FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40572

FusionGeneSummary for UBP1_SLC24A3

check button Fusion gene summary
Fusion gene informationFusion gene name: UBP1_SLC24A3
Fusion gene ID: 40572
HgeneTgene
Gene symbol

UBP1

SLC24A3

Gene ID

7342

57419

Gene nameupstream binding protein 1solute carrier family 24 member 3
SynonymsLBP-1B|LBP-1a|LBP1A|LBP1BNCKX3
Cytomap

3p22.3

20p11.23

Type of geneprotein-codingprotein-coding
Descriptionupstream-binding protein 1transcription factor LBP-1sodium/potassium/calcium exchanger 3Na(+)/K(+)/Ca(2+)-exchange protein 3sodium calcium exchangersolute carrier family 24 (sodium/potassium/calcium exchanger), member 3
Modification date2018052320180523
UniProtAcc

Q9NZI7

Q9HC58

Ensembl transtripts involved in fusion geneENST00000283629, ENST00000447368, 
ENST00000283628, ENST00000486388, 
ENST00000328041, 
Fusion gene scores* DoF score5 X 4 X 5=1006 X 7 X 7=294
# samples 57
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/294*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: UBP1 [Title/Abstract] AND SLC24A3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-VT-A80G-01AUBP1chr3

33450728

-SLC24A3chr20

19565615

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283629ENST00000328041UBP1chr3

33450728

-SLC24A3chr20

19565615

+
In-frameENST00000447368ENST00000328041UBP1chr3

33450728

-SLC24A3chr20

19565615

+
In-frameENST00000283628ENST00000328041UBP1chr3

33450728

-SLC24A3chr20

19565615

+
intron-3CDSENST00000486388ENST00000328041UBP1chr3

33450728

-SLC24A3chr20

19565615

+

Top

FusionProtFeatures for UBP1_SLC24A3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UBP1

Q9NZI7

SLC24A3

Q9HC58

Functions as a transcriptional activator in a promotercontext-dependent manner. Modulates the placental expression ofCYP11A1. Involved in regulation of the alpha-globin gene inerythroid cells. Activation of the alpha-globin promoter inerythroid cells is via synergistic interaction with TFCP2 (Bysimilarity). Involved in regulation of the alpha-globin gene inerythroid cells. Binds strongly to sequences around the HIV-1initiation site and weakly over the TATA-box. Represses HIV-1transcription by inhibiting the binding of TFIID to the TATA-box.{ECO:0000250, ECO:0000269|PubMed:10644752,ECO:0000269|PubMed:2006421, ECO:0000269|PubMed:8114710}. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317422_428141645Compositional biasNote=Poly-Glu
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317149_189141645RepeatNote=Alpha-1
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317518_549141645RepeatNote=Alpha-2
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317175_182141645Topological domainExtracellular
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317204_210141645Topological domainCytoplasmic
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317232_234141645Topological domainExtracellular
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317256_484141645Topological domainCytoplasmic
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317506_510141645Topological domainExtracellular
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317532_549141645Topological domainCytoplasmic
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317571_580141645Topological domainExtracellular
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317602_615141645Topological domainCytoplasmic
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317637_644141645Topological domainExtracellular
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317154_174141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317183_203141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317211_231141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317235_255141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317485_505141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317511_531141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317550_570141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317581_601141645TransmembraneHelical
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317616_636141645TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317129_153141645Topological domainCytoplasmic
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+31745_107141645Topological domainExtracellular
TgeneSLC24A3chr3:33450728chr20:19565615ENST00000328041+317108_128141645TransmembraneHelical


Top

FusionGeneSequence for UBP1_SLC24A3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UBP1_ENST00000283629_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_777aa
MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQTVMCAATSPAVKLHDETLTTLNQGQ
STEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRT
SAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKTQPSTDTTI
LTERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALI
VFITDEKVSWWESLVLVLMTLIYIVIMKTNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSA
YPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLINSRATTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAG
NETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAFSYMMVWMV
TIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLL

>In-frame_UBP1_ENST00000447368_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_777aa
MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQTVMCAATSPAVKLHDETLTTLNQGQ
STEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRT
SAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKTQPSTDTTI
LTERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALI
VFITDEKVSWWESLVLVLMTLIYIVIMKTNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSA
YPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLINSRATTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAG
NETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAFSYMMVWMV
TIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLL

>In-frame_UBP1_ENST00000283628_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_777aa
MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQTVMCAATSPAVKLHDETLTTLNQGQ
STEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRT
SAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKTQPSTDTTI
LTERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALI
VFITDEKVSWWESLVLVLMTLIYIVIMKTNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSA
YPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLINSRATTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAG
NETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAFSYMMVWMV
TIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UBP1_ENST00000283629_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_2331nt
ATGGCCTGGGTGCTCAAGATGGACGAGGTGATCGAGTCCGGGCTGGTGCACGACTTCGACGCCAGCCTCTCGGGCATCGGGCAGGAACTG
GGCGCCGGCGCTTACAGCATGAGTGATGTCTTGGCATTGCCCATTTTCAAGCAGGAAGATTCCAGCCTTCCATTGGATGGTGAAACAGAG
CACCCACCCTTTCAGTATGTGATGTGTGCTGCAACGTCACCAGCAGTAAAACTGCATGATGAAACGCTTACTTATTTGAACCAAGGTCAG
TCATATGAAATTCGGATGCTGGATAATCGGAAAATGGGTGATATGCCTGAGATCAATGGAAAATTAGTAAAGAGCATCATAAGGGTTGTA
TTCCATGACAGACGGCTACAATACACAGAGCATCAGCAACTTGAAGGATGGAAGTGGAATCGCCCAGGAGACAGACTTCTTGATTTAGAT
ATTCCAATGTCTGTGGGAATAATTGACACAAGGACGAATCCAAGCCAGTTAAATGCGGTTGAATTTCTGTGGGACCCAGCAAAACGCACC
TCTGCTTTCATTCAGGTACACTGCATCAGCACAGAATTTACTCCACGGAAGCACGGAGGTGAAAAGGGAGTGCCCTTTAGGATCCAGGTT
GACACCTTTAAGCAGAATGAAAATGGAGAATACACAGATCATCTACACTCAGCTAGCTGCCAAATCAAAGTTTTTAAGCCTAAAGGTGCA
GACAGGAAACAAAAAACTGACCGAGAGAAGATGGAGAAGAGAACAGCTCATGAAAAAGAAAAGTATCAGCCGTCCTATGATACCACAATC
CTCACAGAGCGCCTGCACCTCAGTGAAGATGTGGCTGGGGCCACATTCATGGCAGCGGGAAGTTCGGCCCCAGAGCTGTTCACATCGGTC
ATAGGGGTCTTCATCACCAAAGGCGATGTGGGAGTTGGCACCATCGTGGGCTCAGCGGTATTCAACATCCTGTGCATCATTGGTGTCTGT
GGGCTCTTTGCTGGGCAGGTTGTGGCTCTTTCCTCCTGGTGCCTGCTGAGGGATTCTATTTACTACACGCTGTCTGTGATCGCGCTCATC
GTGTTTATTTATGATGAAAAAGTTTCCTGGTGGGAGTCTTTAGTCCTTGTGCTGATGTATCTTATCTACATTGTCATCATGAAATATAAC
GCTTGCATACATCAGTGCTTTGAGAGGAGGACAAAAGGTGCCGGGAACATGGTCAACGGATTGGCCAACAATGCTGAAATTGATGACAGC
AGCAACTGCGACGCAACTGTGGTGCTACTTAAGAAAGCAAATTTCCACCGCAAAGCATCAGTGATCATGGTAGACGAGCTGCTGTCAGCC
TACCCACACCAGCTTTCCTTCTCTGAGGCTGGCCTTCGAATCATGATAACCAGCCACTTTCCCCCCAAGACCCGGCTCTCCATGGCCAGT
CGCATGTTGATCAATGAGAGACAAAGATTGATAAACAGCAGGGCTTATACCAACGGGGAATCTGAGGTGGCCATCAAAATCCCAATTAAG
CACACCGTGGAGAATGGGACAGGGCCCAGCAGTGCCCCAGACAGGGGCGTGAATGGGACACGGAGGGACGATGTTGTGGCTGAGGCTGGC
AACGAAACAGAGAATGAAAATGAGGACAATGAGAATGATGAGGAGGAAGAGGAGGACGAGGATGATGATGAAGGACCGTACACACCATTC
GACACCCCCTCGGGTAAACTGGAAACAGTGAAATGGGCGTTCACCTGGCCGCTGAGTTTCGTCTTATACTTCACTGTACCCAACTGCAAC
AAGCCGCGCTGGGAGAAATGGTTCATGGTGACGTTTGCTTCCTCCACGCTGTGGATCGCAGCCTTCTCCTACATGATGGTGTGGATGGTC
