FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41497

FusionGeneSummary for VMP1_RNFT1

check button Fusion gene summary
Fusion gene informationFusion gene name: VMP1_RNFT1
Fusion gene ID: 41497
HgeneTgene
Gene symbol

VMP1

RNFT1

Gene ID

81671

51136

Gene namevacuole membrane protein 1ring finger protein, transmembrane 1
SynonymsEPG3|TANGO5|TMEM49PTD016
Cytomap

17q23.1

17q23.1

Type of geneprotein-codingprotein-coding
Descriptionvacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homologE3 ubiquitin-protein ligase RNFT1RING finger and transmembrane domain-containing protein 1
Modification date2018052320180519
UniProtAcc

Q96GC9

Q5M7Z0

Ensembl transtripts involved in fusion geneENST00000262291, ENST00000537567, 
ENST00000539763, ENST00000536180, 
ENST00000545362, ENST00000588617, 
ENST00000305783, ENST00000442346, 
Fusion gene scores* DoF score19 X 10 X 9=17105 X 3 X 4=60
# samples 186
** MAII scorelog2(18/1710*10)=-3.24792751344359
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/60*10)=0
Context

PubMed: VMP1 [Title/Abstract] AND RNFT1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A2-A1FW-01AVMP1chr17

57851246

+RNFT1chr17

58031507

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262291ENST00000305783VMP1chr17

57851246

+RNFT1chr17

58031507

-
5CDS-3UTRENST00000262291ENST00000442346VMP1chr17

57851246

+RNFT1chr17

58031507

-
In-frameENST00000537567ENST00000305783VMP1chr17

57851246

+RNFT1chr17

58031507

-
5CDS-3UTRENST00000537567ENST00000442346VMP1chr17

57851246

+RNFT1chr17

58031507

-
In-frameENST00000539763ENST00000305783VMP1chr17

57851246

+RNFT1chr17

58031507

-
5CDS-3UTRENST00000539763ENST00000442346VMP1chr17

57851246

+RNFT1chr17

58031507

-
In-frameENST00000536180ENST00000305783VMP1chr17

57851246

+RNFT1chr17

58031507

-
5CDS-3UTRENST00000536180ENST00000442346VMP1chr17

57851246

+RNFT1chr17

58031507

-
In-frameENST00000545362ENST00000305783VMP1chr17

57851246

+RNFT1chr17

58031507

-
5CDS-3UTRENST00000545362ENST00000442346VMP1chr17

57851246

+RNFT1chr17

58031507

-
intron-3CDSENST00000588617ENST00000305783VMP1chr17

57851246

+RNFT1chr17

58031507

-
intron-3UTRENST00000588617ENST00000442346VMP1chr17

57851246

+RNFT1chr17

58031507

-

Top

FusionProtFeatures for VMP1_RNFT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VMP1

Q96GC9

RNFT1

Q5M7Z0

Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}. E3 ubiquitin-protein ligase that acts in the endoplasmicreticulum (ER)-associated degradation (ERAD) pathway, whichtargets misfolded proteins that accumulate in the endoplasmicreticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation. Protects cells from ER stress-inducedapoptosis. {ECO:0000269|PubMed:27485036}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+7122_43238407Topological domainCytoplasmic
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+71265_77238407Topological domainExtracellular
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+71299_109238407Topological domainCytoplasmic
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712110_130238407TransmembraneHelical
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+71244_64238407TransmembraneHelical
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+71278_98238407TransmembraneHelical
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69368_419357436RegionRequired for ubiquitin ligase activity and for protection against ER stress-induced cell death
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69375_413357436Zinc fingerRING-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712131_250238407Topological domainExtracellular
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712272_273238407Topological domainCytoplasmic
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712295_305238407Topological domainExtracellular
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712327_363238407Topological domainCytoplasmic
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712385_406238407Topological domainExtracellular
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712251_271238407TransmembraneHelical
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712274_294238407TransmembraneHelical
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712306_326238407TransmembraneHelical
HgeneVMP1chr17:57851246chr17:58031507ENST00000262291+712364_384238407TransmembraneHelical
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69158_178357436TransmembraneHelical
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69203_223357436TransmembraneHelical
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69233_253357436TransmembraneHelical
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69256_276357436TransmembraneHelical
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69298_318357436TransmembraneHelical
TgeneRNFT1chr17:57851246chr17:58031507ENST00000305783-69323_343357436TransmembraneHelical


Top

FusionGeneSequence for VMP1_RNFT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VMP1_ENST00000262291_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_317aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAESAQSTGVAASKRQCSDVDDICSICQAEFQKPILLI

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_183aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEET
QEFEEMLEHAESAQSTGVAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTLWFNREKTCPLCRTVISDHINKWKDGATSSHLQ

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_125aa
MWGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAESAQSTGVAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTL

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_220aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAESAQSTGVAASKRQCSDVDDICSICQAEFQKPILLICQHIFCE

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_261aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAES


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VMP1_ENST00000262291_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_951nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGA
GCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAAGTTAT
GGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTGGATGATATTTGTTCAATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATT
TGTCAGCATATATTTTGTGAAGAGTGCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCAT

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_549nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTAT
CAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAAGTTATGGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTGGATGAT
ATTTGTTCAATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATTTGTCAGCATATATTTTGTGAAGAGTGCATGACCTTATGGTTT
AACAGAGAGAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCATATAAACAAATGGAAGGATGGAGCCACTTCATCACACCTTCAA

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_375nt
ATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAA
GAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAAGTTATGGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTG
GATGATATTTGTTCAATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATTTGTCAGCATATATTTTGTGAAGAGTGCATGACCTTA
TGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCATATAAACAAATGGAAGGATGGAGCCACTTCATCACAC

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_660nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCT
GAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAAGTTATGGAGTGGCTGCCAGCAAGAGA
CAGTGTTCAGATGTGGATGATATTTGTTCAATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATTTGTCAGCATATATTTTGTGAA
GAGTGCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCATATAAACAAATGGAAGGATGGA

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_783nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATAT
TTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCT
GCACAAAGTTATGGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTGGATGATATTTGTTCAATATGTCAAGCTGAATTTCAGAAGCCA
ATTCTTCTCATTTGTCAGCATATATTTTGTGAAGAGTGCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACTGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_VMP1_ENST00000262291_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_1998nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGG
TACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATT
TGAAGAGATGCTGGAACATGCAGAGTCTGCACAAAGTTATGGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTGGATGATATTTGTTC
AATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATTTGTCAGCATATATTTTGTGAAGAGTGCATGACCTTATGGTTTAACAGAGA
GAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCATATAAACAAATGGAAGGATGGAGCCACTTCATCACACCTTCAAATATATTA
AGTTGTATAAACTATCAAGGCCACAAAATACTAATGTCATTTGGTCATAATGACTACTGATAAGGCATCAGAATGGATTTTCAGGGCTAC
CAGAAAAATGTTTCCAGATGGTTTTAGAATGTAGGACTTATGATCCAATTCACCAAAAGATTAAATGAAACCACCCTGTGTTTTAAAATA
TATATAATGTTCAACCTAATGTATATGCAACATTTATTCTATTCTAATTATTTGACAGGTAACTGCAGTGTTAAATTGTAAATGTGTTTT
CTTTATGTTACCAAAACAGCAATTTGAAATTAGAACTAGTGGTTTTAGAGAACTCAGGTATTCTTTCCTGACATTGTTTTCAGAATAAAG
AATATTTTTCATAATATTTTAAGATACATACTATCTAAAAGTAGAATTTTGTTCAGCATTGACTTTTATAATTCCCATCCTAAAAATTCT
TAATATTTTCATAAAATTTGTATTTTTAAATGAAAATTCTAAATGTTGTATTTTATCAGTAACATTTTCTAAGTGAAGATTAATTTACTG
AGGATGATACATTATAGTATTGTATTATTCTCTGTAGTAAGATTAGTAATAAGTGAAAATAAATGATTTAAATTCATTTTGTCTCTGGAC
GTCATAAATTCTTCCTGCCATCAGCTTTAATGTTCATGATCATGCTTTTTGTATAGTACCATGGAGTATCTCGAAGTAACTATTAAAATA

