FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40996

FusionGeneSummary for USP18_DAPK2

check button Fusion gene summary
Fusion gene informationFusion gene name: USP18_DAPK2
Fusion gene ID: 40996
HgeneTgene
Gene symbol

USP18

DAPK2

Gene ID

11274

23604

Gene nameubiquitin specific peptidase 18death associated protein kinase 2
SynonymsISG43|PTORCH2|UBP43DRP-1|DRP1
Cytomap

22q11.21

15q22.31

Type of geneprotein-codingprotein-coding
Descriptionubl carboxyl-terminal hydrolase 1843 kDa ISG15-specific proteaseISG15-specific-processing proteasehUBP43ubiquitin specific protease 18ubl thioesterase 18ubl thiolesterase 18death-associated protein kinase 2DAP kinase 2DAP-kinase-related protein 1 beta isoform
Modification date2018052320180526
UniProtAcc

Q9UMW8

Q9UIK4

Ensembl transtripts involved in fusion geneENST00000215794, ENST00000261891, 
ENST00000457488, ENST00000558069, 
ENST00000558482, 
Fusion gene scores* DoF score4 X 5 X 4=806 X 7 X 7=294
# samples 410
** MAII scorelog2(4/80*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/294*10)=-1.55581615506164
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: USP18 [Title/Abstract] AND DAPK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneDAPK2

GO:0006468

protein phosphorylation

10376525

TgeneDAPK2

GO:0035556

intracellular signal transduction

10376525


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-DD-A73F-01AUSP18chr22

18643035

+DAPK2chr15

64275953

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000215794ENST00000261891USP18chr22

18643035

+DAPK2chr15

64275953

-
In-frameENST00000215794ENST00000457488USP18chr22

18643035

+DAPK2chr15

64275953

-
In-frameENST00000215794ENST00000558069USP18chr22

18643035

+DAPK2chr15

64275953

-
5CDS-5UTRENST00000215794ENST00000558482USP18chr22

18643035

+DAPK2chr15

64275953

-

Top

FusionProtFeatures for USP18_DAPK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
USP18

Q9UMW8

DAPK2

Q9UIK4

Involved in the regulation of inflammatory response tointerferon type 1 (PubMed:27325888). Can efficiently cleave onlyISG15 fusions including native ISG15 conjugates linked viaisopeptide bonds. Necessary to maintain a critical cellularbalance of ISG15-conjugated proteins in both healthy and stressedorganisms. {ECO:0000269|PubMed:27325888}. Isoform 2: Has enzymatic activity similar to isoform 1and interferes with type I interferon signaling. MajordeISGylation enzyme for nuclear proteins (PubMed:22170061).{ECO:0000269|PubMed:22170061}. Calcium/calmodulin-dependent serine/threonine kinaseinvolved in multiple cellular signaling pathways that trigger cellsurvival, apoptosis, and autophagy. Regulates both type Iapoptotic and type II autophagic cell death signals, depending onthe cellular setting. The former is caspase-dependent, while thelatter is caspase-independent and is characterized by theaccumulation of autophagic vesicles. Acts as a mediator of anoikisand a suppressor of beta-catenin-dependent anchorage-independentgrowth of malignant epithelial cells. May play a role ingranulocytic maturation (PubMed:17347302). Regulates granulocyticmotility by controlling cell spreading and polarization(PubMed:24163421). {ECO:0000269|PubMed:17347302,ECO:0000269|PubMed:24163421, ECO:0000269|PubMed:26047703}. Isoform 2 is not regulated by calmodulin. It canphosphorylate MYL9. It can induce membrane blebbing and autophagiccell death.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDAPK2chr22:18643035chr15:64275953ENST00000261891-01129_3730371Nucleotide bindingATP
TgeneDAPK2chr22:18643035chr15:64275953ENST00000457488-11229_3730371Nucleotide bindingATP
TgeneDAPK2chr22:18643035chr15:64275953ENST00000558069-11029_3730489Nucleotide bindingATP
TgeneDAPK2chr22:18643035chr15:64275953ENST00000261891-011277_34430371RegionNote=Calmodulin-binding
TgeneDAPK2chr22:18643035chr15:64275953ENST00000261891-011292_30130371RegionAutoinhibitory domain
TgeneDAPK2chr22:18643035chr15:64275953ENST00000457488-112277_34430371RegionNote=Calmodulin-binding
TgeneDAPK2chr22:18643035chr15:64275953ENST00000457488-112292_30130371RegionAutoinhibitory domain
TgeneDAPK2chr22:18643035chr15:64275953ENST00000558069-110277_34430489RegionNote=Calmodulin-binding
TgeneDAPK2chr22:18643035chr15:64275953ENST00000558069-110292_30130489RegionAutoinhibitory domain

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUSP18chr22:18643035chr15:64275953ENST00000215794+31155_37084373DomainNote=USP
TgeneDAPK2chr22:18643035chr15:64275953ENST00000261891-01123_28530371DomainProtein kinase
TgeneDAPK2chr22:18643035chr15:64275953ENST00000457488-11223_28530371DomainProtein kinase
TgeneDAPK2chr22:18643035chr15:64275953ENST00000558069-11023_28530489DomainProtein kinase


Top

FusionGeneSequence for USP18_DAPK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000261891_chr15_64275953_-_425aa
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKSGQFAI
VKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEA
TSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI
TYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESVVNLENF

>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000457488_chr15_64275953_-_425aa
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKSGQFAI
VKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEA
TSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI
TYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESVVNLENF

>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000558069_chr15_64275953_-_543aa
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKSGQFAI
VKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEA
TSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI
TYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITSKGEGRAPEQRKTEPTQLKT
KHLREYTLKCHSSMPPNNSYVNFERFACVVEDVARVDLGCRALVEAHDTIQDDVEALVSIFNEKEAWYREENESARHDLSQLRYEFRKVE
SLKKLLREDIQATGCSLGSMARKLDHLQAQFEILRQELSADLQWIQELVGSFQLESGSSEGLGSTFYQDTSESLSELLSRSCTEEFLAGW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000261891_chr15_64275953_-_1275nt
ATGAGCAAGGCGTTTGGGCTCCTGAGGCAAATCTGTCAGTCCATCCTGGCTGAGTCCTCGCAGTCCCCGGCAGATCTTGAAGAAAAGAAG
GAAGAAGACAGCAACATGAAGAGAGAGCAGCCCAGAGAGCGTCCCAGGGCCTGGGACTACCCTCATGGCCTGGTTGGTTTACACAACATT
GGACAGACCTGCTGCCTTAACTCCTTGATTCAGGTGTTCGTAATGAATGTGGACTTCACCAGGATATTGAAGAGTGGCCAGTTTGCCATC
GTGAAGAAGTGCCGGGAGAAGAGCACGGGGCTTGAGTATGCAGCCAAGTTCATCAAGAAGCGGCAGAGCCGGGCGAGCCGGCGCGGTGTG
AGCCGGGAGGAGATCGAGCGGGAGGTGAGCATCCTGCGGCAGGTGCTGCACCACAATGTCATCACGCTGCACGACGTCTATGAGAACCGC
ACCGACGTGGTGCTCATCCTTGAGCTAGTGTCTGGAGGAGAGCTCTTCGATTTCCTGGCCCAGAAGGAGTCACTGAGTGAGGAGGAGGCC
ACCAGCTTCATTAAGCAGATCCTGGATGGGGTGAACTACCTTCACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATTATG
TTGTTAGACAAGAATATTCCCATTCCACACATCAAGCTGATTGACTTTGGTCTGGCTCACGAAATAGAAGATGGAGTTGAATTTAAGAAT
ATTTTTGGGACGCCGGAATTTGTTGCTCCAGAAATTGTGAACTACGAGCCCCTGGGTCTGGAGGCTGACATGTGGAGCATAGGCGTCATC
ACCTACATCCTCTTAAGTGGAGCATCCCCTTTCCTGGGAGACACGAAGCAGGAAACACTGGCAAATATCACAGCAGTGAGTTACGACTTT
GATGAGGAATTCTTCAGCCAGACGAGCGAGCTGGCCAAGGACTTTATTCGGAAGCTTCTGGTTAAAGAGACCCGGAAACGGCTCACAATC
CAAGAGGCTCTCAGACACCCCTGGATCACGCCGGTGGACAACCAGCAAGCCATGGTGCGCAGGGAGTCTGTGGTCAATCTGGAGAACTTC
AGGAAGCAGTATGTCCGCAGGCGGTGGAAGCTTTCCTTCAGCATCGTGTCCCTGTGCAACCACCTCACCCGCTCGCTGATGAAGAAGGTG
CACCTGAGGCCGGATGAGGACCTGAGGAACTGTGAGAGTGACACTGAGGAGGACATCGCCAGGAGGAAAGCCCTCCACCCACGGAGGAGG

>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000457488_chr15_64275953_-_1275nt
ATGAGCAAGGCGTTTGGGCTCCTGAGGCAAATCTGTCAGTCCATCCTGGCTGAGTCCTCGCAGTCCCCGGCAGATCTTGAAGAAAAGAAG
GAAGAAGACAGCAACATGAAGAGAGAGCAGCCCAGAGAGCGTCCCAGGGCCTGGGACTACCCTCATGGCCTGGTTGGTTTACACAACATT
GGACAGACCTGCTGCCTTAACTCCTTGATTCAGGTGTTCGTAATGAATGTGGACTTCACCAGGATATTGAAGAGTGGCCAGTTTGCCATC
GTGAAGAAGTGCCGGGAGAAGAGCACGGGGCTTGAGTATGCAGCCAAGTTCATCAAGAAGCGGCAGAGCCGGGCGAGCCGGCGCGGTGTG
AGCCGGGAGGAGATCGAGCGGGAGGTGAGCATCCTGCGGCAGGTGCTGCACCACAATGTCATCACGCTGCACGACGTCTATGAGAACCGC
ACCGACGTGGTGCTCATCCTTGAGCTAGTGTCTGGAGGAGAGCTCTTCGATTTCCTGGCCCAGAAGGAGTCACTGAGTGAGGAGGAGGCC
ACCAGCTTCATTAAGCAGATCCTGGATGGGGTGAACTACCTTCACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATTATG
TTGTTAGACAAGAATATTCCCATTCCACACATCAAGCTGATTGACTTTGGTCTGGCTCACGAAATAGAAGATGGAGTTGAATTTAAGAAT
ATTTTTGGGACGCCGGAATTTGTTGCTCCAGAAATTGTGAACTACGAGCCCCTGGGTCTGGAGGCTGACATGTGGAGCATAGGCGTCATC
ACCTACATCCTCTTAAGTGGAGCATCCCCTTTCCTGGGAGACACGAAGCAGGAAACACTGGCAAATATCACAGCAGTGAGTTACGACTTT
GATGAGGAATTCTTCAGCCAGACGAGCGAGCTGGCCAAGGACTTTATTCGGAAGCTTCTGGTTAAAGAGACCCGGAAACGGCTCACAATC
CAAGAGGCTCTCAGACACCCCTGGATCACGCCGGTGGACAACCAGCAAGCCATGGTGCGCAGGGAGTCTGTGGTCAATCTGGAGAACTTC
AGGAAGCAGTATGTCCGCAGGCGGTGGAAGCTTTCCTTCAGCATCGTGTCCCTGTGCAACCACCTCACCCGCTCGCTGATGAAGAAGGTG
CACCTGAGGCCGGATGAGGACCTGAGGAACTGTGAGAGTGACACTGAGGAGGACATCGCCAGGAGGAAAGCCCTCCACCCACGGAGGAGG

>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000558069_chr15_64275953_-_1629nt
ATGAGCAAGGCGTTTGGGCTCCTGAGGCAAATCTGTCAGTCCATCCTGGCTGAGTCCTCGCAGTCCCCGGCAGATCTTGAAGAAAAGAAG
GAAGAAGACAGCAACATGAAGAGAGAGCAGCCCAGAGAGCGTCCCAGGGCCTGGGACTACCCTCATGGCCTGGTTGGTTTACACAACATT
GGACAGACCTGCTGCCTTAACTCCTTGATTCAGGTGTTCGTAATGAATGTGGACTTCACCAGGATATTGAAGAGTGGCCAGTTTGCCATC
GTGAAGAAGTGCCGGGAGAAGAGCACGGGGCTTGAGTATGCAGCCAAGTTCATCAAGAAGCGGCAGAGCCGGGCGAGCCGGCGCGGTGTG
AGCCGGGAGGAGATCGAGCGGGAGGTGAGCATCCTGCGGCAGGTGCTGCACCACAATGTCATCACGCTGCACGACGTCTATGAGAACCGC
ACCGACGTGGTGCTCATCCTTGAGCTAGTGTCTGGAGGAGAGCTCTTCGATTTCCTGGCCCAGAAGGAGTCACTGAGTGAGGAGGAGGCC
ACCAGCTTCATTAAGCAGATCCTGGATGGGGTGAACTACCTTCACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATTATG
TTGTTAGACAAGAATATTCCCATTCCACACATCAAGCTGATTGACTTTGGTCTGGCTCACGAAATAGAAGATGGAGTTGAATTTAAGAAT
ATTTTTGGGACGCCGGAATTTGTTGCTCCAGAAATTGTGAACTACGAGCCCCTGGGTCTGGAGGCTGACATGTGGAGCATAGGCGTCATC
ACCTACATCCTCTTAAGTGGAGCATCCCCTTTCCTGGGAGACACGAAGCAGGAAACACTGGCAAATATCACAGCAGTGAGTTACGACTTT
GATGAGGAATTCTTCAGCCAGACGAGCGAGCTGGCCAAGGACTTTATTCGGAAGCTTCTGGTTAAAGAGACCCGGAAACGGCTCACAATC
CAAGAGGCTCTCAGACACCCCTGGATCACGTCAAAAGGAGAAGGCAGAGCCCCTGAACAGCGGAAGACAGAGCCCACCCAGCTGAAGACC
AAGCACCTGAGAGAGTACACTCTCAAATGCCACTCAAGCATGCCTCCCAACAACTCCTATGTCAACTTCGAGCGTTTTGCCTGTGTGGTG
GAAGACGTGGCTCGGGTCGACCTGGGATGCCGTGCCCTGGTGGAGGCCCACGATACCATCCAGGACGATGTGGAGGCCCTGGTCTCCATC
TTCAATGAGAAGGAAGCTTGGTACCGAGAGGAGAATGAGAGCGCCCGGCATGACCTGTCCCAGCTCAGGTATGAGTTCCGCAAGGTGGAG
TCATTGAAGAAGCTGCTGCGAGAAGACATCCAGGCCACGGGATGTAGCCTCGGAAGCATGGCCAGGAAACTGGACCATCTGCAAGCCCAG
TTTGAGATTCTGAGGCAGGAGCTCTCCGCAGACCTGCAGTGGATTCAGGAGCTGGTGGGCAGCTTCCAGCTGGAGAGTGGGAGCTCTGAG
GGCCTGGGCTCCACATTCTACCAGGACACCAGTGAATCCCTGTCAGAGCTGCTCAGCAGATCATGCACTGAGGAATTTCTGGCAGGCTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000261891_chr15_64275953_-_3189nt
GACAGAATGAGACTCCGTCTCAAAAAAAAAAAAAAAAAAAAAAAGCGAGGGCTGGAAGTCTGGAGCAGGTGCGCGGCTGCAACGGCAGCC
GCGGGAAGCTCGGGCCGGCAGGGTTTCCCCGCACGCTGGCGCCCAGCTCCCGGCGCGGAGGCCGCTGTAAGTTTCGCTTTCCATTCAGTG
GAAAACGAAAGCTGGGCGGGGTGCCACGAGCGCGGGGCCAGACCAAGGCGGGCCCGGAGCGGAACTTCGGTCCCAGCTCGGTCCCCGGCT
CAGTCCCGACGTGGAACTCAGCAGCGGAGGCTGGACGCTTGCATGGCGCTTGAGAGATTCCATCGTGCCTGGCTCACATAAGCGCTTCCT
GGAAGTGAAGTCGTGCTGTCCTGAACGCGGGCCAGGCAGCTGCGGCCTGGGGGTTTTGGAGTGATCACGAATGAGCAAGGCGTTTGGGCT
CCTGAGGCAAATCTGTCAGTCCATCCTGGCTGAGTCCTCGCAGTCCCCGGCAGATCTTGAAGAAAAGAAGGAAGAAGACAGCAACATGAA
GAGAGAGCAGCCCAGAGAGCGTCCCAGGGCCTGGGACTACCCTCATGGCCTGGTTGGTTTACACAACATTGGACAGACCTGCTGCCTTAA
CTCCTTGATTCAGGTGTTCGTAATGAATGTGGACTTCACCAGGATATTGAAGAGTGGCCAGTTTGCCATCGTGAAGAAGTGCCGGGAGAA
GAGCACGGGGCTTGAGTATGCAGCCAAGTTCATCAAGAAGCGGCAGAGCCGGGCGAGCCGGCGCGGTGTGAGCCGGGAGGAGATCGAGCG
GGAGGTGAGCATCCTGCGGCAGGTGCTGCACCACAATGTCATCACGCTGCACGACGTCTATGAGAACCGCACCGACGTGGTGCTCATCCT
TGAGCTAGTGTCTGGAGGAGAGCTCTTCGATTTCCTGGCCCAGAAGGAGTCACTGAGTGAGGAGGAGGCCACCAGCTTCATTAAGCAGAT
CCTGGATGGGGTGAACTACCTTCACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATTATGTTGTTAGACAAGAATATTCC
CATTCCACACATCAAGCTGATTGACTTTGGTCTGGCTCACGAAATAGAAGATGGAGTTGAATTTAAGAATATTTTTGGGACGCCGGAATT
TGTTGCTCCAGAAATTGTGAACTACGAGCCCCTGGGTCTGGAGGCTGACATGTGGAGCATAGGCGTCATCACCTACATCCTCTTAAGTGG
AGCATCCCCTTTCCTGGGAGACACGAAGCAGGAAACACTGGCAAATATCACAGCAGTGAGTTACGACTTTGATGAGGAATTCTTCAGCCA
GACGAGCGAGCTGGCCAAGGACTTTATTCGGAAGCTTCTGGTTAAAGAGACCCGGAAACGGCTCACAATCCAAGAGGCTCTCAGACACCC
CTGGATCACGCCGGTGGACAACCAGCAAGCCATGGTGCGCAGGGAGTCTGTGGTCAATCTGGAGAACTTCAGGAAGCAGTATGTCCGCAG
GCGGTGGAAGCTTTCCTTCAGCATCGTGTCCCTGTGCAACCACCTCACCCGCTCGCTGATGAAGAAGGTGCACCTGAGGCCGGATGAGGA
CCTGAGGAACTGTGAGAGTGACACTGAGGAGGACATCGCCAGGAGGAAAGCCCTCCACCCACGGAGGAGGAGCAGCACCTCCTAACTGGC
CTGACCTGCAGTGGCCGCCAGGGAGGTCTGGGCCCAGCGGGGCTCCCTTCTGTGCAGACTTTTGGACCCAGCTCAGCACCAGCACCCGGG
CGTCCTGAGCACTTTGCAAGAGAGATGGGCCCAAGGAATTCAGAAGAGCTTGCAGGCAAGCCAGGAGACCCTGGGAGCTGTGGCTGTCTT
CTGTGGAGGAGGCTCCAGCATTCCCAAAGCTCTTAATTCTCCATAAAATGGGCTTTCCTCTGTCTGCCATCCTCAGAGTCTGGGGTGGGA
GTGTGGACTTAGGAAAACAATATAAAGGACATCCTCATCATCACGGGGTGAAGGTCAGACTAAGGCAGCCTTCTTCACAGGCTGAGGGGG
TTCAGAACCAGCCTGGCCAAAAATTACACCAGAGAGACAGAGTCCTCCCCATTGGGAACAGGGTGATTGAGGAAAGTGAACCTTGGGTGT
GAGGGACCAATCCTGTGACCTCCCAGAACCATGGAAGCCAGGACGTCAGGCTGACCAACACCTCAGACCTTCTGAAGCAGCCCATTGCTG
GCCCGCCATGTTGTAATTTTGCTCATTTTTATTAAACTTCTGGTTTACCTGATGCTTGGCTTCTTTTAGGGCTACCCCCATCTCATTTCC
TTTAGCCCGTGTGCCTGTAACTCTGAGGGGGGGCACCCAGTGGGGTGCTGAGTGGGCAGAATCTCAGAAGGTCCTCCTGAACCGTCCGCG
CAGGCCTGCAGTGGGCCTGCCTCCTCCTTGCTTCCCTAACAGGAAGGTGTCCAGTTCAAGAGAACCCACCCAGAGACTGGGAGTGGTGGC
TCACGCCTATAATCCCTGCGCTTTGGCAGTCCGAGGCAGGGGAATTGCTTGAACTCAGGAGTTGGAGACCAGCCTGGGCAACATGGCAAA
ACGCAGTCTGTACAAAAAATACAAAAAATTAGCCAGGTGTAGGGGTAGGCACCTGGCATCCCAGCTACTCCAGGGGCTGAGGTGACAGCA
TTGCTTAAGCCCAGAAGGTCGAGGCTGCAGTGAGCTGAGATCACGCCACTGCACTCCAGTCTGGGTGACAGAGAGAGACCATATCCAAAA
AAAAAAAAAGTTGCCAGAGACGAGTATGCCCATGCTCCCTCTACCTCACTGCCACCACTCCTGCTGTTAGGAGCTGAGTGTGTCTCCCTA
AAATTTCTATGTTGAAGTCTTAACCCTTGGTACCACAGAATATCACTGTATTTGGAGATGGGGTCTTTAGAAAGGCACTTAAATTAAAAT
GAGCTCACTGATATGGGCCCCGATGCAATATAATTGGTGTCCTTATAAGAAGGGGAGGTTAGGACACGCAGGAAAGACCACATGAAGGCC
CAGGAGTGGGAGGGGGAATAGCCATCGACAAACTAAGGGGGCCTCAGAGGAAACCAACCCTGCTGACACCTCAATCTTAGACTCTGGCCT

>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000457488_chr15_64275953_-_2302nt
GACAGAATGAGACTCCGTCTCAAAAAAAAAAAAAAAAAAAAAAAGCGAGGGCTGGAAGTCTGGAGCAGGTGCGCGGCTGCAACGGCAGCC
GCGGGAAGCTCGGGCCGGCAGGGTTTCCCCGCACGCTGGCGCCCAGCTCCCGGCGCGGAGGCCGCTGTAAGTTTCGCTTTCCATTCAGTG
GAAAACGAAAGCTGGGCGGGGTGCCACGAGCGCGGGGCCAGACCAAGGCGGGCCCGGAGCGGAACTTCGGTCCCAGCTCGGTCCCCGGCT
CAGTCCCGACGTGGAACTCAGCAGCGGAGGCTGGACGCTTGCATGGCGCTTGAGAGATTCCATCGTGCCTGGCTCACATAAGCGCTTCCT
GGAAGTGAAGTCGTGCTGTCCTGAACGCGGGCCAGGCAGCTGCGGCCTGGGGGTTTTGGAGTGATCACGAATGAGCAAGGCGTTTGGGCT
CCTGAGGCAAATCTGTCAGTCCATCCTGGCTGAGTCCTCGCAGTCCCCGGCAGATCTTGAAGAAAAGAAGGAAGAAGACAGCAACATGAA
GAGAGAGCAGCCCAGAGAGCGTCCCAGGGCCTGGGACTACCCTCATGGCCTGGTTGGTTTACACAACATTGGACAGACCTGCTGCCTTAA
CTCCTTGATTCAGGTGTTCGTAATGAATGTGGACTTCACCAGGATATTGAAGAGTGGCCAGTTTGCCATCGTGAAGAAGTGCCGGGAGAA
GAGCACGGGGCTTGAGTATGCAGCCAAGTTCATCAAGAAGCGGCAGAGCCGGGCGAGCCGGCGCGGTGTGAGCCGGGAGGAGATCGAGCG
GGAGGTGAGCATCCTGCGGCAGGTGCTGCACCACAATGTCATCACGCTGCACGACGTCTATGAGAACCGCACCGACGTGGTGCTCATCCT
TGAGCTAGTGTCTGGAGGAGAGCTCTTCGATTTCCTGGCCCAGAAGGAGTCACTGAGTGAGGAGGAGGCCACCAGCTTCATTAAGCAGAT
CCTGGATGGGGTGAACTACCTTCACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATTATGTTGTTAGACAAGAATATTCC
CATTCCACACATCAAGCTGATTGACTTTGGTCTGGCTCACGAAATAGAAGATGGAGTTGAATTTAAGAATATTTTTGGGACGCCGGAATT
TGTTGCTCCAGAAATTGTGAACTACGAGCCCCTGGGTCTGGAGGCTGACATGTGGAGCATAGGCGTCATCACCTACATCCTCTTAAGTGG
AGCATCCCCTTTCCTGGGAGACACGAAGCAGGAAACACTGGCAAATATCACAGCAGTGAGTTACGACTTTGATGAGGAATTCTTCAGCCA
GACGAGCGAGCTGGCCAAGGACTTTATTCGGAAGCTTCTGGTTAAAGAGACCCGGAAACGGCTCACAATCCAAGAGGCTCTCAGACACCC
CTGGATCACGCCGGTGGACAACCAGCAAGCCATGGTGCGCAGGGAGTCTGTGGTCAATCTGGAGAACTTCAGGAAGCAGTATGTCCGCAG
GCGGTGGAAGCTTTCCTTCAGCATCGTGTCCCTGTGCAACCACCTCACCCGCTCGCTGATGAAGAAGGTGCACCTGAGGCCGGATGAGGA
CCTGAGGAACTGTGAGAGTGACACTGAGGAGGACATCGCCAGGAGGAAAGCCCTCCACCCACGGAGGAGGAGCAGCACCTCCTAACTGGC
CTGACCTGCAGTGGCCGCCAGGGAGGTCTGGGCCCAGCGGGGCTCCCTTCTGTGCAGACTTTTGGACCCAGCTCAGCACCAGCACCCGGG
CGTCCTGAGCACTTTGCAAGAGAGATGGGCCCAAGGAATTCAGAAGAGCTTGCAGGCAAGCCAGGAGACCCTGGGAGCTGTGGCTGTCTT
CTGTGGAGGAGGCTCCAGCATTCCCAAAGCTCTTAATTCTCCATAAAATGGGCTTTCCTCTGTCTGCCATCCTCAGAGTCTGGGGTGGGA
GTGTGGACTTAGGAAAACAATATAAAGGACATCCTCATCATCACGGGGTGAAGGTCAGACTAAGGCAGCCTTCTTCACAGGCTGAGGGGG
TTCAGAACCAGCCTGGCCAAAAATTACACCAGAGAGACAGAGTCCTCCCCATTGGGAACAGGGTGATTGAGGAAAGTGAACCTTGGGTGT
GAGGGACCAATCCTGTGACCTCCCAGAACCATGGAAGCCAGGACGTCAGGCTGACCAACACCTCAGACCTTCTGAAGCAGCCCATTGCTG

>In-frame_USP18_ENST00000215794_chr22_18643035_+_DAPK2_ENST00000558069_chr15_64275953_-_2059nt
GACAGAATGAGACTCCGTCTCAAAAAAAAAAAAAAAAAAAAAAAGCGAGGGCTGGAAGTCTGGAGCAGGTGCGCGGCTGCAACGGCAGCC
GCGGGAAGCTCGGGCCGGCAGGGTTTCCCCGCACGCTGGCGCCCAGCTCCCGGCGCGGAGGCCGCTGTAAGTTTCGCTTTCCATTCAGTG
GAAAACGAAAGCTGGGCGGGGTGCCACGAGCGCGGGGCCAGACCAAGGCGGGCCCGGAGCGGAACTTCGGTCCCAGCTCGGTCCCCGGCT
CAGTCCCGACGTGGAACTCAGCAGCGGAGGCTGGACGCTTGCATGGCGCTTGAGAGATTCCATCGTGCCTGGCTCACATAAGCGCTTCCT
GGAAGTGAAGTCGTGCTGTCCTGAACGCGGGCCAGGCAGCTGCGGCCTGGGGGTTTTGGAGTGATCACGAATGAGCAAGGCGTTTGGGCT
CCTGAGGCAAATCTGTCAGTCCATCCTGGCTGAGTCCTCGCAGTCCCCGGCAGATCTTGAAGAAAAGAAGGAAGAAGACAGCAACATGAA
GAGAGAGCAGCCCAGAGAGCGTCCCAGGGCCTGGGACTACCCTCATGGCCTGGTTGGTTTACACAACATTGGACAGACCTGCTGCCTTAA
CTCCTTGATTCAGGTGTTCGTAATGAATGTGGACTTCACCAGGATATTGAAGAGTGGCCAGTTTGCCATCGTGAAGAAGTGCCGGGAGAA
GAGCACGGGGCTTGAGTATGCAGCCAAGTTCATCAAGAAGCGGCAGAGCCGGGCGAGCCGGCGCGGTGTGAGCCGGGAGGAGATCGAGCG
GGAGGTGAGCATCCTGCGGCAGGTGCTGCACCACAATGTCATCACGCTGCACGACGTCTATGAGAACCGCACCGACGTGGTGCTCATCCT
TGAGCTAGTGTCTGGAGGAGAGCTCTTCGATTTCCTGGCCCAGAAGGAGTCACTGAGTGAGGAGGAGGCCACCAGCTTCATTAAGCAGAT
CCTGGATGGGGTGAACTACCTTCACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATTATGTTGTTAGACAAGAATATTCC
CATTCCACACATCAAGCTGATTGACTTTGGTCTGGCTCACGAAATAGAAGATGGAGTTGAATTTAAGAATATTTTTGGGACGCCGGAATT
TGTTGCTCCAGAAATTGTGAACTACGAGCCCCTGGGTCTGGAGGCTGACATGTGGAGCATAGGCGTCATCACCTACATCCTCTTAAGTGG
AGCATCCCCTTTCCTGGGAGACACGAAGCAGGAAACACTGGCAAATATCACAGCAGTGAGTTACGACTTTGATGAGGAATTCTTCAGCCA
GACGAGCGAGCTGGCCAAGGACTTTATTCGGAAGCTTCTGGTTAAAGAGACCCGGAAACGGCTCACAATCCAAGAGGCTCTCAGACACCC
CTGGATCACGTCAAAAGGAGAAGGCAGAGCCCCTGAACAGCGGAAGACAGAGCCCACCCAGCTGAAGACCAAGCACCTGAGAGAGTACAC
TCTCAAATGCCACTCAAGCATGCCTCCCAACAACTCCTATGTCAACTTCGAGCGTTTTGCCTGTGTGGTGGAAGACGTGGCTCGGGTCGA
CCTGGGATGCCGTGCCCTGGTGGAGGCCCACGATACCATCCAGGACGATGTGGAGGCCCTGGTCTCCATCTTCAATGAGAAGGAAGCTTG
GTACCGAGAGGAGAATGAGAGCGCCCGGCATGACCTGTCCCAGCTCAGGTATGAGTTCCGCAAGGTGGAGTCATTGAAGAAGCTGCTGCG
AGAAGACATCCAGGCCACGGGATGTAGCCTCGGAAGCATGGCCAGGAAACTGGACCATCTGCAAGCCCAGTTTGAGATTCTGAGGCAGGA
GCTCTCCGCAGACCTGCAGTGGATTCAGGAGCTGGTGGGCAGCTTCCAGCTGGAGAGTGGGAGCTCTGAGGGCCTGGGCTCCACATTCTA


Top

FusionGenePPI for USP18_DAPK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
USP18ISG15, MYL6, NME1, KDM3B, USP41, SKP2, IFNAR2, TRIM54, PCNA, MOV10, NXF1, ZDHHC17, HERC1, BECN1, ATG14, PIK3C3, UVRAG, TMEM14A, TAB1, MAP3K7, CHUK, IKBKB, IKBKG, CARD11, TAB2, TMEM173DAPK2DAPK2, APP, FAM9B, LLGL2, RACGAP1, TUBGCP5, KLC3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for USP18_DAPK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for USP18_DAPK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneUSP18C0023269leiomyosarcoma1CTD_human