ACAATCATTGGTTACACCCTGGGGATTCCTGACGTCATCATGGGGATCACCTTCCTGGCTGCTGGGACCAGCGTGCCTGACTGCATGGCC
AGCCTCATTGTGGCCAGACAAGGGATGGGGGACATGGCTGTGTCCAACTCCATTGGGAGCAACGTGTTTGACATCCTGATTGGCCTCGGT
CTCCCCTGGGCTCTGCAGACCCTGGCTGTGGATTACGGATCCTACATCCGGCTGAATAGCAGGGGGCTGATCTACTCCGTAGGCTTGCTC
CTGGCCTCTGTTTTTGTCACGGTGTTCGGCGTCCACCTGAACAAGTGGCAGCTGGACAAGAAGCTGGGCTGTGGGTGCCTCCTCCTGTAT

>In-frame_UBP1_ENST00000447368_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_2331nt
ATGGCCTGGGTGCTCAAGATGGACGAGGTGATCGAGTCCGGGCTGGTGCACGACTTCGACGCCAGCCTCTCGGGCATCGGGCAGGAACTG
GGCGCCGGCGCTTACAGCATGAGTGATGTCTTGGCATTGCCCATTTTCAAGCAGGAAGATTCCAGCCTTCCATTGGATGGTGAAACAGAG
CACCCACCCTTTCAGTATGTGATGTGTGCTGCAACGTCACCAGCAGTAAAACTGCATGATGAAACGCTTACTTATTTGAACCAAGGTCAG
TCATATGAAATTCGGATGCTGGATAATCGGAAAATGGGTGATATGCCTGAGATCAATGGAAAATTAGTAAAGAGCATCATAAGGGTTGTA
TTCCATGACAGACGGCTACAATACACAGAGCATCAGCAACTTGAAGGATGGAAGTGGAATCGCCCAGGAGACAGACTTCTTGATTTAGAT
ATTCCAATGTCTGTGGGAATAATTGACACAAGGACGAATCCAAGCCAGTTAAATGCGGTTGAATTTCTGTGGGACCCAGCAAAACGCACC
TCTGCTTTCATTCAGGTACACTGCATCAGCACAGAATTTACTCCACGGAAGCACGGAGGTGAAAAGGGAGTGCCCTTTAGGATCCAGGTT
GACACCTTTAAGCAGAATGAAAATGGAGAATACACAGATCATCTACACTCAGCTAGCTGCCAAATCAAAGTTTTTAAGCCTAAAGGTGCA
GACAGGAAACAAAAAACTGACCGAGAGAAGATGGAGAAGAGAACAGCTCATGAAAAAGAAAAGTATCAGCCGTCCTATGATACCACAATC
CTCACAGAGCGCCTGCACCTCAGTGAAGATGTGGCTGGGGCCACATTCATGGCAGCGGGAAGTTCGGCCCCAGAGCTGTTCACATCGGTC
ATAGGGGTCTTCATCACCAAAGGCGATGTGGGAGTTGGCACCATCGTGGGCTCAGCGGTATTCAACATCCTGTGCATCATTGGTGTCTGT
GGGCTCTTTGCTGGGCAGGTTGTGGCTCTTTCCTCCTGGTGCCTGCTGAGGGATTCTATTTACTACACGCTGTCTGTGATCGCGCTCATC
GTGTTTATTTATGATGAAAAAGTTTCCTGGTGGGAGTCTTTAGTCCTTGTGCTGATGTATCTTATCTACATTGTCATCATGAAATATAAC
GCTTGCATACATCAGTGCTTTGAGAGGAGGACAAAAGGTGCCGGGAACATGGTCAACGGATTGGCCAACAATGCTGAAATTGATGACAGC
AGCAACTGCGACGCAACTGTGGTGCTACTTAAGAAAGCAAATTTCCACCGCAAAGCATCAGTGATCATGGTAGACGAGCTGCTGTCAGCC
TACCCACACCAGCTTTCCTTCTCTGAGGCTGGCCTTCGAATCATGATAACCAGCCACTTTCCCCCCAAGACCCGGCTCTCCATGGCCAGT
CGCATGTTGATCAATGAGAGACAAAGATTGATAAACAGCAGGGCTTATACCAACGGGGAATCTGAGGTGGCCATCAAAATCCCAATTAAG
CACACCGTGGAGAATGGGACAGGGCCCAGCAGTGCCCCAGACAGGGGCGTGAATGGGACACGGAGGGACGATGTTGTGGCTGAGGCTGGC
AACGAAACAGAGAATGAAAATGAGGACAATGAGAATGATGAGGAGGAAGAGGAGGACGAGGATGATGATGAAGGACCGTACACACCATTC
GACACCCCCTCGGGTAAACTGGAAACAGTGAAATGGGCGTTCACCTGGCCGCTGAGTTTCGTCTTATACTTCACTGTACCCAACTGCAAC
AAGCCGCGCTGGGAGAAATGGTTCATGGTGACGTTTGCTTCCTCCACGCTGTGGATCGCAGCCTTCTCCTACATGATGGTGTGGATGGTC
ACAATCATTGGTTACACCCTGGGGATTCCTGACGTCATCATGGGGATCACCTTCCTGGCTGCTGGGACCAGCGTGCCTGACTGCATGGCC
AGCCTCATTGTGGCCAGACAAGGGATGGGGGACATGGCTGTGTCCAACTCCATTGGGAGCAACGTGTTTGACATCCTGATTGGCCTCGGT
CTCCCCTGGGCTCTGCAGACCCTGGCTGTGGATTACGGATCCTACATCCGGCTGAATAGCAGGGGGCTGATCTACTCCGTAGGCTTGCTC
CTGGCCTCTGTTTTTGTCACGGTGTTCGGCGTCCACCTGAACAAGTGGCAGCTGGACAAGAAGCTGGGCTGTGGGTGCCTCCTCCTGTAT

>In-frame_UBP1_ENST00000283628_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_2331nt
ATGGCCTGGGTGCTCAAGATGGACGAGGTGATCGAGTCCGGGCTGGTGCACGACTTCGACGCCAGCCTCTCGGGCATCGGGCAGGAACTG
GGCGCCGGCGCTTACAGCATGAGTGATGTCTTGGCATTGCCCATTTTCAAGCAGGAAGATTCCAGCCTTCCATTGGATGGTGAAACAGAG
CACCCACCCTTTCAGTATGTGATGTGTGCTGCAACGTCACCAGCAGTAAAACTGCATGATGAAACGCTTACTTATTTGAACCAAGGTCAG
TCATATGAAATTCGGATGCTGGATAATCGGAAAATGGGTGATATGCCTGAGATCAATGGAAAATTAGTAAAGAGCATCATAAGGGTTGTA
TTCCATGACAGACGGCTACAATACACAGAGCATCAGCAACTTGAAGGATGGAAGTGGAATCGCCCAGGAGACAGACTTCTTGATTTAGAT
ATTCCAATGTCTGTGGGAATAATTGACACAAGGACGAATCCAAGCCAGTTAAATGCGGTTGAATTTCTGTGGGACCCAGCAAAACGCACC
TCTGCTTTCATTCAGGTACACTGCATCAGCACAGAATTTACTCCACGGAAGCACGGAGGTGAAAAGGGAGTGCCCTTTAGGATCCAGGTT
GACACCTTTAAGCAGAATGAAAATGGAGAATACACAGATCATCTACACTCAGCTAGCTGCCAAATCAAAGTTTTTAAGCCTAAAGGTGCA
GACAGGAAACAAAAAACTGACCGAGAGAAGATGGAGAAGAGAACAGCTCATGAAAAAGAAAAGTATCAGCCGTCCTATGATACCACAATC
CTCACAGAGCGCCTGCACCTCAGTGAAGATGTGGCTGGGGCCACATTCATGGCAGCGGGAAGTTCGGCCCCAGAGCTGTTCACATCGGTC
ATAGGGGTCTTCATCACCAAAGGCGATGTGGGAGTTGGCACCATCGTGGGCTCAGCGGTATTCAACATCCTGTGCATCATTGGTGTCTGT
GGGCTCTTTGCTGGGCAGGTTGTGGCTCTTTCCTCCTGGTGCCTGCTGAGGGATTCTATTTACTACACGCTGTCTGTGATCGCGCTCATC
GTGTTTATTTATGATGAAAAAGTTTCCTGGTGGGAGTCTTTAGTCCTTGTGCTGATGTATCTTATCTACATTGTCATCATGAAATATAAC
GCTTGCATACATCAGTGCTTTGAGAGGAGGACAAAAGGTGCCGGGAACATGGTCAACGGATTGGCCAACAATGCTGAAATTGATGACAGC
AGCAACTGCGACGCAACTGTGGTGCTACTTAAGAAAGCAAATTTCCACCGCAAAGCATCAGTGATCATGGTAGACGAGCTGCTGTCAGCC
TACCCACACCAGCTTTCCTTCTCTGAGGCTGGCCTTCGAATCATGATAACCAGCCACTTTCCCCCCAAGACCCGGCTCTCCATGGCCAGT
CGCATGTTGATCAATGAGAGACAAAGATTGATAAACAGCAGGGCTTATACCAACGGGGAATCTGAGGTGGCCATCAAAATCCCAATTAAG
CACACCGTGGAGAATGGGACAGGGCCCAGCAGTGCCCCAGACAGGGGCGTGAATGGGACACGGAGGGACGATGTTGTGGCTGAGGCTGGC
AACGAAACAGAGAATGAAAATGAGGACAATGAGAATGATGAGGAGGAAGAGGAGGACGAGGATGATGATGAAGGACCGTACACACCATTC
GACACCCCCTCGGGTAAACTGGAAACAGTGAAATGGGCGTTCACCTGGCCGCTGAGTTTCGTCTTATACTTCACTGTACCCAACTGCAAC
AAGCCGCGCTGGGAGAAATGGTTCATGGTGACGTTTGCTTCCTCCACGCTGTGGATCGCAGCCTTCTCCTACATGATGGTGTGGATGGTC
ACAATCATTGGTTACACCCTGGGGATTCCTGACGTCATCATGGGGATCACCTTCCTGGCTGCTGGGACCAGCGTGCCTGACTGCATGGCC
AGCCTCATTGTGGCCAGACAAGGGATGGGGGACATGGCTGTGTCCAACTCCATTGGGAGCAACGTGTTTGACATCCTGATTGGCCTCGGT
CTCCCCTGGGCTCTGCAGACCCTGGCTGTGGATTACGGATCCTACATCCGGCTGAATAGCAGGGGGCTGATCTACTCCGTAGGCTTGCTC
CTGGCCTCTGTTTTTGTCACGGTGTTCGGCGTCCACCTGAACAAGTGGCAGCTGGACAAGAAGCTGGGCTGTGGGTGCCTCCTCCTGTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_UBP1_ENST00000283629_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_4658nt
GTCGCGTTGAAGCCAGCGTCCGGCCGGCAGAGCGGCGTCGGCGGGGTTGGCCGGGGCGGTGTGGCGCTAGAGCCTGGGCGGGCCGGGGGC
AAGGAGTCAAGGCTTGGGGGCGGGTGACGGGCGGGCGGAGGGCTTGCCCCCGTGTGGTCCTCGGAGCGGCCCGAGGTCCAGCCTCCCAGC
GGTCCCGGAGGAGGATGCGACCGGGGGGCCCCGGGCGGGGCGGTCGGCGGCGGCTGCAGCGCTAGCGGCGCGGGGGCTGGGCGGCGGCGC
CGGCATGAGGCGCAGGGCCGGTGTCCGCGGGAGGGTGGCGCTGCCGGCGGCCCGGCCGCTCCCGCTGCAATTGCTCGCTGGGCTCGTCGT
GCCCTGCCAGTGGGGCCCCCGCAGCTCTCGTCCCGGCCGCCGCTGGTGACCACTCGCCGCCCCTCCGGAGGCTTCACCCGCGCCCTCCCC
CAGGACGCGCCAGCGGAGCTCCGGCTCCTTCGCCCTGGACGCGGAGGCCGCGGTGTGCGGGGCGACGGCGAGGCCGGAAGATGGCCTGGG
TGCTCAAGATGGACGAGGTGATCGAGTCCGGGCTGGTGCACGACTTCGACGCCAGCCTCTCGGGCATCGGGCAGGAACTGGGCGCCGGCG
CTTACAGCATGAGTGATGTCTTGGCATTGCCCATTTTCAAGCAGGAAGATTCCAGCCTTCCATTGGATGGTGAAACAGAGCACCCACCCT
TTCAGTATGTGATGTGTGCTGCAACGTCACCAGCAGTAAAACTGCATGATGAAACGCTTACTTATTTGAACCAAGGTCAGTCATATGAAA
TTCGGATGCTGGATAATCGGAAAATGGGTGATATGCCTGAGATCAATGGAAAATTAGTAAAGAGCATCATAAGGGTTGTATTCCATGACA
GACGGCTACAATACACAGAGCATCAGCAACTTGAAGGATGGAAGTGGAATCGCCCAGGAGACAGACTTCTTGATTTAGATATTCCAATGT
CTGTGGGAATAATTGACACAAGGACGAATCCAAGCCAGTTAAATGCGGTTGAATTTCTGTGGGACCCAGCAAAACGCACCTCTGCTTTCA
TTCAGGTACACTGCATCAGCACAGAATTTACTCCACGGAAGCACGGAGGTGAAAAGGGAGTGCCCTTTAGGATCCAGGTTGACACCTTTA
AGCAGAATGAAAATGGAGAATACACAGATCATCTACACTCAGCTAGCTGCCAAATCAAAGTTTTTAAGCCTAAAGGTGCAGACAGGAAAC
AAAAAACTGACCGAGAGAAGATGGAGAAGAGAACAGCTCATGAAAAAGAAAAGTATCAGCCGTCCTATGATACCACAATCCTCACAGAGC
GCCTGCACCTCAGTGAAGATGTGGCTGGGGCCACATTCATGGCAGCGGGAAGTTCGGCCCCAGAGCTGTTCACATCGGTCATAGGGGTCT
TCATCACCAAAGGCGATGTGGGAGTTGGCACCATCGTGGGCTCAGCGGTATTCAACATCCTGTGCATCATTGGTGTCTGTGGGCTCTTTG
CTGGGCAGGTTGTGGCTCTTTCCTCCTGGTGCCTGCTGAGGGATTCTATTTACTACACGCTGTCTGTGATCGCGCTCATCGTGTTTATTT
ATGATGAAAAAGTTTCCTGGTGGGAGTCTTTAGTCCTTGTGCTGATGTATCTTATCTACATTGTCATCATGAAATATAACGCTTGCATAC
ATCAGTGCTTTGAGAGGAGGACAAAAGGTGCCGGGAACATGGTCAACGGATTGGCCAACAATGCTGAAATTGATGACAGCAGCAACTGCG
ACGCAACTGTGGTGCTACTTAAGAAAGCAAATTTCCACCGCAAAGCATCAGTGATCATGGTAGACGAGCTGCTGTCAGCCTACCCACACC
AGCTTTCCTTCTCTGAGGCTGGCCTTCGAATCATGATAACCAGCCACTTTCCCCCCAAGACCCGGCTCTCCATGGCCAGTCGCATGTTGA
TCAATGAGAGACAAAGATTGATAAACAGCAGGGCTTATACCAACGGGGAATCTGAGGTGGCCATCAAAATCCCAATTAAGCACACCGTGG
AGAATGGGACAGGGCCCAGCAGTGCCCCAGACAGGGGCGTGAATGGGACACGGAGGGACGATGTTGTGGCTGAGGCTGGCAACGAAACAG
AGAATGAAAATGAGGACAATGAGAATGATGAGGAGGAAGAGGAGGACGAGGATGATGATGAAGGACCGTACACACCATTCGACACCCCCT
CGGGTAAACTGGAAACAGTGAAATGGGCGTTCACCTGGCCGCTGAGTTTCGTCTTATACTTCACTGTACCCAACTGCAACAAGCCGCGCT
GGGAGAAATGGTTCATGGTGACGTTTGCTTCCTCCACGCTGTGGATCGCAGCCTTCTCCTACATGATGGTGTGGATGGTCACAATCATTG
GTTACACCCTGGGGATTCCTGACGTCATCATGGGGATCACCTTCCTGGCTGCTGGGACCAGCGTGCCTGACTGCATGGCCAGCCTCATTG
TGGCCAGACAAGGGATGGGGGACATGGCTGTGTCCAACTCCATTGGGAGCAACGTGTTTGACATCCTGATTGGCCTCGGTCTCCCCTGGG
CTCTGCAGACCCTGGCTGTGGATTACGGATCCTACATCCGGCTGAATAGCAGGGGGCTGATCTACTCCGTAGGCTTGCTCCTGGCCTCTG
TTTTTGTCACGGTGTTCGGCGTCCACCTGAACAAGTGGCAGCTGGACAAGAAGCTGGGCTGTGGGTGCCTCCTCCTGTATGGTGTGTTCC
TGTGCTTCTCCATCATGACTGAGTTCAACGTGTTCACCTTTGTGAACCTGCCCATGTGCGGGGACCACTGAGCCGCCGGGTGCCCACAGA
GGCTCAGCTCCTTCTTTTCTGTGCAATACGAGACCCGGCCGCACCCCGAGTCACACAGGCCCCCGGGGCCACGGCGTTCGTCTCTCCTGT
GCTGTCCTCAGGCCTCCGCTCCTGTTTTGGTGGCCCAGGCTCTCCCCTGACCCATCCTCGCTCCCCCACCTCCTTGGGTCATGCCCACCC
ACCCTTTCCTGCCTCCTCCGTGTGAAGACATCCAACATCCACGTGACTTTTCCAGCTCCATTTTTGAACAGTGACTGAGATTCTAGAAAA
ACTGGCTGCTAACTGGCCTGAGCCAGGCAACACTGATTCCAATCCCTCCTCCTTTTTTAAGTTATTTGATGGAAGACTCACCTAATTTGT
GACCTGAGACTGTTGAAGAAATAGAGAGGAGGGGGCCCGTTGATTACAGAGAGCATTTGGGATTTTGTTTGGTTTGGAGATGATGCCTAG
GTTACTGGGTTTGGGGGGATTGTTTTCTTTTGGGGGCCTTCCCCTTTTACTCCTTTTCTTCCAGAGATCAAGAGCTTCTCTTGCATCTTC
TTCCACTGGGCTCTGGATTAATCAATTACCCAAAGGCTGCACCTGCCGTGTTGTCTGGGCTTGCATCCCAGATGTGTTGGAGTATGCATG
GATGTAGTGCTTTTTAGAGGAGCCACTGGGCAAGGCCACCAAGAACAAATGCATGACATTTTATAGCCAAGGACGCCTCGCTAAAGTCTT
ATGGGCGTCCCCTGGGGTTGGGGGGGCACAAGGTTTTGGAGGAAGAAGACAACTTCCCTCATTCCATCATCACCATCTCTTTCTCACTAG
GTTCTTTCTAGTTTTCAAGCAATAGTTCTAGCCTGCCTTGGACAAGGGGGCCCCAGTTAAACAAACTACCCATCCATGAGCTGCCAGGCA
GTCAAAAACAGAAGCTTCCCCGACTTGTGAGTCCCTGAGATGTGCTCTTGTTGTTTGGCATTTGGGGTGACAGGGAGTGACCCAGAGGCC
ACCACTGCTTTTCATGCAGGAGTTACAGACACTGGTTTCTTGGAAAATGGAGAGAAGCGCACTTTGCACAGACGTCGTCAATTAAGTCCC
AATTTGCCACTTGGTATTGAGTACACTGGACCCTGACCACTGGCTCTTGGGCAAACGTCCTTCCTCACGGGGCGCCTCCGCCAAGCCGGC
CCAGCTGCACCCCTCCCTTCCTGGAGGGATGGCCAGGGAAGGAGAAAACAGAGAACTGACACCTTTGAAACCACAGAATGTGTTACATGC
AGACTCGCTCAAGGGCATAAGTTATTGTGAACGTTTTTGCCAATCACTGCTCAACAGCCCTGCTAGATTTTGTATGATGCTGAATTATTA
TGCAGACTAATTCCACCCAGTTGAGACACACCATGCTTGTTCACTTGTATTTATTGAAACTGTGGATTCTTGCCCGTGCTGTCCCTTGTA
TTTACTTTAAGCACTGATCACTTATCATTCATTCGGTATGGTTTTCCCTGTCCCTTGTACACATTCTGGTATGAATTTGTAAAAATAACC
TGCTACAAATTGGTTGAATGTTTCTGTCTGTGGTGCGAACCAGCATTAACGGATGGGGCACGTGCCCAACTGAGGAACAGGAGAAGAAAT
CACCAATTTGGGCTCTCAGAGCTAAGACACACTTATTGATTCTGTTGCACATTTTGCACTGGTTTATGGCGATTGTTTTCTTGGACGGAT

>In-frame_UBP1_ENST00000447368_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_4290nt
AGTGGGGCCCCCGCAGCTCTCGTCCCGGCCGCCGCTGGTGACCACTCGCCGCCCCTCCGGAGGCTTCACCCGCGCCCTCCCCCAGGACGC
GCCAGCGGAGCTCCGGCTCCTTCGCCCTGGACGCGGAGGCCGCGGTGTGCGGGGCGACGGCGAGGCCGGAAGATGGCCTGGGTGCTCAAG
ATGGACGAGGTGATCGAGTCCGGGCTGGTGCACGACTTCGACGCCAGCCTCTCGGGCATCGGGCAGGAACTGGGCGCCGGCGCTTACAGC
ATGAGTGATGTCTTGGCATTGCCCATTTTCAAGCAGGAAGATTCCAGCCTTCCATTGGATGGTGAAACAGAGCACCCACCCTTTCAGTAT
GTGATGTGTGCTGCAACGTCACCAGCAGTAAAACTGCATGATGAAACGCTTACTTATTTGAACCAAGGTCAGTCATATGAAATTCGGATG
CTGGATAATCGGAAAATGGGTGATATGCCTGAGATCAATGGAAAATTAGTAAAGAGCATCATAAGGGTTGTATTCCATGACAGACGGCTA
CAATACACAGAGCATCAGCAACTTGAAGGATGGAAGTGGAATCGCCCAGGAGACAGACTTCTTGATTTAGATATTCCAATGTCTGTGGGA
ATAATTGACACAAGGACGAATCCAAGCCAGTTAAATGCGGTTGAATTTCTGTGGGACCCAGCAAAACGCACCTCTGCTTTCATTCAGGTA
CACTGCATCAGCACAGAATTTACTCCACGGAAGCACGGAGGTGAAAAGGGAGTGCCCTTTAGGATCCAGGTTGACACCTTTAAGCAGAAT
GAAAATGGAGAATACACAGATCATCTACACTCAGCTAGCTGCCAAATCAAAGTTTTTAAGCCTAAAGGTGCAGACAGGAAACAAAAAACT
GACCGAGAGAAGATGGAGAAGAGAACAGCTCATGAAAAAGAAAAGTATCAGCCGTCCTATGATACCACAATCCTCACAGAGCGCCTGCAC
CTCAGTGAAGATGTGGCTGGGGCCACATTCATGGCAGCGGGAAGTTCGGCCCCAGAGCTGTTCACATCGGTCATAGGGGTCTTCATCACC
AAAGGCGATGTGGGAGTTGGCACCATCGTGGGCTCAGCGGTATTCAACATCCTGTGCATCATTGGTGTCTGTGGGCTCTTTGCTGGGCAG
GTTGTGGCTCTTTCCTCCTGGTGCCTGCTGAGGGATTCTATTTACTACACGCTGTCTGTGATCGCGCTCATCGTGTTTATTTATGATGAA
AAAGTTTCCTGGTGGGAGTCTTTAGTCCTTGTGCTGATGTATCTTATCTACATTGTCATCATGAAATATAACGCTTGCATACATCAGTGC
TTTGAGAGGAGGACAAAAGGTGCCGGGAACATGGTCAACGGATTGGCCAACAATGCTGAAATTGATGACAGCAGCAACTGCGACGCAACT
GTGGTGCTACTTAAGAAAGCAAATTTCCACCGCAAAGCATCAGTGATCATGGTAGACGAGCTGCTGTCAGCCTACCCACACCAGCTTTCC
TTCTCTGAGGCTGGCCTTCGAATCATGATAACCAGCCACTTTCCCCCCAAGACCCGGCTCTCCATGGCCAGTCGCATGTTGATCAATGAG
AGACAAAGATTGATAAACAGCAGGGCTTATACCAACGGGGAATCTGAGGTGGCCATCAAAATCCCAATTAAGCACACCGTGGAGAATGGG
ACAGGGCCCAGCAGTGCCCCAGACAGGGGCGTGAATGGGACACGGAGGGACGATGTTGTGGCTGAGGCTGGCAACGAAACAGAGAATGAA
AATGAGGACAATGAGAATGATGAGGAGGAAGAGGAGGACGAGGATGATGATGAAGGACCGTACACACCATTCGACACCCCCTCGGGTAAA
CTGGAAACAGTGAAATGGGCGTTCACCTGGCCGCTGAGTTTCGTCTTATACTTCACTGTACCCAACTGCAACAAGCCGCGCTGGGAGAAA
TGGTTCATGGTGACGTTTGCTTCCTCCACGCTGTGGATCGCAGCCTTCTCCTACATGATGGTGTGGATGGTCACAATCATTGGTTACACC
CTGGGGATTCCTGACGTCATCATGGGGATCACCTTCCTGGCTGCTGGGACCAGCGTGCCTGACTGCATGGCCAGCCTCATTGTGGCCAGA
CAAGGGATGGGGGACATGGCTGTGTCCAACTCCATTGGGAGCAACGTGTTTGACATCCTGATTGGCCTCGGTCTCCCCTGGGCTCTGCAG
ACCCTGGCTGTGGATTACGGATCCTACATCCGGCTGAATAGCAGGGGGCTGATCTACTCCGTAGGCTTGCTCCTGGCCTCTGTTTTTGTC
ACGGTGTTCGGCGTCCACCTGAACAAGTGGCAGCTGGACAAGAAGCTGGGCTGTGGGTGCCTCCTCCTGTATGGTGTGTTCCTGTGCTTC
TCCATCATGACTGAGTTCAACGTGTTCACCTTTGTGAACCTGCCCATGTGCGGGGACCACTGAGCCGCCGGGTGCCCACAGAGGCTCAGC
TCCTTCTTTTCTGTGCAATACGAGACCCGGCCGCACCCCGAGTCACACAGGCCCCCGGGGCCACGGCGTTCGTCTCTCCTGTGCTGTCCT
CAGGCCTCCGCTCCTGTTTTGGTGGCCCAGGCTCTCCCCTGACCCATCCTCGCTCCCCCACCTCCTTGGGTCATGCCCACCCACCCTTTC
CTGCCTCCTCCGTGTGAAGACATCCAACATCCACGTGACTTTTCCAGCTCCATTTTTGAACAGTGACTGAGATTCTAGAAAAACTGGCTG
CTAACTGGCCTGAGCCAGGCAACACTGATTCCAATCCCTCCTCCTTTTTTAAGTTATTTGATGGAAGACTCACCTAATTTGTGACCTGAG
ACTGTTGAAGAAATAGAGAGGAGGGGGCCCGTTGATTACAGAGAGCATTTGGGATTTTGTTTGGTTTGGAGATGATGCCTAGGTTACTGG
GTTTGGGGGGATTGTTTTCTTTTGGGGGCCTTCCCCTTTTACTCCTTTTCTTCCAGAGATCAAGAGCTTCTCTTGCATCTTCTTCCACTG
GGCTCTGGATTAATCAATTACCCAAAGGCTGCACCTGCCGTGTTGTCTGGGCTTGCATCCCAGATGTGTTGGAGTATGCATGGATGTAGT
GCTTTTTAGAGGAGCCACTGGGCAAGGCCACCAAGAACAAATGCATGACATTTTATAGCCAAGGACGCCTCGCTAAAGTCTTATGGGCGT
CCCCTGGGGTTGGGGGGGCACAAGGTTTTGGAGGAAGAAGACAACTTCCCTCATTCCATCATCACCATCTCTTTCTCACTAGGTTCTTTC
TAGTTTTCAAGCAATAGTTCTAGCCTGCCTTGGACAAGGGGGCCCCAGTTAAACAAACTACCCATCCATGAGCTGCCAGGCAGTCAAAAA
CAGAAGCTTCCCCGACTTGTGAGTCCCTGAGATGTGCTCTTGTTGTTTGGCATTTGGGGTGACAGGGAGTGACCCAGAGGCCACCACTGC
TTTTCATGCAGGAGTTACAGACACTGGTTTCTTGGAAAATGGAGAGAAGCGCACTTTGCACAGACGTCGTCAATTAAGTCCCAATTTGCC
ACTTGGTATTGAGTACACTGGACCCTGACCACTGGCTCTTGGGCAAACGTCCTTCCTCACGGGGCGCCTCCGCCAAGCCGGCCCAGCTGC
ACCCCTCCCTTCCTGGAGGGATGGCCAGGGAAGGAGAAAACAGAGAACTGACACCTTTGAAACCACAGAATGTGTTACATGCAGACTCGC
TCAAGGGCATAAGTTATTGTGAACGTTTTTGCCAATCACTGCTCAACAGCCCTGCTAGATTTTGTATGATGCTGAATTATTATGCAGACT
AATTCCACCCAGTTGAGACACACCATGCTTGTTCACTTGTATTTATTGAAACTGTGGATTCTTGCCCGTGCTGTCCCTTGTATTTACTTT
AAGCACTGATCACTTATCATTCATTCGGTATGGTTTTCCCTGTCCCTTGTACACATTCTGGTATGAATTTGTAAAAATAACCTGCTACAA
ATTGGTTGAATGTTTCTGTCTGTGGTGCGAACCAGCATTAACGGATGGGGCACGTGCCCAACTGAGGAACAGGAGAAGAAATCACCAATT
TGGGCTCTCAGAGCTAAGACACACTTATTGATTCTGTTGCACATTTTGCACTGGTTTATGGCGATTGTTTTCTTGGACGGATAGTGTAAA

>In-frame_UBP1_ENST00000283628_chr3_33450728_-_SLC24A3_ENST00000328041_chr20_19565615_+_4382nt
CTGGGCCGCGAGGCGCGGGGAGTGGCCCTAAGCGCGGGGCTGTACGGGGAGGGCCGAGGCGTGGGGCGAACGCCGGGGCGGGGTCGGGGC
GGGGCCGGGGGAGGCGGAAGCGGCGCGTGAACCTAAGTCGGAGTCGCGTTGAAGCCAGCGTCCGGCCGGCAGAGCGGCGTCGGCGGGGAC
GCGCCAGCGGAGCTCCGGCTCCTTCGCCCTGGACGCGGAGGCCGCGGTGTGCGGGGCGACGGCGAGGCCGGAAGATGGCCTGGGTGCTCA
AGATGGACGAGGTGATCGAGTCCGGGCTGGTGCACGACTTCGACGCCAGCCTCTCGGGCATCGGGCAGGAACTGGGCGCCGGCGCTTACA
GCATGAGTGATGTCTTGGCATTGCCCATTTTCAAGCAGGAAGATTCCAGCCTTCCATTGGATGGTGAAACAGAGCACCCACCCTTTCAGT
ATGTGATGTGTGCTGCAACGTCACCAGCAGTAAAACTGCATGATGAAACGCTTACTTATTTGAACCAAGGTCAGTCATATGAAATTCGGA
TGCTGGATAATCGGAAAATGGGTGATATGCCTGAGATCAATGGAAAATTAGTAAAGAGCATCATAAGGGTTGTATTCCATGACAGACGGC
TACAATACACAGAGCATCAGCAACTTGAAGGATGGAAGTGGAATCGCCCAGGAGACAGACTTCTTGATTTAGATATTCCAATGTCTGTGG
GAATAATTGACACAAGGACGAATCCAAGCCAGTTAAATGCGGTTGAATTTCTGTGGGACCCAGCAAAACGCACCTCTGCTTTCATTCAGG
TACACTGCATCAGCACAGAATTTACTCCACGGAAGCACGGAGGTGAAAAGGGAGTGCCCTTTAGGATCCAGGTTGACACCTTTAAGCAGA
ATGAAAATGGAGAATACACAGATCATCTACACTCAGCTAGCTGCCAAATCAAAGTTTTTAAGCCTAAAGGTGCAGACAGGAAACAAAAAA
CTGACCGAGAGAAGATGGAGAAGAGAACAGCTCATGAAAAAGAAAAGTATCAGCCGTCCTATGATACCACAATCCTCACAGAGCGCCTGC
ACCTCAGTGAAGATGTGGCTGGGGCCACATTCATGGCAGCGGGAAGTTCGGCCCCAGAGCTGTTCACATCGGTCATAGGGGTCTTCATCA
CCAAAGGCGATGTGGGAGTTGGCACCATCGTGGGCTCAGCGGTATTCAACATCCTGTGCATCATTGGTGTCTGTGGGCTCTTTGCTGGGC
AGGTTGTGGCTCTTTCCTCCTGGTGCCTGCTGAGGGATTCTATTTACTACACGCTGTCTGTGATCGCGCTCATCGTGTTTATTTATGATG
AAAAAGTTTCCTGGTGGGAGTCTTTAGTCCTTGTGCTGATGTATCTTATCTACATTGTCATCATGAAATATAACGCTTGCATACATCAGT
GCTTTGAGAGGAGGACAAAAGGTGCCGGGAACATGGTCAACGGATTGGCCAACAATGCTGAAATTGATGACAGCAGCAACTGCGACGCAA
CTGTGGTGCTACTTAAGAAAGCAAATTTCCACCGCAAAGCATCAGTGATCATGGTAGACGAGCTGCTGTCAGCCTACCCACACCAGCTTT
CCTTCTCTGAGGCTGGCCTTCGAATCATGATAACCAGCCACTTTCCCCCCAAGACCCGGCTCTCCATGGCCAGTCGCATGTTGATCAATG
AGAGACAAAGATTGATAAACAGCAGGGCTTATACCAACGGGGAATCTGAGGTGGCCATCAAAATCCCAATTAAGCACACCGTGGAGAATG
GGACAGGGCCCAGCAGTGCCCCAGACAGGGGCGTGAATGGGACACGGAGGGACGATGTTGTGGCTGAGGCTGGCAACGAAACAGAGAATG
AAAATGAGGACAATGAGAATGATGAGGAGGAAGAGGAGGACGAGGATGATGATGAAGGACCGTACACACCATTCGACACCCCCTCGGGTA
AACTGGAAACAGTGAAATGGGCGTTCACCTGGCCGCTGAGTTTCGTCTTATACTTCACTGTACCCAACTGCAACAAGCCGCGCTGGGAGA
AATGGTTCATGGTGACGTTTGCTTCCTCCACGCTGTGGATCGCAGCCTTCTCCTACATGATGGTGTGGATGGTCACAATCATTGGTTACA
CCCTGGGGATTCCTGACGTCATCATGGGGATCACCTTCCTGGCTGCTGGGACCAGCGTGCCTGACTGCATGGCCAGCCTCATTGTGGCCA
GACAAGGGATGGGGGACATGGCTGTGTCCAACTCCATTGGGAGCAACGTGTTTGACATCCTGATTGGCCTCGGTCTCCCCTGGGCTCTGC
AGACCCTGGCTGTGGATTACGGATCCTACATCCGGCTGAATAGCAGGGGGCTGATCTACTCCGTAGGCTTGCTCCTGGCCTCTGTTTTTG
TCACGGTGTTCGGCGTCCACCTGAACAAGTGGCAGCTGGACAAGAAGCTGGGCTGTGGGTGCCTCCTCCTGTATGGTGTGTTCCTGTGCT
TCTCCATCATGACTGAGTTCAACGTGTTCACCTTTGTGAACCTGCCCATGTGCGGGGACCACTGAGCCGCCGGGTGCCCACAGAGGCTCA
GCTCCTTCTTTTCTGTGCAATACGAGACCCGGCCGCACCCCGAGTCACACAGGCCCCCGGGGCCACGGCGTTCGTCTCTCCTGTGCTGTC
CTCAGGCCTCCGCTCCTGTTTTGGTGGCCCAGGCTCTCCCCTGACCCATCCTCGCTCCCCCACCTCCTTGGGTCATGCCCACCCACCCTT
TCCTGCCTCCTCCGTGTGAAGACATCCAACATCCACGTGACTTTTCCAGCTCCATTTTTGAACAGTGACTGAGATTCTAGAAAAACTGGC
TGCTAACTGGCCTGAGCCAGGCAACACTGATTCCAATCCCTCCTCCTTTTTTAAGTTATTTGATGGAAGACTCACCTAATTTGTGACCTG
AGACTGTTGAAGAAATAGAGAGGAGGGGGCCCGTTGATTACAGAGAGCATTTGGGATTTTGTTTGGTTTGGAGATGATGCCTAGGTTACT
GGGTTTGGGGGGATTGTTTTCTTTTGGGGGCCTTCCCCTTTTACTCCTTTTCTTCCAGAGATCAAGAGCTTCTCTTGCATCTTCTTCCAC
TGGGCTCTGGATTAATCAATTACCCAAAGGCTGCACCTGCCGTGTTGTCTGGGCTTGCATCCCAGATGTGTTGGAGTATGCATGGATGTA
GTGCTTTTTAGAGGAGCCACTGGGCAAGGCCACCAAGAACAAATGCATGACATTTTATAGCCAAGGACGCCTCGCTAAAGTCTTATGGGC
GTCCCCTGGGGTTGGGGGGGCACAAGGTTTTGGAGGAAGAAGACAACTTCCCTCATTCCATCATCACCATCTCTTTCTCACTAGGTTCTT
TCTAGTTTTCAAGCAATAGTTCTAGCCTGCCTTGGACAAGGGGGCCCCAGTTAAACAAACTACCCATCCATGAGCTGCCAGGCAGTCAAA
AACAGAAGCTTCCCCGACTTGTGAGTCCCTGAGATGTGCTCTTGTTGTTTGGCATTTGGGGTGACAGGGAGTGACCCAGAGGCCACCACT
GCTTTTCATGCAGGAGTTACAGACACTGGTTTCTTGGAAAATGGAGAGAAGCGCACTTTGCACAGACGTCGTCAATTAAGTCCCAATTTG
CCACTTGGTATTGAGTACACTGGACCCTGACCACTGGCTCTTGGGCAAACGTCCTTCCTCACGGGGCGCCTCCGCCAAGCCGGCCCAGCT
GCACCCCTCCCTTCCTGGAGGGATGGCCAGGGAAGGAGAAAACAGAGAACTGACACCTTTGAAACCACAGAATGTGTTACATGCAGACTC
GCTCAAGGGCATAAGTTATTGTGAACGTTTTTGCCAATCACTGCTCAACAGCCCTGCTAGATTTTGTATGATGCTGAATTATTATGCAGA
CTAATTCCACCCAGTTGAGACACACCATGCTTGTTCACTTGTATTTATTGAAACTGTGGATTCTTGCCCGTGCTGTCCCTTGTATTTACT
TTAAGCACTGATCACTTATCATTCATTCGGTATGGTTTTCCCTGTCCCTTGTACACATTCTGGTATGAATTTGTAAAAATAACCTGCTAC
AAATTGGTTGAATGTTTCTGTCTGTGGTGCGAACCAGCATTAACGGATGGGGCACGTGCCCAACTGAGGAACAGGAGAAGAAATCACCAA
TTTGGGCTCTCAGAGCTAAGACACACTTATTGATTCTGTTGCACATTTTGCACTGGTTTATGGCGATTGTTTTCTTGGACGGATAGTGTA


Top

FusionGenePPI for UBP1_SLC24A3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UBP1TFCP2, WWP2, ELAVL1, TFAP4, WDR4, USP5, TRIM28, GLYCTK, ZNF184, JAK2, ANKRD29, PRMT6, XPO1, FOXA1, FOXC1, FOXC2, FOXD3, FOXE1, FOXN1, FOXP1, FOXP3, STK35, EVL, FAM19A3, GK, MTHFD2SLC24A3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UBP1_SLC24A3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UBP1_SLC24A3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSLC24A3C0010606Adenoid Cystic Carcinoma1CTD_human
TgeneSLC24A3C0036095Salivary Gland Neoplasms1CTD_human