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_1613nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCA
TATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAG
TCTGCACAAAGTTATGGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTGGATGATATTTGTTCAATATGTCAAGCTGAATTTCAGAAG
CCAATTCTTCTCATTTGTCAGCATATATTTTGTGAAGAGTGCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACT
GTGATTTCAGACCATATAAACAAATGGAAGGATGGAGCCACTTCATCACACCTTCAAATATATTAAGTTGTATAAACTATCAAGGCCACA
AAATACTAATGTCATTTGGTCATAATGACTACTGATAAGGCATCAGAATGGATTTTCAGGGCTACCAGAAAAATGTTTCCAGATGGTTTT
AGAATGTAGGACTTATGATCCAATTCACCAAAAGATTAAATGAAACCACCCTGTGTTTTAAAATATATATAATGTTCAACCTAATGTATA
TGCAACATTTATTCTATTCTAATTATTTGACAGGTAACTGCAGTGTTAAATTGTAAATGTGTTTTCTTTATGTTACCAAAACAGCAATTT
GAAATTAGAACTAGTGGTTTTAGAGAACTCAGGTATTCTTTCCTGACATTGTTTTCAGAATAAAGAATATTTTTCATAATATTTTAAGAT
ACATACTATCTAAAAGTAGAATTTTGTTCAGCATTGACTTTTATAATTCCCATCCTAAAAATTCTTAATATTTTCATAAAATTTGTATTT
TTAAATGAAAATTCTAAATGTTGTATTTTATCAGTAACATTTTCTAAGTGAAGATTAATTTACTGAGGATGATACATTATAGTATTGTAT
TATTCTCTGTAGTAAGATTAGTAATAAGTGAAAATAAATGATTTAAATTCATTTTGTCTCTGGACGTCATAAATTCTTCCTGCCATCAGC

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_1677nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCT
CTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAAGTTATGGAGTGGCTGC
CAGCAAGAGACAGTGTTCAGATGTGGATGATATTTGTTCAATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATTTGTCAGCATAT
ATTTTGTGAAGAGTGCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCATATAAACAAATG
GAAGGATGGAGCCACTTCATCACACCTTCAAATATATTAAGTTGTATAAACTATCAAGGCCACAAAATACTAATGTCATTTGGTCATAAT
GACTACTGATAAGGCATCAGAATGGATTTTCAGGGCTACCAGAAAAATGTTTCCAGATGGTTTTAGAATGTAGGACTTATGATCCAATTC
ACCAAAAGATTAAATGAAACCACCCTGTGTTTTAAAATATATATAATGTTCAACCTAATGTATATGCAACATTTATTCTATTCTAATTAT
TTGACAGGTAACTGCAGTGTTAAATTGTAAATGTGTTTTCTTTATGTTACCAAAACAGCAATTTGAAATTAGAACTAGTGGTTTTAGAGA
ACTCAGGTATTCTTTCCTGACATTGTTTTCAGAATAAAGAATATTTTTCATAATATTTTAAGATACATACTATCTAAAAGTAGAATTTTG
TTCAGCATTGACTTTTATAATTCCCATCCTAAAAATTCTTAATATTTTCATAAAATTTGTATTTTTAAATGAAAATTCTAAATGTTGTAT
TTTATCAGTAACATTTTCTAAGTGAAGATTAATTTACTGAGGATGATACATTATAGTATTGTATTATTCTCTGTAGTAAGATTAGTAATA
AGTGAAAATAAATGATTTAAATTCATTTTGTCTCTGGACGTCATAAATTCTTCCTGCCATCAGCTTTAATGTTCATGATCATGCTTTTTG

