FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41485

FusionGeneSummary for VMP1_BCAS3

check button Fusion gene summary
Fusion gene informationFusion gene name: VMP1_BCAS3
Fusion gene ID: 41485
HgeneTgene
Gene symbol

VMP1

BCAS3

Gene ID

81671

54828

Gene namevacuole membrane protein 1BCAS3, microtubule associated cell migration factor
SynonymsEPG3|TANGO5|TMEM49GAOB1|MAAB
Cytomap

17q23.1

17q23.2

Type of geneprotein-codingprotein-coding
Descriptionvacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homologbreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab1
Modification date2018052320180523
UniProtAcc

Q96GC9

Q9H6U6

Ensembl transtripts involved in fusion geneENST00000262291, ENST00000537567, 
ENST00000539763, ENST00000536180, 
ENST00000545362, ENST00000588617, 
ENST00000589222, ENST00000407086, 
ENST00000390652, ENST00000408905, 
ENST00000588462, ENST00000585744, 
ENST00000588874, ENST00000585812, 
Fusion gene scores* DoF score19 X 10 X 9=171026 X 15 X 15=5850
# samples 1841
** MAII scorelog2(18/1710*10)=-3.24792751344359
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(41/5850*10)=-3.83474080985268
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VMP1 [Title/Abstract] AND BCAS3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

TgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

TgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-EY-A4KR-01AVMP1chr17

57842499

+BCAS3chr17

59001768

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262291ENST00000589222VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000262291ENST00000407086VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000262291ENST00000390652VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000262291ENST00000408905VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000262291ENST00000588462VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000262291ENST00000585744VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000262291ENST00000588874VMP1chr17

57842499

+BCAS3chr17

59001768

+
5CDS-intronENST00000262291ENST00000585812VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000537567ENST00000589222VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000537567ENST00000407086VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000537567ENST00000390652VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000537567ENST00000408905VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000537567ENST00000588462VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000537567ENST00000585744VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000537567ENST00000588874VMP1chr17

57842499

+BCAS3chr17

59001768

+
5CDS-intronENST00000537567ENST00000585812VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000539763ENST00000589222VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000539763ENST00000407086VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000539763ENST00000390652VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000539763ENST00000408905VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000539763ENST00000588462VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000539763ENST00000585744VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000539763ENST00000588874VMP1chr17

57842499

+BCAS3chr17

59001768

+
5CDS-intronENST00000539763ENST00000585812VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000536180ENST00000589222VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000536180ENST00000407086VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000536180ENST00000390652VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000536180ENST00000408905VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000536180ENST00000588462VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000536180ENST00000585744VMP1chr17

57842499

+BCAS3chr17

59001768

+
In-frameENST00000536180ENST00000588874VMP1chr17

57842499

+BCAS3chr17

59001768

+
5CDS-intronENST00000536180ENST00000585812VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000545362ENST00000589222VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000545362ENST00000407086VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000545362ENST00000390652VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000545362ENST00000408905VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000545362ENST00000588462VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000545362ENST00000585744VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000545362ENST00000588874VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-intronENST00000545362ENST00000585812VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000588617ENST00000589222VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000588617ENST00000407086VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000588617ENST00000390652VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000588617ENST00000408905VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000588617ENST00000588462VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000588617ENST00000585744VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-3CDSENST00000588617ENST00000588874VMP1chr17

57842499

+BCAS3chr17

59001768

+
intron-intronENST00000588617ENST00000585812VMP1chr17

57842499

+BCAS3chr17

59001768

+

Top

FusionProtFeatures for VMP1_BCAS3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VMP1

Q96GC9

BCAS3

Q9H6U6

Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+6122_43194407Topological domainCytoplasmic
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+61265_77194407Topological domainExtracellular
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+61299_109194407Topological domainCytoplasmic
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612110_130194407TransmembraneHelical
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+61244_64194407TransmembraneHelical
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+61278_98194407TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612131_250194407Topological domainExtracellular
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612272_273194407Topological domainCytoplasmic
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612295_305194407Topological domainExtracellular
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612327_363194407Topological domainCytoplasmic
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612385_406194407Topological domainExtracellular
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612251_271194407TransmembraneHelical
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612274_294194407TransmembraneHelical
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612306_326194407TransmembraneHelical
HgeneVMP1chr17:57842499chr17:59001768ENST00000262291+612364_384194407TransmembraneHelical


Top

FusionGeneSequence for VMP1_BCAS3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_792aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAK
VQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGK
LNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREK
DQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGL
VPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDT
DDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSR

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_777aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAK
VQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGK
LNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREK
DQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGL
VPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDT
DDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSR

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_792aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAK
VQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGK
LNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGT
SRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLL
AADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQS
HGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEG

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_799aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAK
VQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGK
LNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREK
DQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGL
VPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDT
DDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSR

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_814aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAK
VQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGK
LNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGT
SRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLL
AADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQS
HGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEG
LRERLADAMAESPSRDVVGSGTDTALDVAVKTFPPERHVAVKCFELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPT

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_792aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAK
VQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGK
LNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGT
SRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLL
AADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQS
HGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEG

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_777aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL
WSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAK
VQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGK
LNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREK
DQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGL
VPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDT
DDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSR

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_658aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNT
SGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRV
VNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTI
TKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEM
MTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHR
RLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTF
DRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALDVAVKTFPPERHVAVKCFGKKKGKKKQCQQPSV

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_643aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNT
SGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRV
VNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTI
TKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEM
MTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHR
RLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTF
DRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNE

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_658aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNT
SGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRV
VNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTI
TKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRP
LSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEE
WLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSD
RRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSI

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_665aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNT
SGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRV
VNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTI
TKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEM
MTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHR
RLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTF
DRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALDVAVKTFPPERHVAVKCFELQREGSIETLSNSS

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_680aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNT
SGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRV
VNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTI
TKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRP
LSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEE
WLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSD
RRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALDVAVKTFPPERHVAVKCF

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_658aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNT
SGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRV
VNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTI
TKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRP
LSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEE
WLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSD
RRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSI

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_643aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNT
SGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRV
VNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTI
TKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEM
MTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHR
RLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTF
DRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNE

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_600aa
MWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRW
VVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTN
NNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLY
IISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRH
GSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQP
VRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALD

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_585aa
MWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRW
VVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTN
NNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLY
IISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRH
GSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQP
VRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQRE

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_600aa
MWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRW
VVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTN
NNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLK
REKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLL
AGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLD
FDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAES

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_607aa
MWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRW
VVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTN
NNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLY
IISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRH
GSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQP
VRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTALD

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_622aa
MWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRW
VVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTN
NNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLK
REKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLL
AGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLD
FDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAES

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_600aa
MWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRW
VVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTN
NNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLK
REKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLL
AGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLD
FDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAES

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_585aa
MWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRW
VVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTN
NNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLY
IISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRH
GSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQP
VRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQRE

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_695aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFS
HDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDST
NNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVV
VESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPG
PITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNS
LRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGT

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_680aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFS
HDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDST
NNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVV
VESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPG
PITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNS
LRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGT

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_695aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFS
HDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDST
NNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFAN
NAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQT
TQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTP
QPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLAD

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_702aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFS
HDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDST
NNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVV
VESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPG
PITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNS
LRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGT

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_717aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFS
HDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDST
NNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFAN
NAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQT
TQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTP
QPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLAD

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_695aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFS
HDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDST
NNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFAN
NAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQT
TQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTP
QPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLAD

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_680aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV
RIEACMWVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFS
HDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDST
NNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVV
VESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPG
PITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNS
LRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_2376nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTC
CCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCAT
GTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAA
GTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTAT
GGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATT
GAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAA
CTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATG
CCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGC
AAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAA
GATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTC
AGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGG
AATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTG
GTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGG
CTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCA
GGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACA
GATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGA
AGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGC
TTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGG
GACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGG
AAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGA

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_2331nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTC
CCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCAT
GTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAA
GTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTAT
GGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATT
GAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAA
CTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATG
CCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGC
AAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAA
GATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTC
AGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGG
AATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTG
GTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGG
CTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCA
GGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACA
GATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGA
AGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGC
TTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGG
GACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCA

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_2376nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTC
CCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCAT
GTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAA
GTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTAT
GGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATT
GAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAA
CTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATG
CCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATA
AAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACA
TCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGT
TGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATG
ACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTC
GCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTAC
GACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGT
CTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCT
CATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCT
GACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGAC
AGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGC
CTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATC
GAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGC

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_2397nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTC
CCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCAT
GTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAA
GTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTAT
GGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATT
GAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAA
CTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATG
CCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGC
AAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAA
GATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTC
AGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGG
AATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTG
GTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGG
CTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCA
GGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACA
GATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGA
AGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGC
TTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGG
GACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAA
CTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCT

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_2442nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTC
CCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCAT
GTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAA
GTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTAT
GGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATT
GAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAA
CTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATG
CCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATA
AAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACA
TCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGT
TGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATG
ACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTC
GCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTAC
GACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGT
CTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCT
CATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCT
GACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGAC
AGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGC
CTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTA
AAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGC
TCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACT

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_2376nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTC
CCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCAT
GTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAA
GTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTAT
GGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATT
GAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAA
CTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATG
CCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATA
AAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACA
TCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGT
TGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATG
ACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTC
GCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTAC
GACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGT
CTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCT
CATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCT
GACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGAC
AGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGC
CTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATC
GAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGC

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_2331nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTC
CCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCAT
GTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAA
GTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTAT
GGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATT
GAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAA
CTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATG
CCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGC
AAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAA
GATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTC
AGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGG
AATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTG
GTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGG
CTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCA
GGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACA
GATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGA
AGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGC
TTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGG
GACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCA

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_1974nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACA
AGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGT
GCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTG
GTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTA
GTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCT
GTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAAC
CCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATC
ACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGA
ACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATC
AGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATG
ATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTC
CTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCT
TACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGA
CGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAG
TCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGC
TCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTT
GACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAG
GGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCA
GTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTC

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_1929nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACA
AGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGT
GCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTG
GTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTA
GTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCT
GTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAAC
CCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATC
ACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGA
ACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATC
AGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATG
ATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTC
CTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCT
TACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGA
CGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAG
TCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGC
TCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTT
GACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAG
GGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGC
ATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAG

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_1974nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACA
AGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGT
GCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTG
GTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTA
GTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCT
GTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAAC
CCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATC
ACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCC
AGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAA
AAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCC
CTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAA
TGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGC
CTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAA
TGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCC
TCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGAT
ACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGAT
CGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAG
GGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGC
CGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATA

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_1995nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACA
AGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGT
GCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTG
GTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTA
GTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCT
GTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAAC
CCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATC
ACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGA
ACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATC
AGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATG
ATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTC
CTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCT
TACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGA
CGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAG
TCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGC
TCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTT
GACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAG
GGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCA
GTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCA
GGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCG

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_2040nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACA
AGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGT
GCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTG
GTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTA
GTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCT
GTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAAC
CCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATC
ACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCC
AGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAA
AAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCC
CTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAA
TGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGC
CTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAA
TGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCC
TCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGAT
ACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGAT
CGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAG
GGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGC
CGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTT
GAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGA

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_1974nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACA
AGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGT
GCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTG
GTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTA
GTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCT
GTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAAC
CCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATC
ACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCC
AGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAA
AAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCC
CTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAA
TGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGC
CTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAA
TGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCC
TCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGAT
ACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGAT
CGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAG
GGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGC
CGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATA

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_1929nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACA
AGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGT
GCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTG
GTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTA
GTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCT
GTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAAC
CCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATC
ACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGA
ACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATC
AGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATG
ATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTC
CTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCT
TACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGA
CGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAG
TCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGC
TCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTT
GACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAG
GGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGC
ATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAG

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_1800nt
ATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTT
AATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCA
CAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGG
GTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCA
CGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGT
AGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAAC
AACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGG
ACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATC
TTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTAC
ATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTG
GAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCT
CTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACAT
GGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCC
CATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTG
TTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCA
GTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGAC
GTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCC
AGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAA

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_1755nt
ATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTT
AATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCA
CAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGG
GTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCA
CGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGT
AGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAAC
AACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGG
ACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATC
TTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTAC
ATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTG
GAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCT
CTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACAT
GGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCC
CATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTG
TTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCA
GTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_1800nt
ATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTT
AATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCA
CAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGG
GTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCA
CGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGT
AGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAAC
AACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGG
ACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGG
CCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCA
CCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGC
AGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAG

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_1821nt
ATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTT
AATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCA
CAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGG
GTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCA
CGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGT
AGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAAC
AACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGG
ACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATC
TTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTAC
ATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTG
GAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCT
CTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACAT
GGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCC
CATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTG
TTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCA
GTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGAC
GTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAAC
AGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTC

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_1866nt
ATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTT
AATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCA
CAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGG
GTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCA
CGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGT
AGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAAC
AACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGG
ACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGG
CCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCA
CCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAG
TGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGC

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_1800nt
ATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTT
AATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCA
CAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGG
GTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCA
CGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGT
AGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAAC
AACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGG
ACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGG
CCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCA
CCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGC
AGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAG

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_1755nt
ATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTT
AATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCA
CAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGG
GTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCA
CGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGT
AGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAAC
AACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGG
ACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATC
TTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTAC
ATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTG
GAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCT
CTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACAT
GGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCC
CATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTG
TTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCA
GTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGT
ACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACG
GAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAG
GGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACC

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_2085nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTG
TGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCAT
CCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGC
CATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGT
ACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAG
CAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTAT
AACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAG
CCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTT
TGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTA
GTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGT
GACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTT
AATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGG
CCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTA
ACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCA
TCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGT
CTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATT
GATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCC
TCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACA
GACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAA
CAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCAT

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_2040nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTG
TGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCAT
CCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGC
CATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGT
ACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAG
CAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTAT
AACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAG
CCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTT
TGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTA
GTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGT
GACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTT
AATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGG
CCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTA
ACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCA
TCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGT
CTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATT
GATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCC
TCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACA
GAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGA

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_2085nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTG
TGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCAT
CCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGC
CATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGT
ACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAG
CAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTAT
AACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAG
CCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAA
CCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAAT
AATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAA
CACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGG
ACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTAT
TATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCAT
AGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTC
CAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCA
CAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGG
TCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCA
GGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCG

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_2106nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTG
TGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCAT
CCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGC
CATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGT
ACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAG
CAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTAT
AACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAG
CCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTT
TGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTA
GTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGT
GACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTT
AATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGG
CCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTA
ACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCA
TCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGT
CTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATT
GATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCC
TCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACA
GACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATC
GAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGC

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_2151nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTG
TGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCAT
CCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGC
CATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGT
ACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAG
CAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTAT
AACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAG
CCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAA
CCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAAT
AATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAA
CACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGG
ACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTAT
TATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCAT
AGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTC
CAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCA
CAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGG
TCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGA
CACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCA

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_2085nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTG
TGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCAT
CCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGC
CATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGT
ACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAG
CAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTAT
AACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAG
CCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAA
CCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAAT
AATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAA
CACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGG
ACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTAT
TATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCAT
AGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTC
CAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCA
CAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGG
TCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAG
GTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGAC
GCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCA
GGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCG

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_2040nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTG
TGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCAT
CCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGC
CATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGT
ACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAG
CAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTAT
AACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAG
CCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTT
TGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTA
GTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGT
GACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTT
AATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGG
CCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTA
ACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCA
TCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGT
CTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATT
GATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCC
TCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACA
GAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_3504nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGT
GAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAAT
GCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCA
CCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTAC
TCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCG
CATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGG
TCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAA
CCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACG
AACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAG
GTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTA
TGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATC
GCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGC
AGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAG
TTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTG
GATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGG
TCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCC
CGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAG
CGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCG
GGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAAC
CTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCA
ACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCA
CCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCT
TCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAG
TCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAG
CACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCA
TATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCT
GGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGA
CACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGAC
ATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACT

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_3347nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGT
GAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAAT
GCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCA
CCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTAC
TCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCG
CATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGG
TCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAA
CCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACG
AACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAG
GTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTA
TGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATC
GCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGC
AGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAG
TTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTG
GATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGG
TCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCC
CGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAG
CGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCG
GGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGAC
TCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCC
CCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGC
CCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGA
TGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAG
CTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGG
AGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAG
CCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTA
CTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAG
CCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCAC

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_3399nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGT
GAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAAT
GCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCA
CCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTAC
TCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCG
CATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGG
TCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAA
CCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACG
AACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATC
GATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCA
GTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCAC
TGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGA
ATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCC
CCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTC
CCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCA
AACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGA
TCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGG
AGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGG
GCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGT
CGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAA
CTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTG
CTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAAC
CACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCT
GCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCC
GCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAG
TTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCC
TTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCT
TTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGT

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_3413nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGT
GAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAAT
GCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCA
CCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTAC
TCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCG
CATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGG
TCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAA
CCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACG
AACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAG
GTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTA
TGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATC
GCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGC
AGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAG
TTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTG
GATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGG
TCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCC
CGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAG
CGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCG
GGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAAC
CTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCAC
CAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTT
CCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGT
CTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGC
ACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCAT
ATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTG
GGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGAC
ACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACA
TGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTG

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_3458nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGT
GAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAAT
GCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCA
CCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTAC
TCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCG
CATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGG
TCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAA
CCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACG
AACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATC
GATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCA
GTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCAC
TGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGA
ATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCC
CCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTC
CCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCA
AACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGA
TCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGG
AGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGG
GCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGT
CGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCA
GCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCT
GCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCC
CTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAG
CAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGT
GGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACC
CACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTG
ACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGG
GGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAG
TTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGC

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_2686nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGT
GAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAAT
GCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCA
CCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTAC
TCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCG
CATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGG
TCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAA
CCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACG
AACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATC
GATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCA
GTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCAC
TGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGA
ATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCC
CCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTC
CCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCA
AACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGA
TCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGG
AGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGG
GCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGT
CGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAA

>In-frame_VMP1_ENST00000262291_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_3346nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGT
GAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAAT
GCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCA
CCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTAC
TCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCG
CATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGG
TCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAA
CCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACG
AACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAG
GTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTA
TGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATC
GCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGC
AGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAG
TTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTG
GATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGG
TCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCC
CGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAG
CGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCG
GGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGAC
TCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCC
CCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGC
CCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGA
TGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAG
CTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGG
AGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAG
CCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTA
CTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAG
CCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCAC

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_3119nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGC
ATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTT
GGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGA
GAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTC
CCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCT
GGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCA
CCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGC
TTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCA
CAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGT
CTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATG
GAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTT
AGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTC
CTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAG
GAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAA
ACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTT
TTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGT
CCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGG
AGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCC
GAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCA
GTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTT
CGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTT
TGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTT
CTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCAC
CTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCC
ACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCT
TTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTG
ATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTG
GTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTC
CCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTAC

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_2962nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGC
ATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTT
GGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGA
GAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTC
CCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCT
GGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCA
CCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGC
TTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCA
CAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGT
CTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATG
GAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTT
AGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTC
CTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAG
GAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAA
ACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTT
TTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGT
CCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGG
AGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCC
GAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACC
AGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTC
CCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTC
TCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCA
CCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATA
TGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGG
GGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACA
CACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACAT
GCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGA

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_3014nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGC
ATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTT
GGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGA
GAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTC
CCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCT
GGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCA
CCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGC
TTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCG
GGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCT
GCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCC
CTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACA
CCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAAC
CACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACT
CGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACT
GGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCA
TCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATC
CAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCC
TCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAG
CACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAG
CGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTG
CCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCC
TGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGC
AGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTG
GCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCC
ACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGA
CCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGG
GTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGT
TTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCA

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_3028nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGC
ATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTT
GGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGA
GAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTC
CCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCT
GGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCA
CCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGC
TTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCA
CAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGT
CTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATG
GAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTT
AGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTC
CTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAG
GAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAA
ACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTT
TTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGT
CCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGG
AGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCC
GAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCA
GTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTT
GATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTC
TGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACC
TTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCA
CACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTT
TTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGA
TCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGG
TCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCC
CCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACT

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_3073nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGC
ATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTT
GGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGA
GAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTC
CCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCT
GGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCA
CCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGC
TTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCG
GGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCT
GCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCC
CTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACA
CCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAAC
CACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACT
CGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACT
GGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCA
TCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATC
CAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCC
TCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAG
CACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCC
CTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTG
AGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTC
AGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCG
CTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGA
GAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCG
GTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCC
TGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTC
AGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAG
GGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCC
TTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTG

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_2301nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGC
ATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTT
GGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGA
GAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTC
CCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCT
GGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCA
CCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGC
TTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCG
GGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCT
GCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCC
CTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACA
CCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAAC
CACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACT
CGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACT
GGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCA
TCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATC
CAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCC
TCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAG
CACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAG
CGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTG

>In-frame_VMP1_ENST00000537567_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_2961nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGC
ATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTT
GGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGA
GAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTC
CCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCT
GGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCA
CCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGC
TTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCA
CAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGT
CTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATG
GAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTT
AGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTC
CTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAG
GAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAA
ACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTT
TTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGT
CCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGG
AGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCC
GAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACC
AGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTC
CCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTC
TCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCA
CCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATA
TGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGG
GGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACA
CACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACAT
GCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGA

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_3183nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGA
GAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAAT
TCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACAT
CTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCC
TTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACT
GACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCA
AGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACA
AATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGG
CGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAA
ACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACC
CAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCA
GCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGG
AAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGT
TGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCAC
AGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGA
TCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTC
CACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCG
GCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGG
ATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGG
AAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAG
AGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCA
CCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCT
GGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCC
GCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCA
GGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGG
TGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCT
GAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGA
ACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGT
CTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTC

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_3026nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGA
GAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAAT
TCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACAT
CTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCC
TTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACT
GACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCA
AGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACA
AATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGG
CGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAA
ACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACC
CAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCA
GCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGG
AAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGT
TGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCAC
AGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGA
TCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTC
CACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCG
GCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGG
ATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGA
TGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTG
ACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTT
CCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACA
CCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTT
GTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATC
GTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTC
AGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCC
ATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGA

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_3078nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGA
GAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAAT
TCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACAT
CTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCC
TTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACT
GACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCA
AGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACA
AATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATG
CAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATG
GTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCAC
CTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCG
AGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGC
AGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGC
TTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGG
TCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAG
TGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAG
CATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGAC
CCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCG
ACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAG
TAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAG
CCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCT
CTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGA
AGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGT
CCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTG
GAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAG
CTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGG
AAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTT
TACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCA

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_3092nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGA
GAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAAT
TCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACAT
CTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCC
TTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACT
GACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCA
AGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACA
AATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGG
CGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAA
ACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACC
CAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCA
GCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGG
AAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGT
TGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCAC
AGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGA
TCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTC
CACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCG
GCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGG
ATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGA
GGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCAC
CAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTG
GAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCG
CCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAG
GAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGT
GGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTG
AGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAA
CGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTC
TTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCT

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_3137nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGA
GAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAAT
TCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACAT
CTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCC
TTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACT
GACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCA
AGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACA
AATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATG
CAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATG
GTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCAC
CTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCG
AGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGC
AGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGC
TTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGG
TCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAG
TGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAG
CATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGAC
CCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCG
ACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCC
CCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGG
CAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTA
GGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGC
TCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCA
GCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACA
TCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCC
TGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACAC
TGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTC
TTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGT

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_2365nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGA
GAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAAT
TCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACAT
CTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCC
TTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACT
GACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCA
AGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACA
AATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATG
CAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATG
GTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCAC
CTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCG
AGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGC
AGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGC
TTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGG
TCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAG
TGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAG
CATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGAC
CCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCG
ACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAG
TAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAG

>In-frame_VMP1_ENST00000539763_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_3025nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGA
GAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAAT
TCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACAT
CTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCC
TTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACT
GACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCA
AGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACA
AATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGG
CGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAA
ACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACC
CAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCA
GCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGG
AAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGT
TGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCAC
AGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGA
TCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTC
CACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCG
GCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGG
ATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGA
TGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTG
ACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTT
CCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACA
CCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTT
GTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATC
GTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTC
AGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCC
ATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGA

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000589222_chr17_59001768_+_3213nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGA
TGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACAC
CCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAG
GGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGT
TTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAG
TGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGG
GTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCC
CAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCC
TCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGC
AGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACAT
GATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCT
GGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCA
GTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGG
ACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTT
CAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCC
TCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATC
CCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTG
CGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCAT
GGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGT
GGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATG
CGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAA
ACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCT
GCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAA
CCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTC
TGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATC
CGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGA
GTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCC
CTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTC
TTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGG

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000407086_chr17_59001768_+_3056nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGA
TGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACAC
CCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAG
GGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGT
TTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAG
TGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGG
GTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCC
CAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCC
TCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGC
AGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACAT
GATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCT
GGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCA
GTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGG
ACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTT
CAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCC
TCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATC
CCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTG
CGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCAT
GGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTC
CACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGG
CTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTC
AGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCA
AGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTG
CATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGAT
CTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGT
GACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGG
ACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTA

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000390652_chr17_59001768_+_3108nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGA
TGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACAC
CCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAG
GGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGT
TTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAG
TGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGG
GTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCC
CAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGG
AGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGT
GGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGA
GTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGA
CACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGC
AAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCAT
TACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACA
CACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAG
TTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAG
GATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGC
TGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCAT
GGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACT
TCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCC
GCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCT
CCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGA
CAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGC
TGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCAT
ACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATT
TTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCA
CGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAA
GAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAG

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000408905_chr17_59001768_+_3122nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGA
TGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACAC
CCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAG
GGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGT
TTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAG
TGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGG
GTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCC
CAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCC
TCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGC
AGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACAT
GATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCT
GGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCA
GTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGG
ACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTT
CAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCC
TCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATC
CCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTG
CGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCAT
GGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGT
GGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAA
CTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTG
CTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAAC
CACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCT
GCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCC
GCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAG
TTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCC
TTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCT
TTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGT

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000588462_chr17_59001768_+_3167nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGA
TGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACAC
CCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAG
GGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGT
TTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAG
TGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGG
GTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCC
CAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGG
AGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGT
GGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGA
GTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGA
CACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGC
AAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCAT
TACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACA
CACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAG
TTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAG
GATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGC
TGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCAT
GGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACAC
AGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGAC
TCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCC
CCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGC
CCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGA
TGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAG
CTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGG
AGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAG
CCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTA
CTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAG
CCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCAC

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000585744_chr17_59001768_+_2395nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGA
TGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACAC
CCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAG
GGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGT
TTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAG
TGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGG
GTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCC
CAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGG
AGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGT
GGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGA
GTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGA
CACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGC
AAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCAT
TACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACA
CACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAG
TTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAG
GATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGC
TGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCAT
GGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACT
TCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCC

>In-frame_VMP1_ENST00000536180_chr17_57842499_+_BCAS3_ENST00000588874_chr17_59001768_+_3055nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGTGCTTGTGAGTGAGGATTCTGACAGTGA
TGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACAC
CCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAG
GGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGT
TTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAG
TGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGG
GTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCC
CAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCC
TCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGC
AGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACAT
GATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCT
GGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCA
GTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGG
ACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTT
CAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCC
TCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATC
CCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTG
CGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCAT
GGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTC
CACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGG
CTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTC
AGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCA
AGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTG
CATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGAT
CTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGT
GACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGG
ACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTA


Top

FusionGenePPI for VMP1_BCAS3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNABCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VMP1_BCAS3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VMP1_BCAS3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource