FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4122

FusionGeneSummary for BEST3_PTPRR

check button Fusion gene summary
Fusion gene informationFusion gene name: BEST3_PTPRR
Fusion gene ID: 4122
HgeneTgene
Gene symbol

BEST3

PTPRR

Gene ID

144453

5801

Gene namebestrophin 3protein tyrosine phosphatase, receptor type R
SynonymsVMD2L3EC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Cytomap

12q15

12q15

Type of geneprotein-codingprotein-coding
Descriptionbestrophin-3vitelliform macular dystrophy 2-like 3vitelliform macular dystrophy 2-like protein 3receptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1
Modification date2018052320180519
UniProtAcc

Q8N1M1

Q15256

Ensembl transtripts involved in fusion geneENST00000331471, ENST00000488961, 
ENST00000330891, ENST00000553096, 
ENST00000476098, ENST00000266661, 
ENST00000551160, ENST00000393365, 
ENST00000533674, 
ENST00000283228, 
ENST00000440835, ENST00000537619, 
ENST00000378778, ENST00000342084, 
ENST00000549308, 
Fusion gene scores* DoF score3 X 3 X 1=933 X 13 X 10=4290
# samples 331
** MAII scorelog2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(31/4290*10)=-3.79063752711267
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BEST3 [Title/Abstract] AND PTPRR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-3B-A9HS-01ABEST3chr12

70065208

-PTPRRchr12

71158558

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000331471ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000331471ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000331471ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000331471ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000331471ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000331471ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
Frame-shitENST00000488961ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000488961ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000488961ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000488961ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000488961ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000488961ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
In-frameENST00000330891ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000330891ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000330891ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000330891ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000330891ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000330891ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
In-frameENST00000553096ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000553096ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000553096ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000553096ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000553096ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000553096ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
In-frameENST00000476098ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000476098ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000476098ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000476098ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000476098ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
5CDS-intronENST00000476098ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-3CDSENST00000266661ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000266661ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000266661ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000266661ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000266661ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000266661ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-3CDSENST00000551160ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000551160ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000551160ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000551160ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000551160ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000551160ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-3CDSENST00000393365ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000393365ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000393365ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000393365ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000393365ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000393365ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-3CDSENST00000533674ENST00000283228BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000533674ENST00000440835BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000533674ENST00000537619BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000533674ENST00000378778BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000533674ENST00000342084BEST3chr12

70065208

-PTPRRchr12

71158558

-
intron-intronENST00000533674ENST00000549308BEST3chr12

70065208

-PTPRRchr12

71158558

-

Top

FusionProtFeatures for BEST3_PTPRR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BEST3

Q8N1M1

PTPRR

Q15256

Forms calcium-sensitive chloride channels. Permeable tobicarbonate. {ECO:0000269|PubMed:12907679}. Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-910229_249366669IntramembraneOntology_term=ECO:0000255
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-910229_249366399IntramembraneOntology_term=ECO:0000255
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-9101_25366669Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-910200_228366669Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-910250_270366669Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-91047_70366669Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-91092_178366669Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-9101_25366399Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-910200_228366399Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-910250_270366399Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-91047_70366399Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-91092_178366399Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-561_25153456Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-5647_70153456Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-910179_199366669TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-91026_46366669TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-910271_291366669TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-91071_91366669TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-910179_199366399TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-91026_46366399TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-910271_291366399TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-91071_91366399TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-5626_46153456TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-5671_91153456TransmembraneHelical
TgenePTPRRchr12:70065208chr12:71158558ENST00000283228-114393_647119658DomainTyrosine-protein phosphatase
TgenePTPRRchr12:70065208chr12:71158558ENST00000342084-013393_6477546DomainTyrosine-protein phosphatase
TgenePTPRRchr12:70065208chr12:71158558ENST00000378778-011393_6470452DomainTyrosine-protein phosphatase
TgenePTPRRchr12:70065208chr12:71158558ENST00000440835-010393_647-156413DomainTyrosine-protein phosphatase
TgenePTPRRchr12:70065208chr12:71158558ENST00000549308-011393_647-80413DomainTyrosine-protein phosphatase
TgenePTPRRchr12:70065208chr12:71158558ENST00000283228-114588_594119658RegionSubstrate binding
TgenePTPRRchr12:70065208chr12:71158558ENST00000342084-013588_5947546RegionSubstrate binding
TgenePTPRRchr12:70065208chr12:71158558ENST00000378778-011588_5940452RegionSubstrate binding
TgenePTPRRchr12:70065208chr12:71158558ENST00000440835-010588_594-156413RegionSubstrate binding
TgenePTPRRchr12:70065208chr12:71158558ENST00000549308-011588_594-80413RegionSubstrate binding
TgenePTPRRchr12:70065208chr12:71158558ENST00000283228-114249_657119658Topological domainCytoplasmic
TgenePTPRRchr12:70065208chr12:71158558ENST00000342084-01322_2277546Topological domainExtracellular
TgenePTPRRchr12:70065208chr12:71158558ENST00000342084-013249_6577546Topological domainCytoplasmic
TgenePTPRRchr12:70065208chr12:71158558ENST00000378778-01122_2270452Topological domainExtracellular
TgenePTPRRchr12:70065208chr12:71158558ENST00000378778-011249_6570452Topological domainCytoplasmic
TgenePTPRRchr12:70065208chr12:71158558ENST00000440835-01022_227-156413Topological domainExtracellular
TgenePTPRRchr12:70065208chr12:71158558ENST00000440835-010249_657-156413Topological domainCytoplasmic
TgenePTPRRchr12:70065208chr12:71158558ENST00000549308-01122_227-80413Topological domainExtracellular
TgenePTPRRchr12:70065208chr12:71158558ENST00000549308-011249_657-80413Topological domainCytoplasmic
TgenePTPRRchr12:70065208chr12:71158558ENST00000283228-114228_248119658TransmembraneHelical
TgenePTPRRchr12:70065208chr12:71158558ENST00000342084-013228_2487546TransmembraneHelical
TgenePTPRRchr12:70065208chr12:71158558ENST00000378778-011228_2480452TransmembraneHelical
TgenePTPRRchr12:70065208chr12:71158558ENST00000440835-010228_248-156413TransmembraneHelical
TgenePTPRRchr12:70065208chr12:71158558ENST00000549308-011228_248-80413TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-13229_249-11573IntramembraneOntology_term=ECO:0000255
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-15229_249-16473IntramembraneOntology_term=ECO:0000255
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-56229_249153456IntramembraneOntology_term=ECO:0000255
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-14229_249-11973IntramembraneOntology_term=ECO:0000255
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-131_25-11573Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-13200_228-11573Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-13250_270-11573Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-13292_668-11573Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-1347_70-11573Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-1392_178-11573Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000330891-910292_668366669Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000331471-910292_668366399Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-151_25-16473Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-15200_228-16473Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-15250_270-16473Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-15292_668-16473Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-1547_70-16473Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-1592_178-16473Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-56200_228153456Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-56250_270153456Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-56292_668153456Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-5692_178153456Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-141_25-11973Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-14200_228-11973Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-14250_270-11973Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-14292_668-11973Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-1447_70-11973Topological domainExtracellular
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-1492_178-11973Topological domainCytoplasmic
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-13179_199-11573TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-1326_46-11573TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-13271_291-11573TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000266661-1371_91-11573TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-15179_199-16473TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-1526_46-16473TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-15271_291-16473TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000393365-1571_91-16473TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-56179_199153456TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000488961-56271_291153456TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-14179_199-11973TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-1426_46-11973TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-14271_291-11973TransmembraneHelical
HgeneBEST3chr12:70065208chr12:71158558ENST00000551160-1471_91-11973TransmembraneHelical
TgenePTPRRchr12:70065208chr12:71158558ENST00000283228-11422_227119658Topological domainExtracellular


Top

FusionGeneSequence for BEST3_PTPRR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BEST3_ENST00000331471_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_539aa
TLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPE
KNVLQGQHEADKIWSKEGFTAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVL
NVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVAS
SHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTILPNPLSRVCLRPKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQM
VWQEDSPVIVMITKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLML

>In-frame_BEST3_ENST00000330891_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_539aa
TLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPE
KNVLQGQHEADKIWSKEGFTAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVL
NVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVAS
SHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTILPNPLSRVCLRPKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQM
VWQEDSPVIVMITKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLML

>In-frame_BEST3_ENST00000553096_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_539aa
TLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPE
KNVLQGQHEADKIWSKEGFTAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVL
NVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVAS
SHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTILPNPLSRVCLRPKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQM
VWQEDSPVIVMITKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLML

>In-frame_BEST3_ENST00000476098_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_539aa
TLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPE
KNVLQGQHEADKIWSKEGFTAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVL
NVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVAS
SHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTILPNPLSRVCLRPKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQM
VWQEDSPVIVMITKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLML


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BEST3_ENST00000331471_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_1617nt
ACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAG
CAAGTGCACATCAATCGCCTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGAAAAACAGGAATTTCTGATGCT
CTGCCCTCTGAGGAAGTTCTTCGTTCACTTAATATCAATGTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAG
AAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTT
ATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATC
CACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTG
AATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAG
CCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATA
CCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGT
TCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAAT
CGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCT
AATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATG
GTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGA
GGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGC
CACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTG
GATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATT
GCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGA

>In-frame_BEST3_ENST00000330891_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_1617nt
ACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAG
CAAGTGCACATCAATCGCCTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGAAAAACAGGAATTTCTGATGCT
CTGCCCTCTGAGGAAGTTCTTCGTTCACTTAATATCAATGTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAG
AAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTT
ATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATC
CACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTG
AATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAG
CCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATA
CCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGT
TCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAAT
CGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCT
AATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATG
GTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGA
GGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGC
CACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTG
GATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATT
GCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGA

>In-frame_BEST3_ENST00000553096_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_1617nt
ACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAG
CAAGTGCACATCAATCGCCTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGAAAAACAGGAATTTCTGATGCT
CTGCCCTCTGAGGAAGTTCTTCGTTCACTTAATATCAATGTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAG
AAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTT
ATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATC
CACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTG
AATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAG
CCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATA
CCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGT
TCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAAT
CGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCT
AATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATG
GTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGA
GGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGC
CACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTG
GATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATT
GCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGA

>In-frame_BEST3_ENST00000476098_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_1617nt
ACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAG
CAAGTGCACATCAATCGCCTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGAAAAACAGGAATTTCTGATGCT
CTGCCCTCTGAGGAAGTTCTTCGTTCACTTAATATCAATGTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAG
AAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTT
ATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATC
CACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTG
AATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAG
CCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATA
CCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGT
TCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAAT
CGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCT
AATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATG
GTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGA
GGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGC
CACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTG
GATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATT
GCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BEST3_ENST00000331471_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_3991nt
GGGTCCTCTCAGTGGCCAGAGAACAGAAAGAAAATCTGACTGTGCACGAGCGAAGGGTGACACCGGGCGTGCAGCACCGACCTGAAGGCA
CCTCTTCGGGGGAGCCCGAAATTTGAAGATTCTCTTTCCTGTCGGAGACTACAAACCAAATAAATAGAAAAAACTATCCAAGATGACTGT
CACTTACTCCAGTAAAGTAGCAAATGCAACTTTTTTTGGATTTCATAGGTTACTCCTCAAGTGGAGAGGCAGCATCTACAAACTACTGTA
CAGGGAATTTATTGTTTTTGCTGTTCTTTATACAGCAATAAGTTTGGTATACAGATTGTTACTTACAGGAGTCCAAAAACGTTACTTTGA
AAAATTATCAATTTACTGTGACAGATATGCTGAACAAATTCCAGTAACCTTTGTGCTTGGGTTTTATGTTACTCTGGTAGTGAACCGATG
GTGGAACCAGTTTGTGAATTTGCCCTGGCCAGACAGGCTAATGTTCCTCATCTCTAGCAGTGTTCACGGAAGCGACGAGCACGGGCGCCT
GCTTAGAAGGACGCTGATGCGCTACGTCAATCTCACCTCCCTGCTCATCTTTCGCTCGGTGAGCACTGCTGTGTACAAAAGATTTCCCAC
AATGGACCACGTGGTTGAAGCAGGTTTTATGACAACAGATGAAAGGAAATTATTCAACCACCTCAAGTCTCCTCATCTGAAATATTGGGT
TCCATTCATCTGGTTTGGAAATCTTGCAACTAAAGCCCGGAATGAAGGTAGAATCAGAGACAGTGTTGATCTGCAATCATTGATGACTGA
AATGAATCGATACCGCTCTTGGTGCAGCCTCTTATTCGGTTATGACTGGGTTGGGATTCCGCTGGTTTACACCCAGGTTGTCACTCTTGC
TGTCTATACCTTCTTCTTTGCGTGCCTGATTGGACGCCAGTTTTTGGATCCCACCAAAGGCTACGCAGGGCATGACTTGGATCTTTACAT
TCCCATCTTCACCCTCCTACAATTCTTCTTCTATGCAGGATGGCTTAAGGTAGCAGAGCAGCTTATCAACCCTTTTGGAGAAGATGATGA
TGATTTTGAAACTAACTGGTGCATTGACAGAAATTTGCAGGTCTCTCTTTTAGCTGTGGACGAAATGCACATGAGCTTACCCAAGATGAA
GAAGGACATTTACTGGGACGATTCTGCTGCTCGCCCACCATACACATTGGCAGCTGCTGACTACTGCATACCCTCATTTCTGGGGTCAAC
AGTCCAGATGGGACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGA
CTCTTACCCCAGCAAGTGCACATCAATCGCCTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGAAAAACAGGA
ATTTCTGATGCTCTGCCCTCTGAGGAAGTTCTTCGTTCACTTAATATCAATGTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAA
GTCTCTCCTGAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTCATTTTTCTC
AGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAA
AACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCC
CCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCT
TTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCC
TTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGAC
GTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCAT
GGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACC
TACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGAT
TTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGG
CCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTA
AAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTA
CAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACA
GGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATG
GATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACT
GTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCC
TGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGT
GTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGC
AGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGA
TGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTT
CCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGT
CTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATA
GTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCT
GCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAA
GAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGC
CTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCT
TCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATGCAGCAATGTTGACTT

>In-frame_BEST3_ENST00000330891_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_4046nt
ATAAACAGGCCTCTACAAGTGGAAAAACATTTAACCCCTGTTCTTGTCACACTCTGGGTCCTCTCAGTGGCCAGAGAACAGAAAGAAAAT
CTGACTGTGCACGAGCGAAGGGTGACACCGGGCGTGCAGCACCGACCTGAAGGCACCTCTTCGGGGGAGCCCGAAATTTGAAGATTCTCT
TTCCTGTCGGAGACTACAAACCAAATAAATAGAAAAAACTATCCAAGATGACTGTCACTTACTCCAGTAAAGTAGCAAATGCAACTTTTT
TTGGATTTCATAGGTTACTCCTCAAGTGGAGAGGCAGCATCTACAAACTACTGTACAGGGAATTTATTGTTTTTGCTGTTCTTTATACAG
CAATAAGTTTGGTATACAGATTGTTACTTACAGGAGTCCAAAAACGTTACTTTGAAAAATTATCAATTTACTGTGACAGATATGCTGAAC
AAATTCCAGTAACCTTTGTGCTTGGGTTTTATGTTACTCTGGTAGTGAACCGATGGTGGAACCAGTTTGTGAATTTGCCCTGGCCAGACA
GGCTAATGTTCCTCATCTCTAGCAGTGTTCACGGAAGCGACGAGCACGGGCGCCTGCTTAGAAGGACGCTGATGCGCTACGTCAATCTCA
CCTCCCTGCTCATCTTTCGCTCGGTGAGCACTGCTGTGTACAAAAGATTTCCCACAATGGACCACGTGGTTGAAGCAGGTTTTATGACAA
CAGATGAAAGGAAATTATTCAACCACCTCAAGTCTCCTCATCTGAAATATTGGGTTCCATTCATCTGGTTTGGAAATCTTGCAACTAAAG
CCCGGAATGAAGGTAGAATCAGAGACAGTGTTGATCTGCAATCATTGATGACTGAAATGAATCGATACCGCTCTTGGTGCAGCCTCTTAT
TCGGTTATGACTGGGTTGGGATTCCGCTGGTTTACACCCAGGTTGTCACTCTTGCTGTCTATACCTTCTTCTTTGCGTGCCTGATTGGAC
GCCAGTTTTTGGATCCCACCAAAGGCTACGCAGGGCATGACTTGGATCTTTACATTCCCATCTTCACCCTCCTACAATTCTTCTTCTATG
CAGGATGGCTTAAGGTAGCAGAGCAGCTTATCAACCCTTTTGGAGAAGATGATGATGATTTTGAAACTAACTGGTGCATTGACAGAAATT
TGCAGGTCTCTCTTTTAGCTGTGGACGAAATGCACATGAGCTTACCCAAGATGAAGAAGGACATTTACTGGGACGATTCTGCTGCTCGCC
CACCATACACATTGGCAGCTGCTGACTACTGCATACCCTCATTTCTGGGGTCAACAGTCCAGATGGGACACTGCAAATGGATGTAAACAA
GCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAAGTGCACATCAATCGCCTCAT
TGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGAAAAACAGGAATTTCTGATGCTCTGCCCTCTGAGGAAGTTCTTCG
TTCACTTAATATCAATGTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAGAAAAATGTTTTACAAGGGCAGCA
TGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGAT
TCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACA
GCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGG
CCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAG
AGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGC
AATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATT
CATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAA
TCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGG
CAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGT
GATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGT
TCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTA
CTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGC
TTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACA
GCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTA
TGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCA
ATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATG
TATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTA
TTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCA
CACAGAATGTATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGAT
GCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACC
AGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAA
CTATTTTATATGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGAT
TGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGT
GAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAG
GGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGG
CTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCA

>In-frame_BEST3_ENST00000553096_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_3653nt
CCGACCTGAAGGCACCTCTTCGGGGGAGCCCGAAATTTGAAGATTCTCTTTCCTGTCGGAGACTACAAACCAAATAAATAGGGTTTTATG
TTACTCTGGTAGTGAACCGATGGTGGAACCAGTTTGTGAATTTGCCCTGGCCAGACAGGCTAATGTTCCTCATCTCTAGCAGTGTTCACG
GAAGCGACGAGCACGGGCGCCTGCTTAGAAGGACGCTGATGCGCTACGTCAATCTCACCTCCCTGCTCATCTTTCGCTCGGTGAGCACTG
CTGTGTACAAAAGATTTCCCACAATGGACCACGTGGTTGAAGCAGGTTTTATGACAACAGATGAAAGGAAATTATTCAACCACCTCAAGT
CTCCTCATCTGAAATATTGGGTTCCATTCATCTGGTTTGGAAATCTTGCAACTAAAGCCCGGAATGAAGGTAGAATCAGAGACAGTGTTG
ATCTGCAATCATTGATGACTGAAATGAATCGATACCGCTCTTGGTGCAGCCTCTTATTCGGTTATGACTGGGTTGGGATTCCGCTGGTTT
ACACCCAGGTTGTCACTCTTGCTGTCTATACCTTCTTCTTTGCGTGCCTGATTGGACGCCAGTTTTTGGATCCCACCAAAGGCTACGCAG
GGCATGACTTGGATCTTTACATTCCCATCTTCACCCTCCTACAATTCTTCTTCTATGCAGGATGGCTTAAGGTAGCAGAGCAGCTTATCA
ACCCTTTTGGAGAAGATGATGATGATTTTGAAACTAACTGGTGCATTGACAGAAATTTGCAGGTCTCTCTTTTAGCTGTGGACGAAATGC
ACATGAGCTTACCCAAGATGAAGAAGGACATTTACTGGGACGATTCTGCTGCTCGCCCACCATACACATTGGCAGCTGCTGACTACTGCA
TACCCTCATTTCTGGGGTCAACAGTCCAGATGGGACACTGCAAATGGATGTAAACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCA
AGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAAGTGCACATCAATCGCCTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTC
TCCCATAAACCGAAAAACAGGAATTTCTGATGCTCTGCCCTCTGAGGAAGTTCTTCGTTCACTTAATATCAATGTTTTGCATCAAAGTTT
ATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAGAAAAATGTTTTACAAGGGCAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATT
TTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTGATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTC
CTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACATTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAG
CATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCTCAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGC
TACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAGAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAG
TAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCT
CACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAA
AGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAA
TGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCC
CATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAA
TGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTA
CACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCC
AGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTG
CAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAG
CATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGA
GAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCC
AAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATA
TTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATA
GGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAA
ATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATG
GACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGAT
AATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATT
ACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATT
ATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATT
TGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTC
TCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTA
CATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATT

>In-frame_BEST3_ENST00000476098_chr12_70065208_-_PTPRR_ENST00000283228_chr12_71158558_-_3511nt
AGTGGCCAGAGAACAGAAAGAAAATCTGACTGTGCACGAGCGAAGGGTGACACCGGGCGTGCAGCACCGACCTGAAGGCACCTCTTCGGG
GGAGCCCGAAATTTGAAGATTCTCTTTCCTGTCGGAGACTACAAACCAAATAAATAGGGTTTTATGTTACTCTGGTAGTGAACCGATGGT
GGAACCAGTTTGTGAATTTGCCCTGGCCAGACAGGCTAATGTTCCTCATCTCTAGCAGTGTTCACGGAAGCGACGAGCACGGGCGCCTGC
TTAGAAGGACGCTGATGCGCTACGTCAATCTCACCTCCCTGCTCATCTTTCGCTCGGTTTTATGACAACAGATGAAAGGAAATTATTCAA
CCACCTCAAGTCTCCTCATCTGAAATATTGGGTTCCATTCATCTGGTTTGGAAATCTTGCAACTAAAGCCCGGAATGAAGGTAGAATCAG
AGACAGTGTTGATCTGCAATCATTGATGACTGAAATGAATCGATACCGCTCTTGGTGCAGCCTCTTATTCGGTTATGACTGGGTTGGGAT
TCCGCTGGTTTACACCCAGGTAGCAGAGCAGCTTATCAACCCTTTTGGAGAAGATGATGATGATTTTGAAACTAACTGGTGCATTGACAG
AAATTTGCAGGTCTCTCTTTTAGCTGTGGACGAAATGCACATGAGCTTACCCAAGATGAAGAAGGACATTTACTGGGACGATTCTGCTGC
TCGCCCACCATACACATTGGCAGCTGCTGACTACTGCATACCCTCATTTCTGGGGTCAACAGTCCAGATGGGACACTGCAAATGGATGTA
AACAAGCTGAACATAACCTTGCTTCGGATCTTCCGCCAAGGAGTGGCTGCAGCTTTAGGACTCTTACCCCAGCAAGTGCACATCAATCGC
CTCATTGGAAAGAAGAACAGTATTGAACTGTTTGTGTCTCCCATAAACCGAAAAACAGGAATTTCTGATGCTCTGCCCTCTGAGGAAGTT
CTTCGTTCACTTAATATCAATGTTTTGCATCAAAGTTTATCCCAGTTTGGAATTACAGAAGTCTCTCCTGAGAAAAATGTTTTACAAGGG
CAGCATGAAGCGGACAAAATCTGGAGCAAAGAAGGATTTTATGCTGTTGTCATTTTTCTCAGCATCTTTGTTATTATAGTAACGTGTTTG
ATGATTCTTTACAGATTAAAAGAAAGATTTCAGCTTTCCTTAAGACAAGACAAAGAGAAAAACCAGGAGATCCACCTATCGCCCATCACA
TTACAGCCAGCACTGTCCGAGGCAAAGACAGTCCACAGCATGGTCCAACCTGAGCAGGCCCCAAAGGTACTGAATGTTGTCGTGGACCCT
CAAGGCCGAGGTGCTCCTGAGATCAAAGCTACCACCGCTACCTCTGTTTGCCCTTCTCCTTTCAAAATGAAGCCCATAGGACTTCAAGAG
AGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAG
GTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGT
GAATTCATGGAAATACCAATGAACTTTGTGGATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTA
CCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTAC
AGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGC
CCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTT
GAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAG
CATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGA
CTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGT
CAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAG
CAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGAC
CATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGC
CCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCA
AATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATC
TGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGT
TAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAG
TTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAAC
AGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACA
ATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCAC
ATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTA
AGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTT
CGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTAC
CCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATGCAGCAATGTTGACTTTGTTTCATACTGCCAATAAACTCTTAATAC


Top

FusionGenePPI for BEST3_PTPRR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BEST3PTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BEST3_PTPRR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BEST3_PTPRR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePTPRRC0041696Unipolar Depression1PSYGENET
TgenePTPRRC1269683Major Depressive Disorder1PSYGENET