FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41457

FusionGeneSummary for VILL_ITGA9

check button Fusion gene summary
Fusion gene informationFusion gene name: VILL_ITGA9
Fusion gene ID: 41457
HgeneTgene
Gene symbol

VILL

ITGA9

Gene ID

50853

3680

Gene namevillin likeintegrin subunit alpha 9
Synonyms-ALPHA-RLC|ITGA4L|RLC
Cytomap

3p22.2

3p22.2

Type of geneprotein-codingprotein-coding
Descriptionvillin-like proteinintegrin alpha-9integrin alpha-RLC
Modification date2018051920180519
UniProtAcc

O15195

Q13797

Ensembl transtripts involved in fusion geneENST00000283713, ENST00000383759, 
ENST00000465644, 
ENST00000264741, 
ENST00000422441, 
Fusion gene scores* DoF score3 X 3 X 3=276 X 6 X 4=144
# samples 36
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VILL [Title/Abstract] AND ITGA9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-PG-A914-01AVILLchr3

38035463

+ITGA9chr3

37818883

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283713ENST00000264741VILLchr3

38035463

+ITGA9chr3

37818883

+
5CDS-intronENST00000283713ENST00000422441VILLchr3

38035463

+ITGA9chr3

37818883

+
In-frameENST00000383759ENST00000264741VILLchr3

38035463

+ITGA9chr3

37818883

+
5CDS-intronENST00000383759ENST00000422441VILLchr3

38035463

+ITGA9chr3

37818883

+
intron-3CDSENST00000465644ENST00000264741VILLchr3

38035463

+ITGA9chr3

37818883

+
intron-intronENST00000465644ENST00000422441VILLchr3

38035463

+ITGA9chr3

37818883

+

Top

FusionProtFeatures for VILL_ITGA9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VILL

O15195

ITGA9

Q13797

Possible tumor suppressor. Integrin alpha-9/beta-1 (ITGA9:ITGB1) is a receptor forVCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+22281005_10098471036MotifNote=GFFKR motif
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+22281003_10358471036Topological domainCytoplasmic
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228982_10028471036TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVILLchr3:38035463chr3:37818883ENST00000283713+320790_85645857DomainHP
HgeneVILLchr3:38035463chr3:37818883ENST00000383759+219790_85645857DomainHP
HgeneVILLchr3:38035463chr3:37818883ENST00000283713+320146_18645857RepeatNote=Gelsolin-like 2
HgeneVILLchr3:38035463chr3:37818883ENST00000283713+32022_7445857RepeatNote=Gelsolin-like 1
HgeneVILLchr3:38035463chr3:37818883ENST00000283713+320263_30745857RepeatNote=Gelsolin-like 3
HgeneVILLchr3:38035463chr3:37818883ENST00000283713+320401_45045857RepeatNote=Gelsolin-like 4
HgeneVILLchr3:38035463chr3:37818883ENST00000283713+320521_56145857RepeatNote=Gelsolin-like 5
HgeneVILLchr3:38035463chr3:37818883ENST00000283713+320624_66545857RepeatNote=Gelsolin-like 6
HgeneVILLchr3:38035463chr3:37818883ENST00000383759+219146_18645857RepeatNote=Gelsolin-like 2
HgeneVILLchr3:38035463chr3:37818883ENST00000383759+21922_7445857RepeatNote=Gelsolin-like 1
HgeneVILLchr3:38035463chr3:37818883ENST00000383759+219263_30745857RepeatNote=Gelsolin-like 3
HgeneVILLchr3:38035463chr3:37818883ENST00000383759+219401_45045857RepeatNote=Gelsolin-like 4
HgeneVILLchr3:38035463chr3:37818883ENST00000383759+219521_56145857RepeatNote=Gelsolin-like 5
HgeneVILLchr3:38035463chr3:37818883ENST00000383759+219624_66545857RepeatNote=Gelsolin-like 6
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228312_3208471036Calcium bindingOntology_term=ECO:0000255
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228373_3818471036Calcium bindingOntology_term=ECO:0000255
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228435_4438471036Calcium bindingOntology_term=ECO:0000255
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228111_1748471036RepeatFG-GAP 2
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228182_2328471036RepeatFG-GAP 3
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228233_2898471036RepeatFG-GAP 4
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228290_3498471036RepeatFG-GAP 5
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228351_4088471036RepeatFG-GAP 6
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+222835_968471036RepeatFG-GAP 1
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+2228411_4748471036RepeatFG-GAP 7
TgeneITGA9chr3:38035463chr3:37818883ENST00000264741+222830_9818471036Topological domainExtracellular


Top

FusionGeneSequence for VILL_ITGA9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VILL_ENST00000283713_chr3_38035463_+_ITGA9_ENST00000264741_chr3_37818883_+_234aa
MDISKGLPGMQGGLHIWISENRKMVPVPEGAYGNFFEEHCTVILHVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCE
KPGISCLTAHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPEEVTVVFEALHNLEPRGYVVGWI

>In-frame_VILL_ENST00000383759_chr3_38035463_+_ITGA9_ENST00000264741_chr3_37818883_+_234aa
MDISKGLPGMQGGLHIWISENRKMVPVPEGAYGNFFEEHCTVILHVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCE
KPGISCLTAHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPEEVTVVFEALHNLEPRGYVVGWI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VILL_ENST00000283713_chr3_38035463_+_ITGA9_ENST00000264741_chr3_37818883_+_702nt
ATGGACATCAGCAAGGGCCTCCCAGGCATGCAGGGAGGCCTCCACATATGGATCTCTGAGAACCGGAAGATGGTGCCGGTACCCGAGGGG
GCTTACGGGAACTTTTTTGAGGAACACTGCTATGTCATCCTCCACGTGGGCCAAGAGAAGGGAAACTGCTCTTTCCAGAAAAACCCAACT
CCCTGCATCATCCCTCAAGAACAAGAAAATATCTTCCACACAATATTTGCTTTTTTCACAAAGTCTGGAAGAAAAGTCTTGGACTGTGAA
AAACCAGGAATTTCTTGCCTAACAGCACACTGTAACTTTAGTGCTCTTGCTAAAGAAGAAAGTCGTACTATAGACATTTACATGCTGCTG
AACACAGAAATACTGAAAAAGGACAGTTCGTCTGTCATCCAGTTCATGTCCCGCGCCAAGGTGAAGGTGGATCCTGCCCTAAGGGTGGTG
GAAATAGCTCATGGGAACCCAGAAGAGGTGACGGTGGTCTTCGAGGCCCTGCACAATCTGGAGCCCCGTGGCTACGTCGTGGGGTGGATC
ATCGCCATCAGTTTGTTGGTGGGAATCCTCATCTTCCTGCTGCTGGCCGTGCTGCTCTGGAAGATGGGCTTCTTTCGCCGAAGGTACAAA

>In-frame_VILL_ENST00000383759_chr3_38035463_+_ITGA9_ENST00000264741_chr3_37818883_+_702nt
ATGGACATCAGCAAGGGCCTCCCAGGCATGCAGGGAGGCCTCCACATATGGATCTCTGAGAACCGGAAGATGGTGCCGGTACCCGAGGGG
GCTTACGGGAACTTTTTTGAGGAACACTGCTATGTCATCCTCCACGTGGGCCAAGAGAAGGGAAACTGCTCTTTCCAGAAAAACCCAACT
CCCTGCATCATCCCTCAAGAACAAGAAAATATCTTCCACACAATATTTGCTTTTTTCACAAAGTCTGGAAGAAAAGTCTTGGACTGTGAA
AAACCAGGAATTTCTTGCCTAACAGCACACTGTAACTTTAGTGCTCTTGCTAAAGAAGAAAGTCGTACTATAGACATTTACATGCTGCTG
AACACAGAAATACTGAAAAAGGACAGTTCGTCTGTCATCCAGTTCATGTCCCGCGCCAAGGTGAAGGTGGATCCTGCCCTAAGGGTGGTG
GAAATAGCTCATGGGAACCCAGAAGAGGTGACGGTGGTCTTCGAGGCCCTGCACAATCTGGAGCCCCGTGGCTACGTCGTGGGGTGGATC
ATCGCCATCAGTTTGTTGGTGGGAATCCTCATCTTCCTGCTGCTGGCCGTGCTGCTCTGGAAGATGGGCTTCTTTCGCCGAAGGTACAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_VILL_ENST00000283713_chr3_38035463_+_ITGA9_ENST00000264741_chr3_37818883_+_5493nt
GAGGGCGGGAAGGGCCCTCTGTGGGGCTGCCATTTTGGCTGGGACCTAAATGCAGTAAAGGAGCAGCTACGGGAATATAGAGAGTGGGGC
TTCCAGGCAGAGAAGCCTGCAGTGCAAAGGTCTGCAGACAACGACCTGGGCGTCTTCAAGGGACACAAGGAATCATATTGCCAGAACACA
TTGTACAGGTAGCCAGGTGTCGGTCTCCAGCCTGAGAACTCTGGCTGTTGTTCCTTGTGTCGTCCCATATTCCTGCCTGGCCTGCGATGG
ACATCAGCAAGGGCCTCCCAGGCATGCAGGGAGGCCTCCACATATGGATCTCTGAGAACCGGAAGATGGTGCCGGTACCCGAGGGGGCTT
ACGGGAACTTTTTTGAGGAACACTGCTATGTCATCCTCCACGTGGGCCAAGAGAAGGGAAACTGCTCTTTCCAGAAAAACCCAACTCCCT
GCATCATCCCTCAAGAACAAGAAAATATCTTCCACACAATATTTGCTTTTTTCACAAAGTCTGGAAGAAAAGTCTTGGACTGTGAAAAAC
CAGGAATTTCTTGCCTAACAGCACACTGTAACTTTAGTGCTCTTGCTAAAGAAGAAAGTCGTACTATAGACATTTACATGCTGCTGAACA
CAGAAATACTGAAAAAGGACAGTTCGTCTGTCATCCAGTTCATGTCCCGCGCCAAGGTGAAGGTGGATCCTGCCCTAAGGGTGGTGGAAA
TAGCTCATGGGAACCCAGAAGAGGTGACGGTGGTCTTCGAGGCCCTGCACAATCTGGAGCCCCGTGGCTACGTCGTGGGGTGGATCATCG
CCATCAGTTTGTTGGTGGGAATCCTCATCTTCCTGCTGCTGGCCGTGCTGCTCTGGAAGATGGGCTTCTTTCGCCGAAGGTACAAAGAAA
TTATCGAAGCTGAGAAGAACCGGAAAGAGAATGAAGACAGTTGGGACTGGGTCCAGAAAAACCAGTGAGCTGCCACACCAGTCACATGAC
CTGATCACTAGCCTGTCATCCTTGGTCTTTGTATCTTCCATATTTGGAAGAAAAAAATCTTCTCCAGATTTTTCGGAGGCCCCACTGATG
CTGTTCTCTTCTTCATTCTATCAAGCCCAGGTGCCAGCCTGAGGCAGCCACTTCGGCCAGGTCACACGACCGGGGCCAGCACCACTTCCT
TTAAAGATGAACTCTGAACTTTGGAGAGTGAGCTACAGAGCCGAGCAATATTTATGGATGCAACACGCATGGTCAACCCTCAGGGGAAAA
CTGTTACCTAAAGTATTTTTATAAATATAAGCCTTTTATACTGATTATGTCTTTTATATTTGTATCGATGTTTTATTATTTCTATTAAAT
AGTTATATAATTCACTCAAGCACTGATATCTGGCCTAAAATCTTGGAAGTACATGTCCATGAATACAAATTTTAAAGGATGAAAATCTTA
CCGTACTTTGGAACTTGCTGTTTAAAAAGACAGATGAAATAAGTTGAAGAAACCTCATGTAATGAATCCACCAGGCTGGCAGTGGTGCAT
ATAAACTGTGGGTGTGGCAAGACCCCGAAGACATTTCACATCTTTATCGCCTCGATCAAGTGTGGAGTCACATGCTAATGTGTGCTAAAG
AACTGTAAGTGTTTTTTCATATGTACTTTTCATTGGAAGATTCCCAACAAGAATTTGGATGGAAAACCTGATCCCTAGCAAGAAGTCTGC
TCTGTATCACCTTTATATAGCAGACATGTCACCCTGCTTCTACACAGATGATGGATGAAAGCTTGGAGCAATGCCATGTGGTCATCTGGT
AAACCTCAGAATGGCGTCTCATCCTGGACATCCTGCATCAGAGTTCACACACCACAAGGACTAAATCCTTGTCCCCTAAGCAAAGAATTG
GGTCTGAATGCTGTGAGGGATTGCCTTTTTGTGGTAATTTTCATTGAGAGATCTTCATTTCCCCTACCACCCTGGCTGTCCCAGCTAGTG
GTGATTGCAGATTCCTTCCCAGAGAGGACATTTAACCGTTTTAAAAAAAATGTCTTAGATTGGGTTCCCAAGAAGCAGTCCCTGAAACAA
GGATTTGTGTGCAAGTAACTTATTAAGGAAGTATTCCCAGGGGATACCAGTAAGAGAGTGGGGGAAGCAGGACAAGGAAGGAGACAAAGC
CAGGCAAATGTTTGTCATTTCAGGGAGAGCTCCATGAAGTTTAGCCTCAGCCTGATCAGGGGAACTCCGGAGGAAAAGTTAGGCCTCAGA
GGTGTCCCAACCTGAATCAAGGGGCTGGCTGCACCCAGAGGAGATGTAAACGTTTTATTCTCAATTCCTGCTGGCGTAATGGCTCCAGTA
GCTCAGGACAGTCCTCTAAAGGACAACCACAGATGCATCCTCAGCCAGGGGAGACACAGGGAAATGATGCAAAAGAAATGATGCAAAGGA
TCTGAGCAGAACACTGCCCCTCCCCACCCCCTGAATGTGTGAGTGCTGAGTTACGGCCTTCAGTATCCAAGCTCTCTGTTTGACAGTAGA
TATATTGTCAGATGCACTGTGCTGCTTAGTTTTGAGTGCAGTGTGATTTTCTGAAAGGGCAATGAGATGATGGATGTAGCATGCTCAGCA
CTGACCTGGCCCATAGTGATCACTCAATAACTGTTAACAGCTATGGCTGCTATTCCTACTGATGGATAACCATCTAATAAGACAGAAAAC
ATGGGGCTAAGAGCAGGGTCTAACGGAGTCTTAATGGCTTATTACAGCCTGCCAAAGTGCCAGCTACATACACATGGCATCCAGTGCGGA
TGAAACAATCTATAAAACCAAGGGTCTTTCTTATAGCACCTTTTTTACTGGAAGCTAACACGTTGGGAGTCCGTGAACATTGTCAAAAAG
ACATCAAACTCAACTTCTGGGAAGACAGATTTTTAATACACATACTTGGCTAATACTCACAAACATATCTAAAGTTTTGGCAAAATTATG
AGGGTGATGGGTGGGTACTAACCTGGCATGGAGCAGGTGTGTCTTTTGGTTTCTTATGCAGTTGACTCTGCTGCAGGGAGATTACAGATG
TAACCTCATGCTTCTCTTCCTGGTGAACATGGGAATAGACCAAAAAAATCAAGGGTCAATGGCATGAACTAAGCTGATCCTGGAAATCAG
GGATGTTGCATCTAACTGTGGGATGGAGGCACAGAGGTAGCTACAGGGAGCAGGACGAGGCAAAGAAAGCAGCTGTCACTCAGAGTTCGC
TTATGAGTTTTATCAAAAGCAGCAAGAAAAGCAGTCTTGGGTGGGTTTTATCACTTATTAACAGCCATTTATGAGGCCCCTGCTGTGTGT
CAGGCACTGTGCAAGGTGCTGGAGGTTCCCCAGAGAACACTTCAGGGACATTTTGCCTCAGGGTGGCAAAATGCAGTGGCATGTGGACTT
TTTGAATGGGATGCCATTTGCAGCTTTCCTTTGATGGACTCTTGTTCATAATGCCATGTTTTCTTTAATGAATCATTTAGGATTCTTAGG
TGATATTTCTGGAACAGCACCATCAACAGCTTTGGCCACATGCACTTAGAGCAACTAACTTGCCTCCTGCCGGGGTGTAGGTGCGTTGGT
GACAGTGTAGAAGGGTGATTCGCAGGCCCATGTTCTGCCCACCAGCAAAGCCCCACTGGAGAAGGGTAGACTCCTGTGGGCAGTCTCAGA
GCTGGGACCTATTTGCTTCTGCTTGATTCTGCGTGGGTGGACCCACATGAGCAGCTGTATACCCAGGAGGTCACTAAGACTTTATAAAGG
CAGGTTTTAAGAAAACCAGCCTTGGCATCACCACCAGCAGATACTGAAAGCCTCCCCAGGAACCTGTCTGGGGAAGGATGATGCCTCTGC
TGGTCTGATCGTGCTGAGTAGCAGGTGGGCTACGGGGACTGGGGAGTTAAGCATTTTGTGCAGTGATAGAGAAGTCAAGCATATCGTTAG
CGCTCTCTCAACTTGGGCAGTTCACAAGCTCCTTCCCAGCTCAGAAGCCCTCTCTATGCTCTCAGGGGAAGCAGATGGGGTGGATCAGTA
CATCTGTGTTACCCTTCCAGAATATTATTTGAAAATTCTACAGTATGTTCTACTTTCTCCCCTTCCTGCTTCCATGGTTTCACTGTGGAA
TCCTATAAGATATTCTCCTGAGCAGTATTATTTCAGTTTCCTTCAGCTTTTAGTTGAATCTTCAATGTGGTTTTAACCAACTGTTCAGAG
AACTGAAATGGTTTTTAAATATGAAAAAGGACCTTTGTAAAAATGGAGTAAAACAGTGCCCCTTTTTTAAAAAAAGTTTTGCTTATGCTT
AATTTACATAGGACTCAGGAGAGTTTGGAACATCCTCCAAGTGGGCCATAGAGCTGTCACAAAGAAGAGGCCATGATGTTTAGAAACAAG
GGGACACTAGCAGGAGGGGCAGGGTCCACTGGCTTAGTGGCAACTGACAGGCATCCATTCCGAATAACTCAGCACTGAGGTTTCCTCAGG
CAGTTCTTTAGGAAAACTGTCAGCATCATGGGTACTCAGAGGTATGGTAGACCTTGTAGAAGATCCACTAGGAAGTCCTCCTTCACCAAA
TCATGTAGCTACTGCCCTTGAGCCAAAGGCAATGAGGTTTAAAACAAAAACCCAACAGCACTCCTGGGAACATCCTGTTTTCCATGCGGA
AGCATAGCAGATCCCCAGACGATCCGTGTGCTGTATGCTACCTGTTGAACCCTAGCATGGTGGCTTTTTAAAAGGTTATTTATGACTTTT
ATTTTTGGGTAAGGCATTATGGCCAGGTGCATGCAGTTATGTCTGGGTTACGTGTGAAACGTACATCTGGTGAACTGTATACTTGGCTCA
AACTTCTCAAAATTTAGAGGTGCTGGAAAGGATTGTCACTTGGAGCCTTTAGTAGACAAAAGGCAGAAAGTGAGCATCATTTCAGAAATG
CTTTAGTATGCACACTTTTAGCTGATATTTTGATATATAGAATAATAATATACACAGTGGAGAATATTCAAAGAGTGGCTGAAGGGAGAA
TACAGAGCCAGTAGGGCCAAAATGAAACTTCTAGGATGTCTTCTGAATTTTCAGCACATGGGGGGAATAAGTGAACAAATTTCCCAACAT
CGTGCAATGCTTTATAGCACAATGATCTAGATTTCAGACTGTGTTAAGGTTTTTTCTTTGTTGATGTTGTTGTTTTAATTCTAATGTGCA
CGGTGTGACTGGCAGAGTGAGTTTAAAAGCTTTACGAGTGATTAATTGCTTGGCAGGCACCCACGCTATCTGCATTTCCAGAACTTTACT
GATGCATCCATGTACATTTCCACTGAGGAATTTTGGTGGGTGGGGGGAGGTTGTGCTGCCTCACAATGTCACGTGTATTAAAGTCTAAGC
AGTCACTTCTGATTCACTTGCACTGTTTGGGAAATGTCAGGTTTACAAAAACATACATGTTTGGAATAAAAAATGGCTGCAAACAATTCA

>In-frame_VILL_ENST00000383759_chr3_38035463_+_ITGA9_ENST00000264741_chr3_37818883_+_5313nt
TTGTACAGGTAGCCAGGTGTCGGTCTCCAGCCTGAGAACTCTGGCTGTTGTTCCTTGTGTCGTCCCATATTCCTGCCTGGCCTGCGATGG
ACATCAGCAAGGGCCTCCCAGGCATGCAGGGAGGCCTCCACATATGGATCTCTGAGAACCGGAAGATGGTGCCGGTACCCGAGGGGGCTT
ACGGGAACTTTTTTGAGGAACACTGCTATGTCATCCTCCACGTGGGCCAAGAGAAGGGAAACTGCTCTTTCCAGAAAAACCCAACTCCCT
GCATCATCCCTCAAGAACAAGAAAATATCTTCCACACAATATTTGCTTTTTTCACAAAGTCTGGAAGAAAAGTCTTGGACTGTGAAAAAC
CAGGAATTTCTTGCCTAACAGCACACTGTAACTTTAGTGCTCTTGCTAAAGAAGAAAGTCGTACTATAGACATTTACATGCTGCTGAACA
CAGAAATACTGAAAAAGGACAGTTCGTCTGTCATCCAGTTCATGTCCCGCGCCAAGGTGAAGGTGGATCCTGCCCTAAGGGTGGTGGAAA
TAGCTCATGGGAACCCAGAAGAGGTGACGGTGGTCTTCGAGGCCCTGCACAATCTGGAGCCCCGTGGCTACGTCGTGGGGTGGATCATCG
CCATCAGTTTGTTGGTGGGAATCCTCATCTTCCTGCTGCTGGCCGTGCTGCTCTGGAAGATGGGCTTCTTTCGCCGAAGGTACAAAGAAA
TTATCGAAGCTGAGAAGAACCGGAAAGAGAATGAAGACAGTTGGGACTGGGTCCAGAAAAACCAGTGAGCTGCCACACCAGTCACATGAC
CTGATCACTAGCCTGTCATCCTTGGTCTTTGTATCTTCCATATTTGGAAGAAAAAAATCTTCTCCAGATTTTTCGGAGGCCCCACTGATG
CTGTTCTCTTCTTCATTCTATCAAGCCCAGGTGCCAGCCTGAGGCAGCCACTTCGGCCAGGTCACACGACCGGGGCCAGCACCACTTCCT
TTAAAGATGAACTCTGAACTTTGGAGAGTGAGCTACAGAGCCGAGCAATATTTATGGATGCAACACGCATGGTCAACCCTCAGGGGAAAA
CTGTTACCTAAAGTATTTTTATAAATATAAGCCTTTTATACTGATTATGTCTTTTATATTTGTATCGATGTTTTATTATTTCTATTAAAT
AGTTATATAATTCACTCAAGCACTGATATCTGGCCTAAAATCTTGGAAGTACATGTCCATGAATACAAATTTTAAAGGATGAAAATCTTA
CCGTACTTTGGAACTTGCTGTTTAAAAAGACAGATGAAATAAGTTGAAGAAACCTCATGTAATGAATCCACCAGGCTGGCAGTGGTGCAT
ATAAACTGTGGGTGTGGCAAGACCCCGAAGACATTTCACATCTTTATCGCCTCGATCAAGTGTGGAGTCACATGCTAATGTGTGCTAAAG
AACTGTAAGTGTTTTTTCATATGTACTTTTCATTGGAAGATTCCCAACAAGAATTTGGATGGAAAACCTGATCCCTAGCAAGAAGTCTGC
TCTGTATCACCTTTATATAGCAGACATGTCACCCTGCTTCTACACAGATGATGGATGAAAGCTTGGAGCAATGCCATGTGGTCATCTGGT
AAACCTCAGAATGGCGTCTCATCCTGGACATCCTGCATCAGAGTTCACACACCACAAGGACTAAATCCTTGTCCCCTAAGCAAAGAATTG
GGTCTGAATGCTGTGAGGGATTGCCTTTTTGTGGTAATTTTCATTGAGAGATCTTCATTTCCCCTACCACCCTGGCTGTCCCAGCTAGTG
GTGATTGCAGATTCCTTCCCAGAGAGGACATTTAACCGTTTTAAAAAAAATGTCTTAGATTGGGTTCCCAAGAAGCAGTCCCTGAAACAA
GGATTTGTGTGCAAGTAACTTATTAAGGAAGTATTCCCAGGGGATACCAGTAAGAGAGTGGGGGAAGCAGGACAAGGAAGGAGACAAAGC
CAGGCAAATGTTTGTCATTTCAGGGAGAGCTCCATGAAGTTTAGCCTCAGCCTGATCAGGGGAACTCCGGAGGAAAAGTTAGGCCTCAGA
GGTGTCCCAACCTGAATCAAGGGGCTGGCTGCACCCAGAGGAGATGTAAACGTTTTATTCTCAATTCCTGCTGGCGTAATGGCTCCAGTA
GCTCAGGACAGTCCTCTAAAGGACAACCACAGATGCATCCTCAGCCAGGGGAGACACAGGGAAATGATGCAAAAGAAATGATGCAAAGGA
TCTGAGCAGAACACTGCCCCTCCCCACCCCCTGAATGTGTGAGTGCTGAGTTACGGCCTTCAGTATCCAAGCTCTCTGTTTGACAGTAGA
TATATTGTCAGATGCACTGTGCTGCTTAGTTTTGAGTGCAGTGTGATTTTCTGAAAGGGCAATGAGATGATGGATGTAGCATGCTCAGCA
CTGACCTGGCCCATAGTGATCACTCAATAACTGTTAACAGCTATGGCTGCTATTCCTACTGATGGATAACCATCTAATAAGACAGAAAAC
ATGGGGCTAAGAGCAGGGTCTAACGGAGTCTTAATGGCTTATTACAGCCTGCCAAAGTGCCAGCTACATACACATGGCATCCAGTGCGGA
TGAAACAATCTATAAAACCAAGGGTCTTTCTTATAGCACCTTTTTTACTGGAAGCTAACACGTTGGGAGTCCGTGAACATTGTCAAAAAG
ACATCAAACTCAACTTCTGGGAAGACAGATTTTTAATACACATACTTGGCTAATACTCACAAACATATCTAAAGTTTTGGCAAAATTATG
AGGGTGATGGGTGGGTACTAACCTGGCATGGAGCAGGTGTGTCTTTTGGTTTCTTATGCAGTTGACTCTGCTGCAGGGAGATTACAGATG
TAACCTCATGCTTCTCTTCCTGGTGAACATGGGAATAGACCAAAAAAATCAAGGGTCAATGGCATGAACTAAGCTGATCCTGGAAATCAG
GGATGTTGCATCTAACTGTGGGATGGAGGCACAGAGGTAGCTACAGGGAGCAGGACGAGGCAAAGAAAGCAGCTGTCACTCAGAGTTCGC
TTATGAGTTTTATCAAAAGCAGCAAGAAAAGCAGTCTTGGGTGGGTTTTATCACTTATTAACAGCCATTTATGAGGCCCCTGCTGTGTGT
CAGGCACTGTGCAAGGTGCTGGAGGTTCCCCAGAGAACACTTCAGGGACATTTTGCCTCAGGGTGGCAAAATGCAGTGGCATGTGGACTT
TTTGAATGGGATGCCATTTGCAGCTTTCCTTTGATGGACTCTTGTTCATAATGCCATGTTTTCTTTAATGAATCATTTAGGATTCTTAGG
TGATATTTCTGGAACAGCACCATCAACAGCTTTGGCCACATGCACTTAGAGCAACTAACTTGCCTCCTGCCGGGGTGTAGGTGCGTTGGT
GACAGTGTAGAAGGGTGATTCGCAGGCCCATGTTCTGCCCACCAGCAAAGCCCCACTGGAGAAGGGTAGACTCCTGTGGGCAGTCTCAGA
GCTGGGACCTATTTGCTTCTGCTTGATTCTGCGTGGGTGGACCCACATGAGCAGCTGTATACCCAGGAGGTCACTAAGACTTTATAAAGG
CAGGTTTTAAGAAAACCAGCCTTGGCATCACCACCAGCAGATACTGAAAGCCTCCCCAGGAACCTGTCTGGGGAAGGATGATGCCTCTGC
TGGTCTGATCGTGCTGAGTAGCAGGTGGGCTACGGGGACTGGGGAGTTAAGCATTTTGTGCAGTGATAGAGAAGTCAAGCATATCGTTAG
CGCTCTCTCAACTTGGGCAGTTCACAAGCTCCTTCCCAGCTCAGAAGCCCTCTCTATGCTCTCAGGGGAAGCAGATGGGGTGGATCAGTA
CATCTGTGTTACCCTTCCAGAATATTATTTGAAAATTCTACAGTATGTTCTACTTTCTCCCCTTCCTGCTTCCATGGTTTCACTGTGGAA
TCCTATAAGATATTCTCCTGAGCAGTATTATTTCAGTTTCCTTCAGCTTTTAGTTGAATCTTCAATGTGGTTTTAACCAACTGTTCAGAG
AACTGAAATGGTTTTTAAATATGAAAAAGGACCTTTGTAAAAATGGAGTAAAACAGTGCCCCTTTTTTAAAAAAAGTTTTGCTTATGCTT
AATTTACATAGGACTCAGGAGAGTTTGGAACATCCTCCAAGTGGGCCATAGAGCTGTCACAAAGAAGAGGCCATGATGTTTAGAAACAAG
GGGACACTAGCAGGAGGGGCAGGGTCCACTGGCTTAGTGGCAACTGACAGGCATCCATTCCGAATAACTCAGCACTGAGGTTTCCTCAGG
CAGTTCTTTAGGAAAACTGTCAGCATCATGGGTACTCAGAGGTATGGTAGACCTTGTAGAAGATCCACTAGGAAGTCCTCCTTCACCAAA
TCATGTAGCTACTGCCCTTGAGCCAAAGGCAATGAGGTTTAAAACAAAAACCCAACAGCACTCCTGGGAACATCCTGTTTTCCATGCGGA
AGCATAGCAGATCCCCAGACGATCCGTGTGCTGTATGCTACCTGTTGAACCCTAGCATGGTGGCTTTTTAAAAGGTTATTTATGACTTTT
ATTTTTGGGTAAGGCATTATGGCCAGGTGCATGCAGTTATGTCTGGGTTACGTGTGAAACGTACATCTGGTGAACTGTATACTTGGCTCA
AACTTCTCAAAATTTAGAGGTGCTGGAAAGGATTGTCACTTGGAGCCTTTAGTAGACAAAAGGCAGAAAGTGAGCATCATTTCAGAAATG
CTTTAGTATGCACACTTTTAGCTGATATTTTGATATATAGAATAATAATATACACAGTGGAGAATATTCAAAGAGTGGCTGAAGGGAGAA
TACAGAGCCAGTAGGGCCAAAATGAAACTTCTAGGATGTCTTCTGAATTTTCAGCACATGGGGGGAATAAGTGAACAAATTTCCCAACAT
CGTGCAATGCTTTATAGCACAATGATCTAGATTTCAGACTGTGTTAAGGTTTTTTCTTTGTTGATGTTGTTGTTTTAATTCTAATGTGCA
CGGTGTGACTGGCAGAGTGAGTTTAAAAGCTTTACGAGTGATTAATTGCTTGGCAGGCACCCACGCTATCTGCATTTCCAGAACTTTACT
GATGCATCCATGTACATTTCCACTGAGGAATTTTGGTGGGTGGGGGGAGGTTGTGCTGCCTCACAATGTCACGTGTATTAAAGTCTAAGC
AGTCACTTCTGATTCACTTGCACTGTTTGGGAAATGTCAGGTTTACAAAAACATACATGTTTGGAATAAAAAATGGCTGCAAACAATTCA


Top

FusionGenePPI for VILL_ITGA9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VILLHSPA8, TIMM13, HSPA6ITGA9ITGB1, ALDH1A3, LCN2, SERPINB4, SPRR1B, PCYOX1L, SMOC1, IGLL5, KLK10, IVL, HSPA5, CALML5, EVPL, IGKC, TUBA4A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VILL_ITGA9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VILL_ITGA9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneITGA9C0005586Bipolar Disorder1PSYGENET
TgeneITGA9C1839839MAJOR AFFECTIVE DISORDER 21PSYGENET