00000371026VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000324849ENST00000431318VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000324849ENST00000371023VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000324849ENST00000371022VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000324849ENST00000488333VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000324849ENST00000493572VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000324815ENST00000371026VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000324815ENST00000431318VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000324815ENST00000371023VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000324815ENST00000371022VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000324815ENST00000488333VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000324815ENST00000493572VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521829ENST00000371026VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521829ENST00000431318VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521829ENST00000371023VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521829ENST00000371022VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000521829ENST00000488333VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000521829ENST00000493572VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521005ENST00000371026VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521005ENST00000431318VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521005ENST00000371023VPS37Achr8

17104878

+WDR78chr1

67337192

-
In-frameENST00000521005ENST00000371022VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000521005ENST00000488333VPS37Achr8

17104878

+WDR78chr1

67337192

-
5CDS-intronENST00000521005ENST00000493572VPS37Achr8

17104878

+WDR78chr1

67337192

-
intron-3CDSENST00000521162ENST00000371026VPS37Achr8

17104878

+WDR78chr1

67337192

-
intron-3CDSENST00000521162ENST00000431318VPS37Achr8

17104878

+WDR78chr1

67337192

-
intron-3CDSENST00000521162ENST00000371023VPS37Achr8

17104878

+WDR78chr1

67337192

-
intron-3CDSENST00000521162ENST00000371022VPS37Achr8

17104878

+WDR78chr1

67337192

-
intron-intronENST00000521162ENST00000488333VPS37Achr8

17104878

+WDR78chr1

67337192

-
intron-intronENST00000521162ENST00000493572VPS37Achr8

17104878

+WDR78chr1

67337192

-

Top

FusionProtFeatures for VPS37A_WDR78


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VPS37A

Q8NEZ2

WDR78

Q5VTH9

Component of the ESCRT-I complex, a regulator ofvesicular trafficking process. Required for the sorting ofendocytic ubiquitinated cargos into multivesicular bodies. May beinvolved in cell growth and differentiation.{ECO:0000269|PubMed:15240819}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410438_468266546Coiled coilOntology_term=ECO:0000255
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417438_468266849Coiled coilOntology_term=ECO:0000255
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416438_46812562Coiled coilOntology_term=ECO:0000255
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410431_465266546Compositional biasNote=Glu-rich
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417431_465266849Compositional biasNote=Glu-rich
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416431_46512562Compositional biasNote=Glu-rich
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410534_574266546RepeatNote=WD 1
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410583_631266546RepeatNote=WD 2
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410658_698266546RepeatNote=WD 3
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410702_742266546RepeatNote=WD 4
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410745_784266546RepeatNote=WD 5
TgeneWDR78chr8:17104878chr1:67337192ENST00000371023-410790_829266546RepeatNote=WD 6
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417534_574266849RepeatNote=WD 1
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417583_631266849RepeatNote=WD 2
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417658_698266849RepeatNote=WD 3
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417702_742266849RepeatNote=WD 4
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417745_784266849RepeatNote=WD 5
TgeneWDR78chr8:17104878chr1:67337192ENST00000371026-417790_829266849RepeatNote=WD 6
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416534_57412562RepeatNote=WD 1
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416583_63112562RepeatNote=WD 2
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416658_69812562RepeatNote=WD 3
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416702_74212562RepeatNote=WD 4
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416745_78412562RepeatNote=WD 5
TgeneWDR78chr8:17104878chr1:67337192ENST00000431318-416790_82912562RepeatNote=WD 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVPS37Achr8:17104878chr1:67337192ENST00000324815+16308_39741186DomainVPS37 C-terminal
HgeneVPS37Achr8:17104878chr1:67337192ENST00000324849+112308_397411144DomainVPS37 C-terminal
HgeneVPS37Achr8:17104878chr1:67337192ENST00000521829+111308_39741312DomainVPS37 C-terminal


Top

FusionGeneSequence for VPS37A_WDR78


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_624aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNI
TLAGTEEGHIHKCSCSTNEQYLDTYRGHKGPVTKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAA

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_591aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKGPVT
KVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAAANENRVEIWDLHISTLDPLIVNTANPGIKFTTI

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_321aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_96aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGN

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_624aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNI
TLAGTEEGHIHKCSCSTNEQYLDTYRGHKGPVTKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAA

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_591aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKGPVT
KVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAAANENRVEIWDLHISTLDPLIVNTANPGIKFTTI

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_321aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_96aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGN

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_624aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNI
TLAGTEEGHIHKCSCSTNEQYLDTYRGHKGPVTKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAA

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_591aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKGPVT
KVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAAANENRVEIWDLHISTLDPLIVNTANPGIKFTTI

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_321aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_96aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGN

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_624aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNI
TLAGTEEGHIHKCSCSTNEQYLDTYRGHKGPVTKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAA

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_591aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK
TNPDLLAVGTGHFGFKEQKRGLACCWSIKNPMWPERITQSPTGVTAVDFSIGAPNLLAVGTHNGTIAIYNVRSNSNVPVLDSSESPQKHL
GPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCTDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKGPVT
KVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFTPATSVVYDVAWSPKSSTIFAAANENRVEIWDLHISTLDPLIVNTANPGIKFTTI

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_321aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGI
MSTAWDLTDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLF
FMERVLMENIFQPKLAATRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSCDLTKGLNVSSLAWNK

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_96aa
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSQRNKNTEVLCRNRLGNDLTVERMMQTFNGAPKNKDVQCDKIIMEDKGN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_1872nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGACACAAATATC
TATTTGGCTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTTCATATAATGAACAATACTTAGATACCTACAGAGGACATAAGGGT
CCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAG
AATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCT
GCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTC
ACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCT

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_1773nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGGTCCAGTGTAT
AAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAG
CCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAG
AACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATT
CTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTG

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_963nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_288nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGTAAT

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_1872nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGACACAAATATC
TATTTGGCTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTTCATATAATGAACAATACTTAGATACCTACAGAGGACATAAGGGT
CCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAG
AATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCT
GCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTC
ACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCT

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_1773nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGGTCCAGTGTAT
AAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAG
CCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAG
AACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATT
CTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTG

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_963nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_288nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGTAAT

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_1872nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGACACAAATATC
TATTTGGCTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTTCATATAATGAACAATACTTAGATACCTACAGAGGACATAAGGGT
CCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAG
AATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCT
GCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTC
ACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCT

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_1773nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGGTCCAGTGTAT
AAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAG
CCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAG
AACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATT
CTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTG

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_963nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_288nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGTAAT

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_1872nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGACACAAATATC
TATTTGGCTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTTCATATAATGAACAATACTTAGATACCTACAGAGGACATAAGGGT
CCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAG
AATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCT
GCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTC
ACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCT

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_1773nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT
CCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGC
TATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTG
GGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGAT
GGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAA
GGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGGTCCAGTGTAT
AAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAG
CCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAG
AACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATT
CTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTG

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_963nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATA
ATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGT
AAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATA
GAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTT
TTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAA
GAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAA
TCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAA
ACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAAT

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_288nt
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAG
CGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTA
TATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGTAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_3791nt
AGCTGGCGCCATCGCGCACCCTCTCAGGTTCATCGTCCCCGCCCCCTTTCTACTTCCCTAACCCGCCCCTCCCCCCGTAAGGCTGCAGCG
GATGCAAGATCTACTTGTGTCGCTGAGCTCGCGCTCCTCCTCCTCCTCCTCGCCATAGAGACAGCACTCGGCGGCGGTGGCGGTGGCGGT
GGCGGTAGCGGCGGCGGCAGCGGGTGCCCCATAGACACCTCTCGCCCAGCGAAGGGAAAGGCGAGCAGGAGCTGCGCCGCACCGTGCTGC
GCCGTCGCTTTTCGCACGTCCTGACGGGGGCGCTAGATGATGACGCGACACGCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGC
AAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCTGGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCC
TGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGTCCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGA
GAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGC
AGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGG
CTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACA
AGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATA
AAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAAC
TTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGA
GCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACT
CAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTG
CAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGG
AAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTG
ACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTA
AAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTG
CTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGCTATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTA
ATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTGGGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAA
CAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGATGGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATG
ATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAAGGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGG
CTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGACACAAATATCTATTTGGCTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTT
CATATAATGAACAATACTTAGATACCTACAGAGGACATAAGGGTCCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTT
TAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTT
ACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTT
TGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAG
ACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTGGAAACTGGCCGGGGAGATATAATGGATACTTTGCTTG
GATCCAAGTCAAACCAATCAGCATAATTCATCATTCCTAATATTTTTCTTGTAGTTGTTTTAAAAAAGGAATTAACATCCAATATTCTGT
ATTACATACTGTACACCAGATTTTGATTTCAGAAAACAATATTTGATGTATAACTTCCACTTAATTTAAATTTAATAAACTTTTATTTCA
GAGATATTTGATTAGTTTACAATCTAAGAGTTATTCTTAAGAGTTTCAGTGGAATTTTCTTAATTTTTCTAAAGATATTCCTACTCTCTT
GATCATATTCTAAGTACATATGAGTACATGTACATTCTTATACAATGTCTAAATGGGTTAGAAAATTATTATACCTATAGAAGCGAAACT
TGGAAATTAATAGAATCACTTAAACCAAAATCTTTATAAGACACAATTCTATTGATTTTAAAGCTTCTGCTTTCCAGGCTCTGTTTTCCA
GAGTTTATAATTACGTAGTTTTTAGTAGATGAAAATAATGGATTCTTGTACCTAACATTTTATCCTCTTAGATCTAAGAGCCGAAGCTAT
AGAACTTTGTTAGACTATTTGGCAAGCAAAATATATGACAGTAAATATCAGAATTTTATGGTTTGACCAGCGCTTATCACATTCCCAATT
CAGTGAGAAAAATTCATCTGGGACACAACAGGGTACTCTTCTCTGTTTGCCCAGAATCAGCTCTGGATTTTAAGCCCAGACTTCAGTGGA
CCCAGATAGAAAATATAAAGTCTCTGATCTATAGGCCACATCAGGATGTTATTTTATGAAGAGTTCTAGAGCAAGGTTGCGGAAATCGGG
GTGGAGATGGGGAGCAGTGACTCCTCCAAATATTCATTGCTAACAGGCCATTCTATGCAGTTTGTTTTAACAAATCCTGGGTTAAACTGA
GGCCACAGGACATGATGGGCTGTTCTATAAAGCATTCTAAGTGGAGAGGAGACGATAGGGCATATGAAATTCACTAAACTCTCTGGAAAA
AAAATATGTATATATTAAAAACCAAGACTGGAATCAGTGCAACAGTGGGAACTACCTTTTACAAGTATCCATTGCTTCATAAACTCCATT
TGTTTGGACCAATCCCTTAAACAAAAGCAAGGCAAATTTTACATGGATTTAGAGCCTAGGTCAGGTTATTAGGATTATAAATTTTCCACT
GGTATGTCATTGTGATTATCTTTGTTTTTGTCTTTCTGAAAGATTGGATTTTCTATAACACCTTGTGTAAGAAAATAAAAAACTTGATCT

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_3686nt
AGCTGGCGCCATCGCGCACCCTCTCAGGTTCATCGTCCCCGCCCCCTTTCTACTTCCCTAACCCGCCCCTCCCCCCGTAAGGCTGCAGCG
GATGCAAGATCTACTTGTGTCGCTGAGCTCGCGCTCCTCCTCCTCCTCCTCGCCATAGAGACAGCACTCGGCGGCGGTGGCGGTGGCGGT
GGCGGTAGCGGCGGCGGCAGCGGGTGCCCCATAGACACCTCTCGCCCAGCGAAGGGAAAGGCGAGCAGGAGCTGCGCCGCACCGTGCTGC
GCCGTCGCTTTTCGCACGTCCTGACGGGGGCGCTAGATGATGACGCGACACGCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGC
AAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCTGGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCC
TGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGTCCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGA
GAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGC
AGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGG
CTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACA
AGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATA
AAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAAC
TTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGA
GCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACT
CAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTG
CAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGG
AAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTG
ACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTA
AAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTG
CTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGCTATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTA
ATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTGGGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAA
CAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGATGGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATG
ATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAAGGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGG
CTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGGTCCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTT
CTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTG
CCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTC
TGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATG
GACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTGGAAACTGGCCGGGGAGATATAATGGATACTTTGCTTGGATCCAAGT
CAAACCAATCAGCATAATTCATCATTCCTAATATTTTTCTTGTAGTTGTTTTAAAAAAGGAATTAACATCCAATATTCTGTATTACATAC
TGTACACCAGATTTTGATTTCAGAAAACAATATTTGATGTATAACTTCCACTTAATTTAAATTTAATAAACTTTTATTTCAGAGATATTT
GATTAGTTTACAATCTAAGAGTTATTCTTAAGAGTTTCAGTGGAATTTTCTTAATTTTTCTAAAGATATTCCTACTCTCTTGATCATATT
CTAAGTACATATGAGTACATGTACATTCTTATACAATGTCTAAATGGGTTAGAAAATTATTATACCTATAGAAGCGAAACTTGGAAATTA
ATAGAATCACTTAAACCAAAATCTTTATAAGACACAATTCTATTGATTTTAAAGCTTCTGCTTTCCAGGCTCTGTTTTCCAGAGTTTATA
ATTACGTAGTTTTTAGTAGATGAAAATAATGGATTCTTGTACCTAACATTTTATCCTCTTAGATCTAAGAGCCGAAGCTATAGAACTTTG
TTAGACTATTTGGCAAGCAAAATATATGACAGTAAATATCAGAATTTTATGGTTTGACCAGCGCTTATCACATTCCCAATTCAGTGAGAA
AAATTCATCTGGGACACAACAGGGTACTCTTCTCTGTTTGCCCAGAATCAGCTCTGGATTTTAAGCCCAGACTTCAGTGGACCCAGATAG
AAAATATAAAGTCTCTGATCTATAGGCCACATCAGGATGTTATTTTATGAAGAGTTCTAGAGCAAGGTTGCGGAAATCGGGGTGGAGATG
GGGAGCAGTGACTCCTCCAAATATTCATTGCTAACAGGCCATTCTATGCAGTTTGTTTTAACAAATCCTGGGTTAAACTGAGGCCACAGG
ACATGATGGGCTGTTCTATAAAGCATTCTAAGTGGAGAGGAGACGATAGGGCATATGAAATTCACTAAACTCTCTGGAAAAAAAATATGT
ATATATTAAAAACCAAGACTGGAATCAGTGCAACAGTGGGAACTACCTTTTACAAGTATCCATTGCTTCATAAACTCCATTTGTTTGGAC
CAATCCCTTAAACAAAAGCAAGGCAAATTTTACATGGATTTAGAGCCTAGGTCAGGTTATTAGGATTATAAATTTTCCACTGGTATGTCA

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_1687nt
AGCTGGCGCCATCGCGCACCCTCTCAGGTTCATCGTCCCCGCCCCCTTTCTACTTCCCTAACCCGCCCCTCCCCCCGTAAGGCTGCAGCG
GATGCAAGATCTACTTGTGTCGCTGAGCTCGCGCTCCTCCTCCTCCTCCTCGCCATAGAGACAGCACTCGGCGGCGGTGGCGGTGGCGGT
GGCGGTAGCGGCGGCGGCAGCGGGTGCCCCATAGACACCTCTCGCCCAGCGAAGGGAAAGGCGAGCAGGAGCTGCGCCGCACCGTGCTGC
GCCGTCGCTTTTCGCACGTCCTGACGGGGGCGCTAGATGATGACGCGACACGCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGC
AAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCTGGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCC
TGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGTCCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGA
GAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGC
AGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGG
CTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACA
AGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATA
AAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAAC
TTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGA
GCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACT
CAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTG
CAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGG
AAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTG
ACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTA
AAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGGTAACCCAAACAAGAATAAGAAGCATTTTTATCTGGCTGT

>In-frame_VPS37A_ENST00000324849_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_1504nt
AGCTGGCGCCATCGCGCACCCTCTCAGGTTCATCGTCCCCGCCCCCTTTCTACTTCCCTAACCCGCCCCTCCCCCCGTAAGGCTGCAGCG
GATGCAAGATCTACTTGTGTCGCTGAGCTCGCGCTCCTCCTCCTCCTCCTCGCCATAGAGACAGCACTCGGCGGCGGTGGCGGTGGCGGT
GGCGGTAGCGGCGGCGGCAGCGGGTGCCCCATAGACACCTCTCGCCCAGCGAAGGGAAAGGCGAGCAGGAGCTGCGCCGCACCGTGCTGC
GCCGTCGCTTTTCGCACGTCCTGACGGGGGCGCTAGATGATGACGCGACACGCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGC
AAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCTGGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCC
TGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGTCCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGA
GAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGC
AGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGG
CTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACA
AGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATA
AAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGTAATTTCTATCATTCTGCTTGATAAACTATAATGTTCTAATATACATTTT
TTGAGTCTGTCAATCGACAAGTGAATATTGAAATGTATAAAGCAAAAATAAAAATAATTTGGCCAAACCACAACAGTAGTTGGACACTGT
GTTCTATAGCTTTCAGAATTTGACATGTTAAGTAATAAATATATAGATTTGAATAACATAATTATTCATCTTGGTTTTTATGCATACTAT
ATCATAGAACTTTATACTCTTTAAACGTTTATATAAACTGATTATTTACTATGTCACAAAGAATATCAGCCATAACTATTAACATTTTAA
ATGTGTCAGACACTATGTCCTTCACATGTATTAACTGGTTTAATTTTTACAGCAACCCTATGAGGTAGATACTATTATGCTTCCCCATTT
TATAGATGAGGAAACAGGCAAAGAGAAGTTTGCTAACTGTTCTGGTTCTAGAGCTTGTGCACTTAACTACTATACTTACCACCTCTCACT