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_1707nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCC
TCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGC
AGAGTCTGCACAAAGTTATGGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTGGATGATATTTGTTCAATATGTCAAGCTGAATTTCA
GAAGCCAATTCTTCTCATTTGTCAGCATATATTTTGTGAAGAGTGCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAG
AACTGTGATTTCAGACCATATAAACAAATGGAAGGATGGAGCCACTTCATCACACCTTCAAATATATTAAGTTGTATAAACTATCAAGGC
CACAAAATACTAATGTCATTTGGTCATAATGACTACTGATAAGGCATCAGAATGGATTTTCAGGGCTACCAGAAAAATGTTTCCAGATGG
TTTTAGAATGTAGGACTTATGATCCAATTCACCAAAAGATTAAATGAAACCACCCTGTGTTTTAAAATATATATAATGTTCAACCTAATG
TATATGCAACATTTATTCTATTCTAATTATTTGACAGGTAACTGCAGTGTTAAATTGTAAATGTGTTTTCTTTATGTTACCAAAACAGCA
ATTTGAAATTAGAACTAGTGGTTTTAGAGAACTCAGGTATTCTTTCCTGACATTGTTTTCAGAATAAAGAATATTTTTCATAATATTTTA
AGATACATACTATCTAAAAGTAGAATTTTGTTCAGCATTGACTTTTATAATTCCCATCCTAAAAATTCTTAATATTTTCATAAAATTTGT
ATTTTTAAATGAAAATTCTAAATGTTGTATTTTATCAGTAACATTTTCTAAGTGAAGATTAATTTACTGAGGATGATACATTATAGTATT
GTATTATTCTCTGTAGTAAGATTAGTAATAAGTGAAAATAAATGATTTAAATTCATTTTGTCTCTGGACGTCATAAATTCTTCCTGCCAT

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_RNFT1_ENST00000305783_chr17_58031507_-_1573nt
GATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTG
TAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGA
ATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTAT
GGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATG
TGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACA
CCTTTCTGCTTTATCTGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAAC
CAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAAGTTATGGAGTGGCTGCCAGCAAGAGACAGT
GTTCAGATGTGGATGATATTTGTTCAATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATTTGTCAGCATATATTTTGTGAAGAGT
GCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCATATAAACAAATGGAAGGATGGAGCCA
CTTCATCACACCTTCAAATATATTAAGTTGTATAAACTATCAAGGCCACAAAATACTAATGTCATTTGGTCATAATGACTACTGATAAGG
CATCAGAATGGATTTTCAGGGCTACCAGAAAAATGTTTCCAGATGGTTTTAGAATGTAGGACTTATGATCCAATTCACCAAAAGATTAAA
TGAAACCACCCTGTGTTTTAAAATATATATAATGTTCAACCTAATGTATATGCAACATTTATTCTATTCTAATTATTTGACAGGTAACTG
CAGTGTTAAATTGTAAATGTGTTTTCTTTATGTTACCAAAACAGCAATTTGAAATTAGAACTAGTGGTTTTAGAGAACTCAGGTATTCTT
TCCTGACATTGTTTTCAGAATAAAGAATATTTTTCATAATATTTTAAGATACATACTATCTAAAAGTAGAATTTTGTTCAGCATTGACTT
TTATAATTCCCATCCTAAAAATTCTTAATATTTTCATAAAATTTGTATTTTTAAATGAAAATTCTAAATGTTGTATTTTATCAGTAACAT
TTTCTAAGTGAAGATTAATTTACTGAGGATGATACATTATAGTATTGTATTATTCTCTGTAGTAAGATTAGTAATAAGTGAAAATAAATG
ATTTAAATTCATTTTGTCTCTGGACGTCATAAATTCTTCCTGCCATCAGCTTTAATGTTCATGATCATGCTTTTTGTATAGTACCATGGA


Top

FusionGenePPI for VMP1_RNFT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNARNFT1UBE2U, NXF1, KRAS, IL17RB, REEP5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VMP1_RNFT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VMP1_RNFT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource