FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 398

FusionGeneSummary for ACLY_TAF15

check button Fusion gene summary
Fusion gene informationFusion gene name: ACLY_TAF15
Fusion gene ID: 398
HgeneTgene
Gene symbol

ACLY

TAF15

Gene ID

47

8148

Gene nameATP citrate lyaseTATA-box binding protein associated factor 15
SynonymsACL|ATPCL|CLATPNpl3|RBP56|TAF2N|TAFII68
Cytomap

17q21.2

17q12

Type of geneprotein-codingprotein-coding
DescriptionATP-citrate synthaseATP-citrate (pro-S-)-lyasecitrate cleavage enzymeTATA-binding protein-associated factor 2NRBP56/CSMF fusionTAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDaTATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding protein 56)TATA box-bin
Modification date2018052320180523
UniProtAcc

P53396

Q92804

Ensembl transtripts involved in fusion geneENST00000352035, ENST00000590151, 
ENST00000353196, ENST00000537919, 
ENST00000393896, ENST00000588779, 
ENST00000588240, ENST00000592237, 
ENST00000311979, 
Fusion gene scores* DoF score4 X 5 X 3=607 X 5 X 6=210
# samples 57
** MAII scorelog2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ACLY [Title/Abstract] AND TAF15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneACLY

GO:0006085

acetyl-CoA biosynthetic process

1371749

HgeneACLY

GO:0006101

citrate metabolic process

1371749

HgeneACLY

GO:0006107

oxaloacetate metabolic process

1371749

HgeneACLY

GO:0008610

lipid biosynthetic process

23932781


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-WK-A8Y0-01AACLYchr17

40054002

-TAF15chr17

34163136

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000352035ENST00000588240ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000352035ENST00000592237ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000352035ENST00000311979ACLYchr17

40054002

-TAF15chr17

34163136

+
Frame-shitENST00000590151ENST00000588240ACLYchr17

40054002

-TAF15chr17

34163136

+
Frame-shitENST00000590151ENST00000592237ACLYchr17

40054002

-TAF15chr17

34163136

+
Frame-shitENST00000590151ENST00000311979ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000353196ENST00000588240ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000353196ENST00000592237ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000353196ENST00000311979ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000537919ENST00000588240ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000537919ENST00000592237ACLYchr17

40054002

-TAF15chr17

34163136

+
In-frameENST00000537919ENST00000311979ACLYchr17

40054002

-TAF15chr17

34163136

+
Frame-shitENST00000393896ENST00000588240ACLYchr17

40054002

-TAF15chr17

34163136

+
Frame-shitENST00000393896ENST00000592237ACLYchr17

40054002

-TAF15chr17

34163136

+
Frame-shitENST00000393896ENST00000311979ACLYchr17

40054002

-TAF15chr17

34163136

+
intron-3CDSENST00000588779ENST00000588240ACLYchr17

40054002

-TAF15chr17

34163136

+
intron-3CDSENST00000588779ENST00000592237ACLYchr17

40054002

-TAF15chr17

34163136

+
intron-3CDSENST00000588779ENST00000311979ACLYchr17

40054002

-TAF15chr17

34163136

+

Top

FusionProtFeatures for ACLY_TAF15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACLY

P53396

TAF15

Q92804

ATP-citrate synthase is the primary enzyme responsiblefor the synthesis of cytosolic acetyl-CoA in many tissues. Has acentral role in de novo lipid synthesis. In nervous tissue it maybe involved in the biosynthesis of acetylcholine.{ECO:0000269|PubMed:23932781}. RNA and ssDNA-binding protein that may play specificroles during transcription initiation at distinct promoters. Canenter the preinitiation complex together with the RNA polymeraseII (Pol II). {ECO:0000269|PubMed:19124016}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACLYchr17:40054002chr17:34163136ENST00000352035-13294_2654761102DomainNote=ATP-grasp
HgeneACLYchr17:40054002chr17:34163136ENST00000353196-13284_2654761092DomainNote=ATP-grasp
HgeneACLYchr17:40054002chr17:34163136ENST00000393896-13284_2654761092DomainNote=ATP-grasp
HgeneACLYchr17:40054002chr17:34163136ENST00000590151-13294_2654761102DomainNote=ATP-grasp
HgeneACLYchr17:40054002chr17:34163136ENST00000352035-1329109_1114761102Nucleotide bindingNote=ATP
HgeneACLYchr17:40054002chr17:34163136ENST00000352035-132966_674761102Nucleotide bindingNote=ATP
HgeneACLYchr17:40054002chr17:34163136ENST00000353196-1328109_1114761092Nucleotide bindingNote=ATP
HgeneACLYchr17:40054002chr17:34163136ENST00000353196-132866_674761092Nucleotide bindingNote=ATP
HgeneACLYchr17:40054002chr17:34163136ENST00000393896-1328109_1114761092Nucleotide bindingNote=ATP
HgeneACLYchr17:40054002chr17:34163136ENST00000393896-132866_674761092Nucleotide bindingNote=ATP
HgeneACLYchr17:40054002chr17:34163136ENST00000590151-1329109_1114761102Nucleotide bindingNote=ATP
HgeneACLYchr17:40054002chr17:34163136ENST00000590151-132966_674761102Nucleotide bindingNote=ATP
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816320_590221590Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816320_590224593Compositional biasNote=Arg/Gly-rich
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816234_320221590DomainRRM
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816234_320224593DomainRRM
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816407_575221590RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816407_575224593RegionNote=21 X approximate tandem repeats of D-R-[S%2CG](0%2C3)-G-G-Y-G-G
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816407_413221590RepeatNote=1
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816414_420221590RepeatNote=2
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816421_429221590RepeatNote=3
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816430_439221590RepeatNote=4
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816440_448221590RepeatNote=5
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816449_457221590RepeatNote=6
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816458_465221590RepeatNote=7
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816466_473221590RepeatNote=8
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816474_481221590RepeatNote=9
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816482_488221590RepeatNote=10
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816489_496221590RepeatNote=11
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816497_503221590RepeatNote=12
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816504_510221590RepeatNote=13
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816511_517221590RepeatNote=14
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816518_524221590RepeatNote=15
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816525_533221590RepeatNote=16
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816534_543221590RepeatNote=17
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816544_551221590RepeatNote=18
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816552_560221590RepeatNote=19
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816561_568221590RepeatNote=20
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816569_575221590RepeatNote=21
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816407_413224593RepeatNote=1
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816414_420224593RepeatNote=2
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816421_429224593RepeatNote=3
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816430_439224593RepeatNote=4
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816440_448224593RepeatNote=5
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816449_457224593RepeatNote=6
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816458_465224593RepeatNote=7
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816466_473224593RepeatNote=8
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816474_481224593RepeatNote=9
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816482_488224593RepeatNote=10
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816489_496224593RepeatNote=11
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816497_503224593RepeatNote=12
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816504_510224593RepeatNote=13
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816511_517224593RepeatNote=14
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816518_524224593RepeatNote=15
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816525_533224593RepeatNote=16
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816534_543224593RepeatNote=17
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816544_551224593RepeatNote=18
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816552_560224593RepeatNote=19
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816561_568224593RepeatNote=20
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816569_575224593RepeatNote=21
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+816354_385221590Zinc fingerRanBP2-type
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+816354_385224593Zinc fingerRanBP2-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACLYchr17:40054002chr17:34163136ENST00000352035-1329701_7214761102Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000352035-1329752_7784761102Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000353196-1328701_7214761092Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000353196-1328752_7784761092Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000393896-1328701_7214761092Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000393896-1328752_7784761092Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000590151-1329701_7214761102Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000590151-1329752_7784761102Nucleotide bindingATP
HgeneACLYchr17:40054002chr17:34163136ENST00000352035-1329779_7894761102RegionCoA-binding
HgeneACLYchr17:40054002chr17:34163136ENST00000353196-1328779_7894761092RegionCoA-binding
HgeneACLYchr17:40054002chr17:34163136ENST00000393896-1328779_7894761092RegionCoA-binding
HgeneACLYchr17:40054002chr17:34163136ENST00000590151-1329779_7894761102RegionCoA-binding
TgeneTAF15chr17:40054002chr17:34163136ENST00000311979+8161_208221590Compositional biasNote=Gln/Gly/Ser/Tyr-rich
TgeneTAF15chr17:40054002chr17:34163136ENST00000588240+8161_208224593Compositional biasNote=Gln/Gly/Ser/Tyr-rich


Top

FusionGeneSequence for ACLY_TAF15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_845aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATVGKATGFLKNFLIEPFVPHSQAEEFTVCITATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVTVLDLAAKVDATADYICKVKWGDIEFPPPFGREATPEEAYIADLDAKSGASLKLTLLN
PKGRIWTMVAGGGASVVYSDTICDLGGVNELANTGEYSGAPSEQQTTDTAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAP
SRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDTGKPKGEATV
SFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQ
CNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRG
GGTGGDRGGGTGGDRGGTGGDRGGGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGT

>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_793aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATVGKATGFLKNFLIEPFVPHSQAEEFTVCITATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVTVLDLAAKVDATADYICKVKWGDIEFPPPFGREATPEEAYIADLDAKSGASLKLTLLN
PKGRIWTMVAGGGASVVYSDTICDLGGVNELANTGEYSGAPSEQQTTDTAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAP
SRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDTGKPKGEATV
SFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQ
CNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRTGGAMEETVVVAVATVETEVEAMEETGVVAAMEETEVGATEETEVA

>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_845aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATVGKATGFLKNFLIEPFVPHSQAEEFTVCITATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVTVLDLAAKVDATADYICKVKWGDIEFPPPFGREATPEEAYIADLDAKSGASLKLTLLN
PKGRIWTMVAGGGASVVYSDTICDLGGVNELANTGEYSGAPSEQQTTDTAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAP
SRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDTGKPKGEATV
SFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQ
CNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRG
GGTGGDRGGGTGGDRGGTGGDRGGGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGT

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_845aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATVGKATGFLKNFLIEPFVPHSQAEEFTVCITATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVTVLDLAAKVDATADYICKVKWGDIEFPPPFGREATPEEAYIADLDAKSGASLKLTLLN
PKGRIWTMVAGGGASVVYSDTICDLGGVNELANTGEYSGAPSEQQTTDTAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAP
SRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDTGKPKGEATV
SFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQ
CNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRG
GGTGGDRGGGTGGDRGGTGGDRGGGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGT

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_793aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATVGKATGFLKNFLIEPFVPHSQAEEFTVCITATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVTVLDLAAKVDATADYICKVKWGDIEFPPPFGREATPEEAYIADLDAKSGASLKLTLLN
PKGRIWTMVAGGGASVVYSDTICDLGGVNELANTGEYSGAPSEQQTTDTAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAP
SRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDTGKPKGEATV
SFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQ
CNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRTGGAMEETVVVAVATVETEVEAMEETGVVAAMEETEVGATEETEVA

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_845aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATVGKATGFLKNFLIEPFVPHSQAEEFTVCITATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVTVLDLAAKVDATADYICKVKWGDIEFPPPFGREATPEEAYIADLDAKSGASLKLTLLN
PKGRIWTMVAGGGASVVYSDTICDLGGVNELANTGEYSGAPSEQQTTDTAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAP
SRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDTGKPKGEATV
SFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQ
CNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDRGGGTGGDRG
GGTGGDRGGGTGGDRGGTGGDRGGGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGTGGDRSGGGT

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_584aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATGIVRAIRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNA
SGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDT
GKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMN
FARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDR
GGGTGGDRGGGTGGDRGGGTGGDRGGTGGDRGGGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGT

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_532aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATGIVRAIRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNA
SGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDT
GKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMN
FARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRTGGAMEETVVVAVATVETEVEAMEETGVVAAMEETEV

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_584aa
MSAKAISEQTGKELLYKFICTTSAIQNRFKTARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLG
QEATGIVRAIRDYQGPLKEHEVTIFVRRGGPNTQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNA
SGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLTTDKDT
GKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGTRGRGGFQGRGGDPKSGDWVCPNPSCGNMN
FARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGTGGDRSGGGTGGDRSSGGGYSGDRSGGGTGGDRSGGGTGGDR
GGGTGGDRGGGTGGDRGGGTGGDRGGTGGDRGGGTGGDRGGTGGDRGGYGGDRGGTGGDRGGTGGDRSRGGTGGDRGGGSGYGGDRSGGT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_2535nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTAT
GTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAG
AAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATT
CTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGAT
GGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCC
CCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAAC
CCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAG
CTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAG
AAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTG
ATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGC
CACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCC
AGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCT
GATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGA
ATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTG
TCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCC
ACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGG
AGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAG
TGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGT
GGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGC
GGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGA
GGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGA
GGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGG
GGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTAT
GGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGC

>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_2379nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTAT
GTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAG
AAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATT
CTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGAT
GGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCC
CCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAAC
CCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAG
CTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAG
AAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTG
ATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGC
CACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCC
AGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCT
GATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGA
ATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTG
TCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCC
ACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGG
AGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAG
TGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGT
GGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTG
GAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCT
ATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCT
GACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATT

>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_2535nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTAT
GTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAG
AAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATT
CTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGAT
GGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCC
CCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAAC
CCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAG
CTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAG
AAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTG
ATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGC
CACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCC
AGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCT
GATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGA
ATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTG
TCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCC
ACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGG
AGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAG
TGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGT
GGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGC
GGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGA
GGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGA
GGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGG
GGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTAT
GGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGC

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_2535nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTAT
GTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAG
AAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATT
CTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGAT
GGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCC
CCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAAC
CCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAG
CTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAG
AAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTG
ATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGC
CACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCC
AGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCT
GATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGA
ATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTG
TCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCC
ACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGG
AGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAG
TGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGT
GGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGC
GGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGA
GGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGA
GGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGG
GGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTAT
GGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGC

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_2379nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTAT
GTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAG
AAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATT
CTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGAT
GGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCC
CCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAAC
CCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAG
CTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAG
AAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTG
ATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGC
CACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCC
AGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCT
GATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGA
ATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTG
TCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCC
ACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGG
AGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAG
TGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGT
GGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTG
GAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCT
ATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCT
GACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATT

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_2535nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTAT
GTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAG
AAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATT
CTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGAT
GGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCC
CCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAAC
CCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAG
CTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAG
AAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTG
ATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGC
CACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCC
AGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCT
GATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGA
ATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTG
TCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCC
ACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGG
AGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAG
TGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGT
GGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGC
GGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGA
GGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGA
GGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGG
GGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTAT
GGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGC

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_1752nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGC
CCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATG
ACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCC
AGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAG
CCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAA
GTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACA
GGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCAT
GGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGA
TATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAAC
TTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTAC
GGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGA
GACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGA
GGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGAC
CGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGA
GGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTAT
GGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGA

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_1596nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGC
CCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATG
ACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCC
AGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAG
CCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAA
GTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACA
GGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCAT
GGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGA
TATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAAC
TTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTAC
GGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAG
ACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTG
GGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGAT
GACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGG

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_1752nt
ATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAG
TATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGAC
CAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGA
CAGGAAGCCACAGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGC
CCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATG
ACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCC
AGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAG
CCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAA
GTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACA
GGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCAT
GGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGA
TATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAAC
TTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTAC
GGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGA
GACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGA
GGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGAC
CGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGA
GGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTAT
GGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_2963nt
CCGGGACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGCGGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGC
GCACGGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACA
AGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACC
ACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCA
CTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGA
TCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTATGTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACG
AGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAGAAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAA
AACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATTCTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACT
TCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGATGGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACT
ACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCCCCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCG
ATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAACCCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCG
TGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAGCTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCT
ATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAGAAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACT
TCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTG
TCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCA
CAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACT
TCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTG
CAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTG
TGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATA
CAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATG
GAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGC
GAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCAT
GCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCC
GGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGG
GTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCT
ATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTG
GCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTT
ATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACC
GAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAG
GCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATG
ATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATT
TGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGC

>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_2642nt
CCGGGACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGCGGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGC
GCACGGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACA
AGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACC
ACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCA
CTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGA
TCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTATGTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACG
AGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAGAAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAA
AACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATTCTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACT
TCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGATGGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACT
ACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCCCCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCG
ATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAACCCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCG
TGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAGCTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCT
ATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAGAAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACT
TCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTG
TCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCA
CAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACT
TCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTG
CAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTG
TGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATA
CAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATG
GAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGC
GAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCAT
GCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCC
GGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAACCGGGG
GGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGG
AGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAA
CCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCG
TGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGT
TGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTA

>In-frame_ACLY_ENST00000352035_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_2955nt
CCGGGACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGCGGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGC
GCACGGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACA
AGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACC
ACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCA
CTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGTTGGCAAGGCCACAGGCTTCCTCAAGAACTTTCTGA
TCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTATGTCTGCATCTATGCCACCCGAGAAGGGGACTACGTCCTGTTCCACCACG
AGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAGAAGCTGCTTGTTGGCGTGGATGAGAAACTGAATCCTGAGGACATCAAAA
AACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATTCTGGCCAGTTTTATCTCCGGCCTCTTCAATTTCTACGAGGACTTGTACT
TCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGATGGAGTCTATGTCCTTGACTTGGCGGCCAAGGTGGACGCCACTGCCGACT
ACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCCCCCTTCGGGCGGGAGGCATATCCAGAGGAAGCCTACATTGCAGACCTCG
ATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAACCCCAAAGGGAGGATCTGGACCATGGTGGCCGGGGGTGGCGCCTCTGTCG
TGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAGCTGGCAAACTATGGGGAGTACTCAGGCGCCCCCAGCGAGCAGCAGACCT
ATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAGAAGCACCCAGATGGCAAGATCCTCATCATTGGAGGCAGCATCGCAAACT
TCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAAGGAGCACGAAGTCACAATCTTTG
TCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGGGATCCCCATCCATGTCTTTGGCA
CAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACCCACAGCGGCCCACACTGCAAACT
TCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTCCAGGGCCGATGAGGTGGCGCCTG
CAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGGGGAGGGTG
TGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGGAAAACCAATGATAAATCTTTATA
CAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTGGTTTGATG
GAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGC
GAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAATCCGTCAT
GCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCC
GGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAGAAGTGGGG
GTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCT
ATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGATCGAGGTG
GCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTT
ATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACC
GAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAG
GCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATG
ATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATT
TGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGC

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_2995nt
AGCCGATGGGGGCGGGGAAAAGTCCGGCTGGGCCGGGACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGC
GGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGCGCACGGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAAT
TTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCC
TGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCG
TGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGTTGG
CAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTATGTCTGCATCTATGCCAC
CCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAGAAGCTGCTTGTTGGCGT
GGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATTCTGGCCAGTTTTATCTC
CGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGATGGAGTCTATGTCCTTGA
CTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCCCCCTTCGGGCGGGAGGC
ATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAACCCCAAAGGGAGGATCTG
GACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAGCTGGCAAACTATGGGGA
GTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAGAAGCACCCAGATGGCAA
GATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCAATTCGAGATTACCAGGG
CCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAA
GACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAA
CCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTT
TTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAA
CACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAA
GAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCC
TTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATT
CATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAA
AAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACC
AGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGA
CCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGG
CGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGA
CCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGA
TCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGA
CCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGG
GGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATG
ACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGG
TAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTT
TAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGG

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_2674nt
AGCCGATGGGGGCGGGGAAAAGTCCGGCTGGGCCGGGACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGC
GGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGCGCACGGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAAT
TTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCC
TGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCG
TGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGTTGG
CAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTATGTCTGCATCTATGCCAC
CCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAGAAGCTGCTTGTTGGCGT
GGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATTCTGGCCAGTTTTATCTC
CGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGATGGAGTCTATGTCCTTGA
CTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCCCCCTTCGGGCGGGAGGC
ATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAACCCCAAAGGGAGGATCTG
GACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAGCTGGCAAACTATGGGGA
GTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAGAAGCACCCAGATGGCAA
GATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCAATTCGAGATTACCAGGG
CCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAA
GACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAA
CCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTT
TTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAA
CACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAA
GAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCC
TTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATT
CATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAA
AAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACC
AGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGA
CCGAGGCGGCTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGC
TATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGA
GGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGA
AATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGG
GCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTG

>In-frame_ACLY_ENST00000353196_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_2987nt
AGCCGATGGGGGCGGGGAAAAGTCCGGCTGGGCCGGGACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGC
GGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGCGCACGGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAAT
TTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTTCATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCC
TGACACAGACTGGGCCCGCTTGCTGCAGGACCACCCCTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCG
TGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCTGGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGTTGG
CAAGGCCACAGGCTTCCTCAAGAACTTTCTGATCGAGCCCTTCGTCCCCCACAGTCAGGCTGAGGAGTTCTATGTCTGCATCTATGCCAC
CCGAGAAGGGGACTACGTCCTGTTCCACCACGAGGGGGGTGTGGACGTGGGTGATGTGGACGCCAAGGCCCAGAAGCTGCTTGTTGGCGT
GGATGAGAAACTGAATCCTGAGGACATCAAAAAACACCTGTTGGTCCACGCCCCTGAAGACAAGAAAGAAATTCTGGCCAGTTTTATCTC
CGGCCTCTTCAATTTCTACGAGGACTTGTACTTCACCTACCTCGAGATCAATCCCCTTGTAGTGACCAAAGATGGAGTCTATGTCCTTGA
CTTGGCGGCCAAGGTGGACGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATCGAGTTCCCTCCCCCCTTCGGGCGGGAGGC
ATATCCAGAGGAAGCCTACATTGCAGACCTCGATGCCAAAAGTGGGGCAAGCCTGAAGCTGACCTTGCTGAACCCCAAAGGGAGGATCTG
GACCATGGTGGCCGGGGGTGGCGCCTCTGTCGTGTACAGCGATACCATCTGTGATCTAGGGGGTGTCAACGAGCTGGCAAACTATGGGGA
GTACTCAGGCGCCCCCAGCGAGCAGCAGACCTATGACTATGCCAAGACTATCCTCTCCCTCATGACCCGAGAGAAGCACCCAGATGGCAA
GATCCTCATCATTGGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACGTTCAAGGGCATCGTGAGAGCAATTCGAGATTACCAGGG
CCCCCTGAAGGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAA
GACCACTGGGATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAA
CCAGCCACCCACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTT
TTCTGAGTCCAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAA
CACAATCTTTGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAA
GAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCC
TTCAGCTAAGGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATT
CATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAA
AAGTGGGGATTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACC
AGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGA
CCGAGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGG
CGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGA
CCGAGGAGGTGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGA
TCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGA
CCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGG
GGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATG
ACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGG
TAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTT
TAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGG

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000588240_chr17_34163136_+_2176nt
GACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGCGGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGCGCAC
GGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTT
CATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCC
CTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCT
GGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAA
GGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGG
GATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACC
CACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTC
CAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTT
TGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGG
AAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAA
GGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGG
AGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGA
TTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTC
TCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGG
CTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGG
TGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGG
TGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGG
TTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGG
TGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGG
AGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTG
AATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAAT
TAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCA
ACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGGCTGCTTGTT

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000592237_chr17_34163136_+_1855nt
GACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGCGGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGCGCAC
GGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTT
CATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCC
CTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCT
GGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAA
GGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGG
GATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACC
CACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTC
CAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTT
TGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGG
AAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAA
GGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGG
AGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGA
TTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTC
TCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGG
CTATGGTGGAGACAGAACCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGA
GACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAAC
GACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAG
AGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACA
GTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATT

>In-frame_ACLY_ENST00000537919_chr17_40054002_-_TAF15_ENST00000311979_chr17_34163136_+_2168nt
GACAAAAGCCGGATCCCGGGAAGCTACCGGCTGCTGGGGTGCTCCGGATTTTGCGGGGTTCGTCGGGCCTGTGGAAGAAGCGCCGCGCAC
GGACTTCGGCAGAGGTAGAGCAGGTCTCTCTGCAGCCATGTCGGCCAAGGCAATTTCAGAGCAGACGGGCAAAGAACTCCTTTACAAGTT
CATCTGTACCACCTCAGCCATCCAGAATCGGTTCAAGTATGCTCGGGTCACTCCTGACACAGACTGGGCCCGCTTGCTGCAGGACCACCC
CTGGCTGCTCAGCCAGAACTTGGTAGTCAAGCCAGACCAGCTGATCAAACGTCGTGGAAAACTTGGTCTCGTTGGGGTCAACCTCACTCT
GGATGGGGTCAAGTCCTGGCTGAAGCCACGGCTGGGACAGGAAGCCACAGGCATCGTGAGAGCAATTCGAGATTACCAGGGCCCCCTGAA
GGAGCACGAAGTCACAATCTTTGTCCGAAGAGGTGGCCCCAACTATCAGGAGGGCTTACGGGTGATGGGAGAAGTCGGGAAGACCACTGG
GATCCCCATCCATGTCTTTGGCACAGAGACTCACATGACGGCCATTGTGGGCATGGCCCTGGGCCACCGGCCCATCCCCAACCAGCCACC
CACAGCGGCCCACACTGCAAACTTCCTCCTCAACGCCAGCGGGAGCACATCGACGCCAGCCCCCAGCAGGACAGCATCTTTTTCTGAGTC
CAGGGCCGATGAGGTGGCGCCTGCAAAGAAGGCCAAGCCTGCCATGCCACAAGATTCAGAATCTGATAATTCAGATAACAACACAATCTT
TGTGCAAGGACTTGGGGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGACAAATAAGAAGACCGG
AAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCCAAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAA
GGCAGCCATTGACTGGTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACCTGAATTCATGAGAGG
AGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGGTCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGA
TTGGGTTTGCCCTAATCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCCTAGACCAGAGGACTC
TCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGAGAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGG
CTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAGTGGGGGCGGCTATGG
TGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGGCTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGG
TGGCTATGGAGGAGATCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGGAGGAGATCGAGGAGG
TTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTATGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGG
TGGCAGTGGCTACGGTGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCGAGGTGGGGGCTACGG
AGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGACTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTG
AATGTTCCTTTGTCTCTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTTCTTGGGTAGTGAAAT
TAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGTTTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCA
ACCTTCTCCCCAACCCTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAATAAAGGCTGCTTGTT


Top

FusionGenePPI for ACLY_TAF15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACLYTFE3, IKBKE, PRKAB1, GSK3B, NME2, HGS, TERF1, TERF2, HDAC5, SIRT7, ISG15, CUL3, CUL2, CAND1, SHC1, APP, UBC, FN1, CDKN2A, BAG3, KPNA2, KPNA4, PPP6C, PRMT1, SRRT, MAGED2, MCM2, MCM6, NCL, WWOX, ASB15, TRIM25, STAU1, HUWE1, UBR4, KAT2B, SIRT2, CUL7, OBSL1, CCDC8, SIRT6, CTH, EEF1D, PYGB, CS, HNRNPK, NAPRT, NUP210L, RPE, SDHA, SDHB, STIP1, NTRK1, AHSA1, NUP107, ATF6, CRY1, CRY2, FBXW7, USP13, DERL1, ZNF746, DDIAS, DUSP13, DNM1L, BRCA1TAF15SAFB, PRMT1, TAF7, TAF5, TAF13, TAF11, POLR2C, POLR2G, POLR2E, SF1, KAT2B, POLR2A, HIST2H2AC, HIST1H3A, HIST2H4A, CACNA1A, SIRT7, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, DDB1, TPR, SAP30BP, RNF168, SCARB2, TPM2, TMED9, MED26, PRMT8, FUS, RPA3, RPA2, RPA1, HIST3H3, CUL7, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, RPS6KB2, ACAA2, SFN, HNRNPA1, PPP1CB, MATR3, MED12, MCM2, NF2, DNPEP, KLHL8, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACLY_TAF15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ACLY_TAF15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACLYC0018801Heart failure1CTD_human
HgeneACLYC0028754Obesity1CTD_human
HgeneACLYC2239176Liver carcinoma1CTD_human
TgeneTAF15C0029463Osteosarcoma1CTD_human
TgeneTAF15C0038356Stomach Neoplasms1CTD_human