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_3470nt
GCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGCAAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCT
GGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCCTGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGT
CCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGAGAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCT
GTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCT
GGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGA
TCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTG
AAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCA
CTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAA
ATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATG
TAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGG
AACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTG
AAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAA
TACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATC
CAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGT
GGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGCTATCACA
ATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTGGGACCTG
TATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGATGGAAGAA
TCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAAGGAGGGG
AAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGACACAAATATCTATTTGG
CTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTTCATATAATGAACAATACTTAGATACCTACAGAGGACATAAGGGTCCAGTGT
ATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCA
AGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATG
AGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCA
TTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTT
TGGAAACTGGCCGGGGAGATATAATGGATACTTTGCTTGGATCCAAGTCAAACCAATCAGCATAATTCATCATTCCTAATATTTTTCTTG
TAGTTGTTTTAAAAAAGGAATTAACATCCAATATTCTGTATTACATACTGTACACCAGATTTTGATTTCAGAAAACAATATTTGATGTAT
AACTTCCACTTAATTTAAATTTAATAAACTTTTATTTCAGAGATATTTGATTAGTTTACAATCTAAGAGTTATTCTTAAGAGTTTCAGTG
GAATTTTCTTAATTTTTCTAAAGATATTCCTACTCTCTTGATCATATTCTAAGTACATATGAGTACATGTACATTCTTATACAATGTCTA
AATGGGTTAGAAAATTATTATACCTATAGAAGCGAAACTTGGAAATTAATAGAATCACTTAAACCAAAATCTTTATAAGACACAATTCTA
TTGATTTTAAAGCTTCTGCTTTCCAGGCTCTGTTTTCCAGAGTTTATAATTACGTAGTTTTTAGTAGATGAAAATAATGGATTCTTGTAC
CTAACATTTTATCCTCTTAGATCTAAGAGCCGAAGCTATAGAACTTTGTTAGACTATTTGGCAAGCAAAATATATGACAGTAAATATCAG
AATTTTATGGTTTGACCAGCGCTTATCACATTCCCAATTCAGTGAGAAAAATTCATCTGGGACACAACAGGGTACTCTTCTCTGTTTGCC
CAGAATCAGCTCTGGATTTTAAGCCCAGACTTCAGTGGACCCAGATAGAAAATATAAAGTCTCTGATCTATAGGCCACATCAGGATGTTA
TTTTATGAAGAGTTCTAGAGCAAGGTTGCGGAAATCGGGGTGGAGATGGGGAGCAGTGACTCCTCCAAATATTCATTGCTAACAGGCCAT
TCTATGCAGTTTGTTTTAACAAATCCTGGGTTAAACTGAGGCCACAGGACATGATGGGCTGTTCTATAAAGCATTCTAAGTGGAGAGGAG
ACGATAGGGCATATGAAATTCACTAAACTCTCTGGAAAAAAAATATGTATATATTAAAAACCAAGACTGGAATCAGTGCAACAGTGGGAA
CTACCTTTTACAAGTATCCATTGCTTCATAAACTCCATTTGTTTGGACCAATCCCTTAAACAAAAGCAAGGCAAATTTTACATGGATTTA
GAGCCTAGGTCAGGTTATTAGGATTATAAATTTTCCACTGGTATGTCATTGTGATTATCTTTGTTTTTGTCTTTCTGAAAGATTGGATTT

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_3365nt
GCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGCAAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCT
GGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCCTGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGT
CCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGAGAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCT
GTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCT
GGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGA
TCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTG
AAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCA
CTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAA
ATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATG
TAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGG
AACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTG
AAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAA
TACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATC
CAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGT
GGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGGCTATCACA
ATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTTGGGACCTG
TATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGATGGAAGAA
TCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAAAGGAGGGG
AAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGGTCCAGTGTATAAAGTGA
CATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAGCCATCTT
TGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAGAACAGGG
TGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATTCTCTTTG
CCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTGGAAACTG
GCCGGGGAGATATAATGGATACTTTGCTTGGATCCAAGTCAAACCAATCAGCATAATTCATCATTCCTAATATTTTTCTTGTAGTTGTTT
TAAAAAAGGAATTAACATCCAATATTCTGTATTACATACTGTACACCAGATTTTGATTTCAGAAAACAATATTTGATGTATAACTTCCAC
TTAATTTAAATTTAATAAACTTTTATTTCAGAGATATTTGATTAGTTTACAATCTAAGAGTTATTCTTAAGAGTTTCAGTGGAATTTTCT
TAATTTTTCTAAAGATATTCCTACTCTCTTGATCATATTCTAAGTACATATGAGTACATGTACATTCTTATACAATGTCTAAATGGGTTA
GAAAATTATTATACCTATAGAAGCGAAACTTGGAAATTAATAGAATCACTTAAACCAAAATCTTTATAAGACACAATTCTATTGATTTTA
AAGCTTCTGCTTTCCAGGCTCTGTTTTCCAGAGTTTATAATTACGTAGTTTTTAGTAGATGAAAATAATGGATTCTTGTACCTAACATTT
TATCCTCTTAGATCTAAGAGCCGAAGCTATAGAACTTTGTTAGACTATTTGGCAAGCAAAATATATGACAGTAAATATCAGAATTTTATG
GTTTGACCAGCGCTTATCACATTCCCAATTCAGTGAGAAAAATTCATCTGGGACACAACAGGGTACTCTTCTCTGTTTGCCCAGAATCAG
CTCTGGATTTTAAGCCCAGACTTCAGTGGACCCAGATAGAAAATATAAAGTCTCTGATCTATAGGCCACATCAGGATGTTATTTTATGAA
GAGTTCTAGAGCAAGGTTGCGGAAATCGGGGTGGAGATGGGGAGCAGTGACTCCTCCAAATATTCATTGCTAACAGGCCATTCTATGCAG
TTTGTTTTAACAAATCCTGGGTTAAACTGAGGCCACAGGACATGATGGGCTGTTCTATAAAGCATTCTAAGTGGAGAGGAGACGATAGGG
CATATGAAATTCACTAAACTCTCTGGAAAAAAAATATGTATATATTAAAAACCAAGACTGGAATCAGTGCAACAGTGGGAACTACCTTTT
ACAAGTATCCATTGCTTCATAAACTCCATTTGTTTGGACCAATCCCTTAAACAAAAGCAAGGCAAATTTTACATGGATTTAGAGCCTAGG
TCAGGTTATTAGGATTATAAATTTTCCACTGGTATGTCATTGTGATTATCTTTGTTTTTGTCTTTCTGAAAGATTGGATTTTCTATAACA

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_1366nt
GCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGCAAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCT
GGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCCTGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGT
CCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGAGAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCT
GTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCT
GGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGA
TCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTG
AAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCA
CTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAA
ATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATG
TAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGG
AACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTG
AAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAA
TACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATC
CAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGG
TAACCCAAACAAGAATAAGAAGCATTTTTATCTGGCTGTTGACAAAATTCTCATAAAATATATAATTACATGTAATAATTAAATAAAGTC

>In-frame_VPS37A_ENST00000324815_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_1183nt
GCAGAGGGGGCGGAGAGCGCCCCCGGGGGCGGGGCACGCAAGTGACGGCGGCGCGGGTGGTGGAGCGCTGGGCGGCCAGGCTCCCTGGCT
GGCCGGTTTGGGCGTCTGGGCCGTGAAGGTGGGACCTCCTGTTCCGGGCCGCAAGTTTCCCTCTCCAGCCGCCCGCCGTTCGTAGCATGT
CCCCCAGAACTCGGGGAGCGCAGGCAGGACAGGCTTAGAGAAGACGCGGTCCCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCT
GTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCTTCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCT
GGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGA
TCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTG
AAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGTAATTTCTATC
ATTCTGCTTGATAAACTATAATGTTCTAATATACATTTTTTGAGTCTGTCAATCGACAAGTGAATATTGAAATGTATAAAGCAAAAATAA
AAATAATTTGGCCAAACCACAACAGTAGTTGGACACTGTGTTCTATAGCTTTCAGAATTTGACATGTTAAGTAATAAATATATAGATTTG
AATAACATAATTATTCATCTTGGTTTTTATGCATACTATATCATAGAACTTTATACTCTTTAAACGTTTATATAAACTGATTATTTACTA
TGTCACAAAGAATATCAGCCATAACTATTAACATTTTAAATGTGTCAGACACTATGTCCTTCACATGTATTAACTGGTTTAATTTTTACA
GCAACCCTATGAGGTAGATACTATTATGCTTCCCCATTTTATAGATGAGGAAACAGGCAAAGAGAAGTTTGCTAACTGTTCTGGTTCTAG
AGCTTGTGCACTTAACTACTATACTTACCACCTCTCACTGTGTACAAATTAACAACCCTGAGCACATTGCATAGCCAAAATCTGTAGGGT

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_3239nt
CCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCT
TCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCG
GTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAG
TCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAAT
GTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTAT
CAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAA
AAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATAT
TAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTC
AGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGA
AGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAG
GCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAA
GAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTT
CAATTGGAGCACCTAACCTTTTAGCCGTTGGCTATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTC
TGGATAGTAGTGAATCACCTCAAAAACATTTGGGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCA
AAAGAGAAATACTAGTTTCTATATCAGCAGATGGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGAT
TAAAGAGAACTACAGCTGCCAGTAACAAAAAAGGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGT
GTTTTGCTTTTCATCCCAAGGACACAAATATCTATTTGGCTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTTCATATAATGAAC
AATACTTAGATACCTACAGAGGACATAAGGGTCCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTG
CAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCT
GGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGA
TTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGAC
AGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTTGGAAACTGGCCGGGGAGATATAATGGATACTTTGCTTGGATCCAAGTCAA
ACCAATCAGCATAATTCATCATTCCTAATATTTTTCTTGTAGTTGTTTTAAAAAAGGAATTAACATCCAATATTCTGTATTACATACTGT
ACACCAGATTTTGATTTCAGAAAACAATATTTGATGTATAACTTCCACTTAATTTAAATTTAATAAACTTTTATTTCAGAGATATTTGAT
TAGTTTACAATCTAAGAGTTATTCTTAAGAGTTTCAGTGGAATTTTCTTAATTTTTCTAAAGATATTCCTACTCTCTTGATCATATTCTA
AGTACATATGAGTACATGTACATTCTTATACAATGTCTAAATGGGTTAGAAAATTATTATACCTATAGAAGCGAAACTTGGAAATTAATA
GAATCACTTAAACCAAAATCTTTATAAGACACAATTCTATTGATTTTAAAGCTTCTGCTTTCCAGGCTCTGTTTTCCAGAGTTTATAATT
ACGTAGTTTTTAGTAGATGAAAATAATGGATTCTTGTACCTAACATTTTATCCTCTTAGATCTAAGAGCCGAAGCTATAGAACTTTGTTA
GACTATTTGGCAAGCAAAATATATGACAGTAAATATCAGAATTTTATGGTTTGACCAGCGCTTATCACATTCCCAATTCAGTGAGAAAAA
TTCATCTGGGACACAACAGGGTACTCTTCTCTGTTTGCCCAGAATCAGCTCTGGATTTTAAGCCCAGACTTCAGTGGACCCAGATAGAAA
ATATAAAGTCTCTGATCTATAGGCCACATCAGGATGTTATTTTATGAAGAGTTCTAGAGCAAGGTTGCGGAAATCGGGGTGGAGATGGGG
AGCAGTGACTCCTCCAAATATTCATTGCTAACAGGCCATTCTATGCAGTTTGTTTTAACAAATCCTGGGTTAAACTGAGGCCACAGGACA
TGATGGGCTGTTCTATAAAGCATTCTAAGTGGAGAGGAGACGATAGGGCATATGAAATTCACTAAACTCTCTGGAAAAAAAATATGTATA
TATTAAAAACCAAGACTGGAATCAGTGCAACAGTGGGAACTACCTTTTACAAGTATCCATTGCTTCATAAACTCCATTTGTTTGGACCAA
TCCCTTAAACAAAAGCAAGGCAAATTTTACATGGATTTAGAGCCTAGGTCAGGTTATTAGGATTATAAATTTTCCACTGGTATGTCATTG

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_3134nt
CCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCT
TCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCG
GTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAG
TCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAAT
GTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTAT
CAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAA
AAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATAT
TAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTC
AGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGA
AGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAG
GCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAA
GAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTT
CAATTGGAGCACCTAACCTTTTAGCCGTTGGCTATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTC
TGGATAGTAGTGAATCACCTCAAAAACATTTGGGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCA
AAAGAGAAATACTAGTTTCTATATCAGCAGATGGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGAT
TAAAGAGAACTACAGCTGCCAGTAACAAAAAAGGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGT
GTTTTGCTTTTCATCCCAAGGGTCCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGG
GTGTTATTATATGGCAACAGGAGAATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAA
AATCATCCTATATATTTGCAGCTGCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATA
CTGCTAACCCTGGAATCAAGTTCACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTG
TGTATGAACTGAGAAATATGCCTACTGTTTTGGAAACTGGCCGGGGAGATATAATGGATACTTTGCTTGGATCCAAGTCAAACCAATCAG
CATAATTCATCATTCCTAATATTTTTCTTGTAGTTGTTTTAAAAAAGGAATTAACATCCAATATTCTGTATTACATACTGTACACCAGAT
TTTGATTTCAGAAAACAATATTTGATGTATAACTTCCACTTAATTTAAATTTAATAAACTTTTATTTCAGAGATATTTGATTAGTTTACA
ATCTAAGAGTTATTCTTAAGAGTTTCAGTGGAATTTTCTTAATTTTTCTAAAGATATTCCTACTCTCTTGATCATATTCTAAGTACATAT
GAGTACATGTACATTCTTATACAATGTCTAAATGGGTTAGAAAATTATTATACCTATAGAAGCGAAACTTGGAAATTAATAGAATCACTT
AAACCAAAATCTTTATAAGACACAATTCTATTGATTTTAAAGCTTCTGCTTTCCAGGCTCTGTTTTCCAGAGTTTATAATTACGTAGTTT
TTAGTAGATGAAAATAATGGATTCTTGTACCTAACATTTTATCCTCTTAGATCTAAGAGCCGAAGCTATAGAACTTTGTTAGACTATTTG
GCAAGCAAAATATATGACAGTAAATATCAGAATTTTATGGTTTGACCAGCGCTTATCACATTCCCAATTCAGTGAGAAAAATTCATCTGG
GACACAACAGGGTACTCTTCTCTGTTTGCCCAGAATCAGCTCTGGATTTTAAGCCCAGACTTCAGTGGACCCAGATAGAAAATATAAAGT
CTCTGATCTATAGGCCACATCAGGATGTTATTTTATGAAGAGTTCTAGAGCAAGGTTGCGGAAATCGGGGTGGAGATGGGGAGCAGTGAC
TCCTCCAAATATTCATTGCTAACAGGCCATTCTATGCAGTTTGTTTTAACAAATCCTGGGTTAAACTGAGGCCACAGGACATGATGGGCT
GTTCTATAAAGCATTCTAAGTGGAGAGGAGACGATAGGGCATATGAAATTCACTAAACTCTCTGGAAAAAAAATATGTATATATTAAAAA
CCAAGACTGGAATCAGTGCAACAGTGGGAACTACCTTTTACAAGTATCCATTGCTTCATAAACTCCATTTGTTTGGACCAATCCCTTAAA
CAAAAGCAAGGCAAATTTTACATGGATTTAGAGCCTAGGTCAGGTTATTAGGATTATAAATTTTCCACTGGTATGTCATTGTGATTATCT

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_1135nt
CCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCT
TCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCG
GTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAG
TCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAAT
GTGATAAAATCATAATGGAAGATAAAGGCATAATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTAT
CAGTAAAACAATCTGTGGTTGAGTCAAGTAGTAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAA
AAAATAGTGAAACTAGTTCTCTAATGGACATAGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATAT
TAAAATCTGACAAATTTCATCAGGACTTATTTTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTC
AGCTTCCTGTTTTAAAAGAACCTGAACCTGAAGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGA
AGGAGGAGGAAGAAGAAATACATGCAGAAGAATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAG
GCCTCAATGTGAGCAGCCTTGCCTGGAATAAAACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAA
GAGGACTGGCTTGCTGCTGGTCAATAAAGAATCCCATGGTAACCCAAACAAGAATAAGAAGCATTTTTATCTGGCTGTTGACAAAATTCT

>In-frame_VPS37A_ENST00000521829_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_952nt
CCCAGCGCTTGGGCCACGGACGTCCCACCCCGCTCCTCTGTCGCTGGAGAACCGCCGGGCCGAGCCACTGGGAGAAGCAGGCCAGAGCCT
TCCAGGGCCTCCGGCCCGTGGACCCGAGGAGGATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCG
GTGGCCTCACCAGCCTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAG
TCCTTTGTAGAAACAGATTAGGCAATGACCTATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAAT
GTGATAAAATCATAATGGAAGATAAAGGTAATTTCTATCATTCTGCTTGATAAACTATAATGTTCTAATATACATTTTTTGAGTCTGTCA
ATCGACAAGTGAATATTGAAATGTATAAAGCAAAAATAAAAATAATTTGGCCAAACCACAACAGTAGTTGGACACTGTGTTCTATAGCTT
TCAGAATTTGACATGTTAAGTAATAAATATATAGATTTGAATAACATAATTATTCATCTTGGTTTTTATGCATACTATATCATAGAACTT
TATACTCTTTAAACGTTTATATAAACTGATTATTTACTATGTCACAAAGAATATCAGCCATAACTATTAACATTTTAAATGTGTCAGACA
CTATGTCCTTCACATGTATTAACTGGTTTAATTTTTACAGCAACCCTATGAGGTAGATACTATTATGCTTCCCCATTTTATAGATGAGGA
AACAGGCAAAGAGAAGTTTGCTAACTGTTCTGGTTCTAGAGCTTGTGCACTTAACTACTATACTTACCACCTCTCACTGTGTACAAATTA

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371026_chr1_67337192_-_3118nt
GATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCA
GCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCT
ATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCAT
AATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAG
TAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACAT
AGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATT
TTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGA
AGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGA
ATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAA
AACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAA
TCCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGG
CTATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTT
GGGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGA
TGGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAA
AGGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGACACAAATAT
CTATTTGGCTGGCACTGAAGAAGGTCATATTCACAAATGTTCTTGTTCATATAATGAACAATACTTAGATACCTACAGAGGACATAAGGG
TCCAGTGTATAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGA
GAATGTCAAGCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGC
TGCAAATGAGAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTT
CACAACCATTCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCC
TACTGTTTTGGAAACTGGCCGGGGAGATATAATGGATACTTTGCTTGGATCCAAGTCAAACCAATCAGCATAATTCATCATTCCTAATAT
TTTTCTTGTAGTTGTTTTAAAAAAGGAATTAACATCCAATATTCTGTATTACATACTGTACACCAGATTTTGATTTCAGAAAACAATATT
TGATGTATAACTTCCACTTAATTTAAATTTAATAAACTTTTATTTCAGAGATATTTGATTAGTTTACAATCTAAGAGTTATTCTTAAGAG
TTTCAGTGGAATTTTCTTAATTTTTCTAAAGATATTCCTACTCTCTTGATCATATTCTAAGTACATATGAGTACATGTACATTCTTATAC
AATGTCTAAATGGGTTAGAAAATTATTATACCTATAGAAGCGAAACTTGGAAATTAATAGAATCACTTAAACCAAAATCTTTATAAGACA
CAATTCTATTGATTTTAAAGCTTCTGCTTTCCAGGCTCTGTTTTCCAGAGTTTATAATTACGTAGTTTTTAGTAGATGAAAATAATGGAT
TCTTGTACCTAACATTTTATCCTCTTAGATCTAAGAGCCGAAGCTATAGAACTTTGTTAGACTATTTGGCAAGCAAAATATATGACAGTA
AATATCAGAATTTTATGGTTTGACCAGCGCTTATCACATTCCCAATTCAGTGAGAAAAATTCATCTGGGACACAACAGGGTACTCTTCTC
TGTTTGCCCAGAATCAGCTCTGGATTTTAAGCCCAGACTTCAGTGGACCCAGATAGAAAATATAAAGTCTCTGATCTATAGGCCACATCA
GGATGTTATTTTATGAAGAGTTCTAGAGCAAGGTTGCGGAAATCGGGGTGGAGATGGGGAGCAGTGACTCCTCCAAATATTCATTGCTAA
CAGGCCATTCTATGCAGTTTGTTTTAACAAATCCTGGGTTAAACTGAGGCCACAGGACATGATGGGCTGTTCTATAAAGCATTCTAAGTG
GAGAGGAGACGATAGGGCATATGAAATTCACTAAACTCTCTGGAAAAAAAATATGTATATATTAAAAACCAAGACTGGAATCAGTGCAAC
AGTGGGAACTACCTTTTACAAGTATCCATTGCTTCATAAACTCCATTTGTTTGGACCAATCCCTTAAACAAAAGCAAGGCAAATTTTACA
TGGATTTAGAGCCTAGGTCAGGTTATTAGGATTATAAATTTTCCACTGGTATGTCATTGTGATTATCTTTGTTTTTGTCTTTCTGAAAGA

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000431318_chr1_67337192_-_3013nt
GATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCA
GCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCT
ATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCAT
AATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAG
TAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACAT
AGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATT
TTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGA
AGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGA
ATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAA
AACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAA
TCCCATGTGGCCAGAACGTATTTATCAGAGTCCATATGGAGTTACTGCTGTGGATTTTTCAATTGGAGCACCTAACCTTTTAGCCGTTGG
CTATCACAATGGCACAATTGCAATTTACAATGTACGGAGCAACAGTAATGTTCCAGTTCTGGATAGTAGTGAATCACCTCAAAAACATTT
GGGACCTGTATGGCAACTACAGTGGATAGAACAAGATCGAGGAACAACAGGAGATGGCAAAAGAGAAATACTAGTTTCTATATCAGCAGA
TGGAAGAATCTCCAAATGGGTTATACGAAAAGGACTAGACTGTTATGATTTGATGCGATTAAAGAGAACTACAGCTGCCAGTAACAAAAA
AGGAGGGGAAAAGGAAAAGAAAGATGAAGCTTTGATATCTCGACAGGCTCCTGGAATGTGTTTTGCTTTTCATCCCAAGGGTCCAGTGTA
TAAAGTGACATGGAATCCATTTTGTCATGATGTATTTTTAAGCTGTTCTGCAGATTGGGGTGTTATTATATGGCAACAGGAGAATGTCAA
GCCATCTTTGAGTTTTTATCCAGCTACTTCTGTTGTTTACGACGTTGCCTGGTCTCCAAAATCATCCTATATATTTGCAGCTGCAAATGA
GAACAGGGTGGAGATTTGGGACCTTCATATCAGCACTTTGGACCCTCTGATTGTGAATACTGCTAACCCTGGAATCAAGTTCACAACCAT
TCTCTTTGCCAAACAAACAGATTGCCTTCTGGTAGGAGACAGTGATGGACAGGTTTCTGTGTATGAACTGAGAAATATGCCTACTGTTTT
GGAAACTGGCCGGGGAGATATAATGGATACTTTGCTTGGATCCAAGTCAAACCAATCAGCATAATTCATCATTCCTAATATTTTTCTTGT
AGTTGTTTTAAAAAAGGAATTAACATCCAATATTCTGTATTACATACTGTACACCAGATTTTGATTTCAGAAAACAATATTTGATGTATA
ACTTCCACTTAATTTAAATTTAATAAACTTTTATTTCAGAGATATTTGATTAGTTTACAATCTAAGAGTTATTCTTAAGAGTTTCAGTGG
AATTTTCTTAATTTTTCTAAAGATATTCCTACTCTCTTGATCATATTCTAAGTACATATGAGTACATGTACATTCTTATACAATGTCTAA
ATGGGTTAGAAAATTATTATACCTATAGAAGCGAAACTTGGAAATTAATAGAATCACTTAAACCAAAATCTTTATAAGACACAATTCTAT
TGATTTTAAAGCTTCTGCTTTCCAGGCTCTGTTTTCCAGAGTTTATAATTACGTAGTTTTTAGTAGATGAAAATAATGGATTCTTGTACC
TAACATTTTATCCTCTTAGATCTAAGAGCCGAAGCTATAGAACTTTGTTAGACTATTTGGCAAGCAAAATATATGACAGTAAATATCAGA
ATTTTATGGTTTGACCAGCGCTTATCACATTCCCAATTCAGTGAGAAAAATTCATCTGGGACACAACAGGGTACTCTTCTCTGTTTGCCC
AGAATCAGCTCTGGATTTTAAGCCCAGACTTCAGTGGACCCAGATAGAAAATATAAAGTCTCTGATCTATAGGCCACATCAGGATGTTAT
TTTATGAAGAGTTCTAGAGCAAGGTTGCGGAAATCGGGGTGGAGATGGGGAGCAGTGACTCCTCCAAATATTCATTGCTAACAGGCCATT
CTATGCAGTTTGTTTTAACAAATCCTGGGTTAAACTGAGGCCACAGGACATGATGGGCTGTTCTATAAAGCATTCTAAGTGGAGAGGAGA
CGATAGGGCATATGAAATTCACTAAACTCTCTGGAAAAAAAATATGTATATATTAAAAACCAAGACTGGAATCAGTGCAACAGTGGGAAC
TACCTTTTACAAGTATCCATTGCTTCATAAACTCCATTTGTTTGGACCAATCCCTTAAACAAAAGCAAGGCAAATTTTACATGGATTTAG
AGCCTAGGTCAGGTTATTAGGATTATAAATTTTCCACTGGTATGTCATTGTGATTATCTTTGTTTTTGTCTTTCTGAAAGATTGGATTTT

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371023_chr1_67337192_-_1014nt
GATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCA
GCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCT
ATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGCAT
AATGTCCACTGCCTGGGATTTGTATGATTCTTACAATGCTATGGAACTTGTATCTTTATCAGTAAAACAATCTGTGGTTGAGTCAAGTAG
TAAAGCAAATGTACTTCCTAAAGATCAGGACCAAAGATTGCCAGGGAGCACTACAGAAAAAAATAGTGAAACTAGTTCTCTAATGGACAT
AGAAAATGTAATTCTGGCAAAAATCCATGAAGATGAGGAAGACCACTCAGATGCAATATTAAAATCTGACAAATTTCATCAGGACTTATT
TTTTATGGAACGGGTTCTGATGGAAAATATATTTCAGCCCAAACTTGCAGCTTATCGTCAGCTTCCTGTTTTAAAAGAACCTGAACCTGA
AGAGCCTGAAGATGTTTTAGAAAGTGCAAAACATGAAGAGGTAGAGGAAGAATCTAAGAAGGAGGAGGAAGAAGAAATACATGCAGAAGA
ATCAACAATACCCGCCAACTTGGAACGACTTTGGTCTTTTTCCTGTGACTTAACCAAAGGCCTCAATGTGAGCAGCCTTGCCTGGAATAA
AACAAATCCAGATCTTTTGGCTGTTGGCTATGGGCACTTTGGATTTAAAGAGCAAAAAAGAGGACTGGCTTGCTGCTGGTCAATAAAGAA
TCCCATGGTAACCCAAACAAGAATAAGAAGCATTTTTATCTGGCTGTTGACAAAATTCTCATAAAATATATAATTACATGTAATAATTAA

>In-frame_VPS37A_ENST00000521005_chr8_17104878_+_WDR78_ENST00000371022_chr1_67337192_-_831nt
GATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCAGCCTCCAGCAGCAGAAGCA
GCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGTCAGAGAAACAAGAATTATGAAGTCCTTTGTAGAAACAGATTAGGCAATGACCT
ATATGTTGAAAGGATGATGCAGACTTTCAATGGAGCACCAAAGAATAAAGATGTTCAATGTGATAAAATCATAATGGAAGATAAAGGTAA
TTTCTATCATTCTGCTTGATAAACTATAATGTTCTAATATACATTTTTTGAGTCTGTCAATCGACAAGTGAATATTGAAATGTATAAAGC
AAAAATAAAAATAATTTGGCCAAACCACAACAGTAGTTGGACACTGTGTTCTATAGCTTTCAGAATTTGACATGTTAAGTAATAAATATA
TAGATTTGAATAACATAATTATTCATCTTGGTTTTTATGCATACTATATCATAGAACTTTATACTCTTTAAACGTTTATATAAACTGATT
ATTTACTATGTCACAAAGAATATCAGCCATAACTATTAACATTTTAAATGTGTCAGACACTATGTCCTTCACATGTATTAACTGGTTTAA
TTTTTACAGCAACCCTATGAGGTAGATACTATTATGCTTCCCCATTTTATAGATGAGGAAACAGGCAAAGAGAAGTTTGCTAACTGTTCT
GGTTCTAGAGCTTGTGCACTTAACTACTATACTTACCACCTCTCACTGTGTACAAATTAACAACCCTGAGCACATTGCATAGCCAAAATC


Top

FusionGenePPI for VPS37A_WDR78


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VPS37ATSG101, VPS28, MVB12A, MVB12B, ALG2, UBAP1, APP, KDM1A, TRIM42, ARRDC1, XPO1, UBCWDR78


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VPS37A_WDR78


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VPS37A_WDR78


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneVPS37AC3539494SPASTIC PARAPLEGIA 53, AUTOSOMAL RECESSIVE1ORPHANET;UNIPROT