FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41346

FusionGeneSummary for VAPB_IKZF3

check button Fusion gene summary
Fusion gene informationFusion gene name: VAPB_IKZF3
Fusion gene ID: 41346
HgeneTgene
Gene symbol

VAPB

IKZF3

Gene ID

9217

22806

Gene nameVAMP associated protein B and CIKAROS family zinc finger 3
SynonymsALS8|VAMP-B|VAP-BAIO|AIOLOS|ZNFN1A3
Cytomap

20q13.32

17q12-q21.1

Type of geneprotein-codingprotein-coding
Descriptionvesicle-associated membrane protein-associated protein B/CVAMP (vesicle-associated membrane protein)-associated protein B and CVAMP-associated 33 kDa proteinzinc finger protein Aioloszinc finger DNA binding protein Aioloszinc finger protein, subfamily 1A, 3 (Aiolos)
Modification date2018052220180523
UniProtAcc

O95292

Q9UKT9

Ensembl transtripts involved in fusion geneENST00000475243, ENST00000395802, 
ENST00000265619, 
ENST00000346872, 
ENST00000394189, ENST00000439167, 
ENST00000535189, ENST00000377944, 
ENST00000377945, ENST00000377952, 
ENST00000377958, ENST00000346243, 
ENST00000350532, ENST00000351680, 
ENST00000467757, ENST00000439016, 
ENST00000583368, 
Fusion gene scores* DoF score7 X 4 X 4=11227 X 9 X 12=2916
# samples 734
** MAII scorelog2(7/112*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(34/2916*10)=-3.10038406818924
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VAPB [Title/Abstract] AND IKZF3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneVAPB

GO:0019048

modulation by virus of host morphology or physiology

16227268


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1XX000009VAPBchr20

56964573

+IKZF3chr17

37934022

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000475243ENST00000346872VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000475243ENST00000394189VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000475243ENST00000439167VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000475243ENST00000535189VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000475243ENST00000377944VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000377945VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000377952VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000377958VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000346243VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000350532VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000351680VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000467757VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000475243ENST00000439016VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-5UTRENST00000475243ENST00000583368VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000395802ENST00000346872VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000395802ENST00000394189VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000395802ENST00000439167VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000395802ENST00000535189VAPBchr20

56964573

+IKZF3chr17

37934022

-
In-frameENST00000395802ENST00000377944VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000377945VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000377952VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000377958VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000346243VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000350532VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000351680VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000467757VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-intronENST00000395802ENST00000439016VAPBchr20

56964573

+IKZF3chr17

37934022

-
5CDS-5UTRENST00000395802ENST00000583368VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-3CDSENST00000265619ENST00000346872VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-3CDSENST00000265619ENST00000394189VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-3CDSENST00000265619ENST00000439167VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-3CDSENST00000265619ENST00000535189VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-3CDSENST00000265619ENST00000377944VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000377945VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000377952VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000377958VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000346243VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000350532VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000351680VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000467757VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-intronENST00000265619ENST00000439016VAPBchr20

56964573

+IKZF3chr17

37934022

-
3UTR-5UTRENST00000265619ENST00000583368VAPBchr20

56964573

+IKZF3chr17

37934022

-

Top

FusionProtFeatures for VAPB_IKZF3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VAPB

O95292

IKZF3

Q9UKT9

Participates in the endoplasmic reticulum unfoldedprotein response (UPR) by inducing ERN1/IRE1 activity. Involved incellular calcium homeostasis regulation.{ECO:0000269|PubMed:16891305, ECO:0000269|PubMed:20940299,ECO:0000269|PubMed:22131369}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346243-06118_1400432Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346243-06146_1680432Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346243-06174_1960432Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346243-06202_2240432Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346243-06452_4740432Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346243-06480_5040432Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346872-58452_474236510Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346872-58480_504236510Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000350532-07118_1400471Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000350532-07146_1680471Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000350532-07174_1960471Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000350532-07202_2240471Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000350532-07452_4740471Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000350532-07480_5040471Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000351680-47202_224197471Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000351680-47452_474197471Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000351680-47480_504197471Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377944-36118_14093367Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377944-36146_16893367Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377944-36174_19693367Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377944-36202_22493367Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377944-36452_47493367Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377944-36480_50493367Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377945-05118_140-21376Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377945-05146_168-21376Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377945-05174_196-21376Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377945-05202_224-21376Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377945-05452_474-21376Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377945-05480_504-21376Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377952-04118_140-21289Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377952-04146_168-21289Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377952-04174_196-21289Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377952-04202_224-21289Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377952-04452_474-21289Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377952-04480_504-21289Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377958-47146_168149423Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377958-47174_196149423Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377958-47202_224149423Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377958-47452_474149423Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377958-47480_504149423Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000394189-25118_14054328Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000394189-25146_16854328Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000394189-25174_19654328Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000394189-25202_22454328Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000394189-25452_47454328Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000394189-25480_50454328Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439016-36146_168141415Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439016-36174_196141415Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439016-36202_224141415Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439016-36452_474141415Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439016-36480_504141415Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439167-36174_196163437Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439167-36202_224163437Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439167-36452_474163437Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439167-36480_504163437Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000467757-47202_224180454Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000467757-47452_474180454Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000467757-47480_504180454Zinc fingerC2H2-type 6%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000535189-47202_224202476Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000535189-47452_474202476Zinc fingerC2H2-type 5
TgeneIKZF3chr20:56964573chr17:37934022ENST00000535189-47480_504202476Zinc fingerC2H2-type 6%3B atypical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVAPBchr20:56964573chr17:37934022ENST00000395802+13159_19619100Coiled coilOntology_term=ECO:0000255
HgeneVAPBchr20:56964573chr17:37934022ENST00000475243+16159_19619244Coiled coilOntology_term=ECO:0000255
HgeneVAPBchr20:56964573chr17:37934022ENST00000395802+137_12419100DomainMSP
HgeneVAPBchr20:56964573chr17:37934022ENST00000475243+167_12419244DomainMSP
HgeneVAPBchr20:56964573chr17:37934022ENST00000395802+132_22219100Topological domainCytoplasmic
HgeneVAPBchr20:56964573chr17:37934022ENST00000475243+162_22219244Topological domainCytoplasmic
HgeneVAPBchr20:56964573chr17:37934022ENST00000395802+13223_24319100TransmembraneHelical%3B Anchor for type IV membrane protein
HgeneVAPBchr20:56964573chr17:37934022ENST00000475243+16223_24319244TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346872-58118_140236510Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346872-58146_168236510Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346872-58174_196236510Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000346872-58202_224236510Zinc fingerC2H2-type 4%3B atypical
TgeneIKZF3chr20:56964573chr17:37934022ENST00000351680-47118_140197471Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000351680-47146_168197471Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000351680-47174_196197471Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000377958-47118_140149423Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439016-36118_140141415Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439167-36118_140163437Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000439167-36146_168163437Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000467757-47118_140180454Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000467757-47146_168180454Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000467757-47174_196180454Zinc fingerC2H2-type 3
TgeneIKZF3chr20:56964573chr17:37934022ENST00000535189-47118_140202476Zinc fingerC2H2-type 1
TgeneIKZF3chr20:56964573chr17:37934022ENST00000535189-47146_168202476Zinc fingerC2H2-type 2
TgeneIKZF3chr20:56964573chr17:37934022ENST00000535189-47174_196202476Zinc fingerC2H2-type 3


Top

FusionGeneSequence for VAPB_IKZF3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000346872_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000394189_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000439167_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000535189_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000377944_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000346872_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000394189_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000439167_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000535189_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000377944_chr17_37934022_-_293aa
MAKVEQVLSLEPQHELKFRASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMDQA
INNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQ
NHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000346872_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000394189_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000439167_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000535189_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000377944_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000346872_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000394189_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000439167_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000535189_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000377944_chr17_37934022_-_879nt
ATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAG
ATGGGAAGTGAAAGAGCTCTCGTACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAG
AAGCGCCACTGCTTTGATGTCAACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCC
ATCAATAACGCCATCAGCTATCTTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTT
ATCAGCAGCATGTATCCCATAGCCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCA
GAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAG
AATCACATCTATCAGCAAAATCACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTC
CTCAAGCCCCCGCCCATCTGCCCAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGC
CGCGTCCTCTTCCTGGACTATGTGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000346872_chr17_37934022_-_2062nt
CCCCGCCCCTGGAGCCGGCGGCGCAGGGCGCAGCTTCCCGCCGCCAGAGCGGGCCAGCCTGCTGCGTGCGTGCGTGTGTACGACTCTGCG
TGCGTGCGTGCGTGCGTGCGTGCCGTCAGCTCGCCGGGCACCGCGGCCTCGCCCTCGCCCTCCGCCCCTGCGCCTGCACCGCGTAGACCG
ACCCCCCCCCAGCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGC
ATTAACGCTTCCCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCC
TGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCG
TACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCA
ACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATC
TTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAG
CCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGA
GAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATC
ACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCC
CAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATG
TGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGT
TCTCGTCTCACATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTT
CTAAAAACCAATGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAG
GGGTAGCCAGGGAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGG
GACTTGAATTTTATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTAT
ATGAAACATTCTTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGC
TGACCTTGCTGGGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTA
AGTAAAAGAACAGCCATAAAATAAGTATCTGTTACGAGTAACTGAAGACCCCATTCTCCAAGCATCAGATCCATTTCCTATCACAACATT
TTTAAAAAATGTCATCTGATGGCACTTCTGCTTCTGTCCTTTACCTTCCCATCTCCAGTGAAAAGCTGAGCTGCTTTGGGCTAAACCAGT
TGTCTATAGAAGAAAATCTATGCCAGAAGAACTCATGGTTTTAAATATAGACCATCATCGAAACTCCAGAAATTTATCCACTGTGGATGA

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000394189_chr17_37934022_-_1723nt
CCCCGCCCCTGGAGCCGGCGGCGCAGGGCGCAGCTTCCCGCCGCCAGAGCGGGCCAGCCTGCTGCGTGCGTGCGTGTGTACGACTCTGCG
TGCGTGCGTGCGTGCGTGCGTGCCGTCAGCTCGCCGGGCACCGCGGCCTCGCCCTCGCCCTCCGCCCCTGCGCCTGCACCGCGTAGACCG
ACCCCCCCCCAGCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGC
ATTAACGCTTCCCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCC
TGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCG
TACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCA
ACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATC
TTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAG
CCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGA
GAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATC
ACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCC
CAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATG
TGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGT
TCTCGTCTCACATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTT
CTAAAAACCAATGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAG
GGGTAGCCAGGGAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGG
GACTTGAATTTTATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTAT
ATGAAACATTCTTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGC
TGACCTTGCTGGGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTA

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000439167_chr17_37934022_-_1723nt
CCCCGCCCCTGGAGCCGGCGGCGCAGGGCGCAGCTTCCCGCCGCCAGAGCGGGCCAGCCTGCTGCGTGCGTGCGTGTGTACGACTCTGCG
TGCGTGCGTGCGTGCGTGCGTGCCGTCAGCTCGCCGGGCACCGCGGCCTCGCCCTCGCCCTCCGCCCCTGCGCCTGCACCGCGTAGACCG
ACCCCCCCCCAGCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGC
ATTAACGCTTCCCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCC
TGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCG
TACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCA
ACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATC
TTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAG
CCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGA
GAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATC
ACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCC
CAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATG
TGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGT
TCTCGTCTCACATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTT
CTAAAAACCAATGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAG
GGGTAGCCAGGGAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGG
GACTTGAATTTTATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTAT
ATGAAACATTCTTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGC
TGACCTTGCTGGGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTA

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000535189_chr17_37934022_-_1723nt
CCCCGCCCCTGGAGCCGGCGGCGCAGGGCGCAGCTTCCCGCCGCCAGAGCGGGCCAGCCTGCTGCGTGCGTGCGTGTGTACGACTCTGCG
TGCGTGCGTGCGTGCGTGCGTGCCGTCAGCTCGCCGGGCACCGCGGCCTCGCCCTCGCCCTCCGCCCCTGCGCCTGCACCGCGTAGACCG
ACCCCCCCCCAGCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGC
ATTAACGCTTCCCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCC
TGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCG
TACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCA
ACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATC
TTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAG
CCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGA
GAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATC
ACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCC
CAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATG
TGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGT
TCTCGTCTCACATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTT
CTAAAAACCAATGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAG
GGGTAGCCAGGGAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGG
GACTTGAATTTTATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTAT
ATGAAACATTCTTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGC
TGACCTTGCTGGGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTA

>In-frame_VAPB_ENST00000475243_chr20_56964573_+_IKZF3_ENST00000377944_chr17_37934022_-_1723nt
CCCCGCCCCTGGAGCCGGCGGCGCAGGGCGCAGCTTCCCGCCGCCAGAGCGGGCCAGCCTGCTGCGTGCGTGCGTGTGTACGACTCTGCG
TGCGTGCGTGCGTGCGTGCGTGCCGTCAGCTCGCCGGGCACCGCGGCCTCGCCCTCGCCCTCCGCCCCTGCGCCTGCACCGCGTAGACCG
ACCCCCCCCCAGCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGC
ATTAACGCTTCCCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCC
TGAGCCTCGAGCCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCG
TACTGGACAGATTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCA
ACTATAATTCAAGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATC
TTGGCGCCGAAGCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAG
CCCTCACCCGGGCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGA
GAGGCCTCTCTCCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATC
ACATGGTCCTGTCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCC
CAAGAGACTCCGTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATG
TGATGTTCACGATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGT
TCTCGTCTCACATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTT
CTAAAAACCAATGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAG
GGGTAGCCAGGGAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGG
GACTTGAATTTTATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTAT
ATGAAACATTCTTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGC
TGACCTTGCTGGGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTA

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000346872_chr17_37934022_-_1871nt
GCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGCATTAACGCTTC
CCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAG
CCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCGTACTGGACAGA
TTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCAACTATAATTCA
AGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATCTTGGCGCCGAA
GCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAGCCCTCACCCGG
GCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCT
CCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATCACATGGTCCTG
TCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCCCAAGAGACTCC
GTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATGTGATGTTCACG
ATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGTTCTCGTCTCAC
ATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTTCTAAAAACCAA
TGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAGGGGTAGCCAGG
GAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGGGACTTGAATTT
TATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTATATGAAACATTC
TTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGCTGACCTTGCTG
GGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTAAGTAAAAGAAC
AGCCATAAAATAAGTATCTGTTACGAGTAACTGAAGACCCCATTCTCCAAGCATCAGATCCATTTCCTATCACAACATTTTTAAAAAATG
TCATCTGATGGCACTTCTGCTTCTGTCCTTTACCTTCCCATCTCCAGTGAAAAGCTGAGCTGCTTTGGGCTAAACCAGTTGTCTATAGAA
GAAAATCTATGCCAGAAGAACTCATGGTTTTAAATATAGACCATCATCGAAACTCCAGAAATTTATCCACTGTGGATGATGACATCGCTT

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000394189_chr17_37934022_-_1532nt
GCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGCATTAACGCTTC
CCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAG
CCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCGTACTGGACAGA
TTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCAACTATAATTCA
AGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATCTTGGCGCCGAA
GCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAGCCCTCACCCGG
GCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCT
CCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATCACATGGTCCTG
TCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCCCAAGAGACTCC
GTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATGTGATGTTCACG
ATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGTTCTCGTCTCAC
ATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTTCTAAAAACCAA
TGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAGGGGTAGCCAGG
GAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGGGACTTGAATTT
TATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTATATGAAACATTC
TTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGCTGACCTTGCTG
GGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTAAGTAAAAGAAC

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000439167_chr17_37934022_-_1532nt
GCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGCATTAACGCTTC
CCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAG
CCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCGTACTGGACAGA
TTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCAACTATAATTCA
AGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATCTTGGCGCCGAA
GCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAGCCCTCACCCGG
GCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCT
CCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATCACATGGTCCTG
TCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCCCAAGAGACTCC
GTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATGTGATGTTCACG
ATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGTTCTCGTCTCAC
ATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTTCTAAAAACCAA
TGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAGGGGTAGCCAGG
GAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGGGACTTGAATTT
TATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTATATGAAACATTC
TTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGCTGACCTTGCTG
GGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTAAGTAAAAGAAC

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000535189_chr17_37934022_-_1532nt
GCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGCATTAACGCTTC
CCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAG
CCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCGTACTGGACAGA
TTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCAACTATAATTCA
AGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATCTTGGCGCCGAA
GCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAGCCCTCACCCGG
GCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCT
CCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATCACATGGTCCTG
TCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCCCAAGAGACTCC
GTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATGTGATGTTCACG
ATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGTTCTCGTCTCAC
ATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTTCTAAAAACCAA
TGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAGGGGTAGCCAGG
GAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGGGACTTGAATTT
TATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTATATGAAACATTC
TTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGCTGACCTTGCTG
GGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTAAGTAAAAGAAC

>In-frame_VAPB_ENST00000395802_chr20_56964573_+_IKZF3_ENST00000377944_chr17_37934022_-_1532nt
GCGCGCCCACCCGGTAGAGGACCCCCGCCCGTGCCCCGACCGGTCCCCGCCTTTTTGTAAAACTTAAAGCGGGCGCAGCATTAACGCTTC
CCGCCCCGGTGACCTCTCAGGGGTCTCCCCGCCAAAGGTGCTCCGCCGCTAAGGAACATGGCGAAGGTGGAGCAGGTCCTGAGCCTCGAG
CCGCAGCACGAGCTCAAATTCCGAGCAAGTGCGGAGGCAAGACACATCAAAGCAGAGATGGGAAGTGAAAGAGCTCTCGTACTGGACAGA
TTAGCAAGCAATGTGGCAAAACGAAAAAGCTCAATGCCTCAGAAATTCATTGGTGAGAAGCGCCACTGCTTTGATGTCAACTATAATTCA
AGTTACATGTATGAGAAAGAGAGTGAGCTCATACAGACCCGCATGATGGACCAAGCCATCAATAACGCCATCAGCTATCTTGGCGCCGAA
GCCCTGCGCCCCTTGGTCCAGACACCGCCTGCTCCCACCTCGGAGATGGTTCCAGTTATCAGCAGCATGTATCCCATAGCCCTCACCCGG
GCTGAGATGTCAAACGGTGCCCCTCAAGAGCTGGAAAAGAAAAGCATCCACCTTCCAGAGAAGAGCGTGCCTTCTGAGAGAGGCCTCTCT
CCCAACAATAGTGGCCACGACTCCACGGACACTGACAGCAACCATGAAGAACGCCAGAATCACATCTATCAGCAAAATCACATGGTCCTG
TCTCGGGCCCGCAATGGGATGCCACTTCTGAAGGAGGTTCCCCGCTCTTACGAACTCCTCAAGCCCCCGCCCATCTGCCCAAGAGACTCC
GTCAAAGTGATCAACAAGGAAGGGGAGGTGATGGATGTGTATCGGTGTGACCACTGCCGCGTCCTCTTCCTGGACTATGTGATGTTCACG
ATTCACATGGGCTGCCACGGCTTCCGTGACCCTTTCGAGTGTAACATGTGTGGATATCGAAGCCATGATCGGTATGAGTTCTCGTCTCAC
ATAGCCAGAGGAGAACACAGAGCCCTGCTGAAGTGAATATCTGGTCTCAGGGATTGCTCCTATGTATTCAGCATCGTTTCTAAAAACCAA
TGACCTCGCCTAACAGATTGCTCTCAAAACATACTCAGTTCCAAACTTCTTTTCATACCATTTTTAGCTGTGTTCACAGGGGTAGCCAGG
GAAACACTGTCTTCCTTCAGAAATTATTCGCAGGTCTAGCATATTATTACTTTTGTGAAACCTTTGTTTTCCCATCAGGGACTTGAATTT
TATGGAATTTAAAAGCCAAAAAGGTATTTGGTCATTATCTTCTACAGCAGTGGAATGAGTGGTCCCGGAGATGTGCTATATGAAACATTC
TTTCTGAGATATATCAACCACACGTGGAAAAGCCTTTCAGTCATACATGCAAATCCACAAAGAGGAAGAGCTGACCAGCTGACCTTGCTG
GGAAGCCTCACCCTTCTGCCCTTCACAGGCTGAAGGGTTAAGATCTAATCTCCCTAATCTAAATGACAGTCTAAGAGTAAGTAAAAGAAC


Top

FusionGenePPI for VAPB_IKZF3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VAPBSTX1A, STX2, STX5, STX4, STX1B, VAMP1, VAMP2, VAPA, USP20, OSBPL9, INSIG1, UQCRFS1, S100A16, TJP1, HNRNPC, VCL, PITRM1, VDAC3, OXCT1, SEPT9, SEC22B, MPST, SCAF4, VKORC1, MTNR1A, UBL4A, VHL, PRKACA, PRKACB, FAF1, VCP, ASNA1, UBC, BAG6, GET4, RPN2, DDOST, RAB3GAP1, RAB3GAP2, WDR44, OSBP, OSBP2, OSBPL2, OSBPL3, OSBPL6, OSBPL10, OSBPL11, PITPNM1, TTC1, GPR25, RMDN2, FAF2, PPT1, FAM170A, SYNE4, PRKAR2B, LTBR, TTC39B, AKAP11, LSG1, RMDN3, TACC1, SYNRG, VPS13A, OSBPL1A, CCNB2, POTEF, STK4, CEBPZ, SNX5, NDUFA7, RB1CC1, ARHGEF12, AFTPH, BRIP1, AHCTF1, ACBD5, SLC6A15, NDUFB8, SNX6, UBE4A, STARD3, SNX2, NACAD, CTU2, JMY, ZDBF2, RFT1, ACBD4, SNX25, SLC7A2, PITPNM2, RHBDD3, FAM83G, PRKAR1B, USP33, NBR1, NDUFV3, FAM118B, FAM73B, ND5, SLC26A2, NOL11, SLC25A35, HEATR5B, RASSF3, ABCE1, COX4I1, COX5B, SSR4, UQCRC2, CAND1, MORF4L1, MORF4L2, SCD, NTRK1, TCTN2, TMEM216, ERBB2, PKN2, ATL3, GOLT1B, YBX1, ESRRB, NFATC2, CDH1, TPTE, DUSP9, EYA2, MTMR12, RASSF1, MPRIP, RAI14, MAP4K3, MICAL3, SYNE2, TRIOBP, NDUFS4, DOPEY1, SPEG, PRKACG, STK3, SLC39A8, NDUFA12, NDUFS6, CELSR2, PITPNM3, PRKAR1A, NDUFB3, VPS13C, SLC39A9, GPN3, PTPN5, INTU, CCDC40IKZF3UBE2I, SIN3A, SIN3B, HDAC2, HDAC4, HDAC5, HDAC7, CHD4, IKZF4, IKZF5, IKZF2, HRAS, BCL2L1, IKZF1, NOTCH1, FOXP3, CRBN, UBC, ARNT2, DGCR6, PRKAB2, AES, AQP1, RHOA, CDKN1A, CDKN2D, GEM, GRB2, HNRNPF, KRT19, LMO1, LMO2, PFDN5, PIK3R2, PIN1, PRKAA1, PSMA1, RAD51D, STK16, STX11, POLR1C, EMC2, FAM115A, AKAP9, BCAS2, KAT5, MRPL28, FARS2, NEK6, IKZF3, ABLIM3, PPP1R16B, POLM, OSGIN1, CHCHD2, SPG21, OAZ3, C1orf109, MAGOHB, FANCL, TBC1D22B, RCOR3, PCID2, CABP5, LGALS14, EXOSC5, STAMBPL1, TRAPPC6A, ARMC7, TSSK3, ING5, ZGPAT, FBF1, ATPAF2, EFHC1, MRPL53, EXOC8, TEKT4, TSTD2, NATD1, MORN3, TRIM42, ARMC8, SETMAR, DGCR14, GID4, MAD1L1, LDOC1, STK26, SUMO1, PRDM1, CUL4A, GATAD2B, TRIM25, SMARCB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VAPB_IKZF3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VAPB_IKZF3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneVAPBC1837728AMYOTROPHIC LATERAL SCLEROSIS 8 (disorder)4CTD_human;UNIPROT
TgeneIKZF3C0003873Rheumatoid Arthritis1CTD_human
TgeneIKZF3C0004096Asthma1CTD_human
TgeneIKZF3C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human