FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3970

FusionGeneSummary for BCAS3_TANC2

check button Fusion gene summary
Fusion gene informationFusion gene name: BCAS3_TANC2
Fusion gene ID: 3970
HgeneTgene
Gene symbol

BCAS3

TANC2

Gene ID

54828

26115

Gene nameBCAS3, microtubule associated cell migration factortetratricopeptide repeat, ankyrin repeat and coiled-coil containing 2
SynonymsGAOB1|MAABROLSA|rols
Cytomap

17q23.2

17q23.2-q23.3

Type of geneprotein-codingprotein-coding
Descriptionbreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab1protein TANC2putative ankyrin-repeat containing proteinrolling pebbles homolog Btetratricopeptide repeat, ankyrin repeat and coiled-coil domain-containing protein 2
Modification date2018052320180519
UniProtAcc

Q9H6U6

Q9HCD6

Ensembl transtripts involved in fusion geneENST00000589222, ENST00000407086, 
ENST00000390652, ENST00000408905, 
ENST00000588462, ENST00000585744, 
ENST00000588874, ENST00000585812, 
ENST00000424789, ENST00000389520, 
Fusion gene scores* DoF score40 X 23 X 15=1380014 X 11 X 5=770
# samples 4713
** MAII scorelog2(47/13800*10)=-4.87586369998789
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(13/770*10)=-2.56634682255381
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BCAS3 [Title/Abstract] AND TANC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

HgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

HgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-UL-AAZ6-01ABCAS3chr17

58952099

+TANC2chr17

61271352

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000589222ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000589222ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000407086ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000407086ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000390652ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000390652ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000408905ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000408905ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000588462ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
In-frameENST00000588462ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+
intron-3CDSENST00000585744ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
intron-3CDSENST00000585744ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+
intron-3CDSENST00000588874ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
intron-3CDSENST00000588874ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+
intron-3CDSENST00000585812ENST00000424789BCAS3chr17

58952099

+TANC2chr17

61271352

+
intron-3CDSENST00000585812ENST00000389520BCAS3chr17

58952099

+TANC2chr17

61271352

+

Top

FusionProtFeatures for BCAS3_TANC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCAS3

Q9H6U6

TANC2

Q9HCD6


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261033_1062702001RepeatNote=ANK 6
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261066_1095702001RepeatNote=ANK 7
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261099_1128702001RepeatNote=ANK 8
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261132_1161702001RepeatNote=ANK 9
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261165_1194702001RepeatNote=ANK 10
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261198_1227702001RepeatNote=ANK 11
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261244_1277702001RepeatNote=TPR 1
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261291_1324702001RepeatNote=TPR 2
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+2261325_1358702001RepeatNote=TPR 3
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+226846_878702001RepeatNote=ANK 1
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+226884_913702001RepeatNote=ANK 2
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+226917_946702001RepeatNote=ANK 3
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+226950_979702001RepeatNote=ANK 4
TgeneTANC2chr17:58952099chr17:61271352ENST00000389520+226990_1019702001RepeatNote=ANK 5
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251033_1062701991RepeatNote=ANK 6
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251066_1095701991RepeatNote=ANK 7
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251099_1128701991RepeatNote=ANK 8
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251132_1161701991RepeatNote=ANK 9
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251165_1194701991RepeatNote=ANK 10
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251198_1227701991RepeatNote=ANK 11
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251244_1277701991RepeatNote=TPR 1
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251291_1324701991RepeatNote=TPR 2
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+2251325_1358701991RepeatNote=TPR 3
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+225846_878701991RepeatNote=ANK 1
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+225884_913701991RepeatNote=ANK 2
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+225917_946701991RepeatNote=ANK 3
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+225950_979701991RepeatNote=ANK 4
TgeneTANC2chr17:58952099chr17:61271352ENST00000424789+225990_1019701991RepeatNote=ANK 5

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for BCAS3_TANC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCAS3_ENST00000589222_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_2141aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELK
VSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEEECRQMQQPQQ
PPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPLGSHQVFDFRS
SSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAESMSVTRSQSGS
PVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSMASKYQSSQGD
IGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCHSKLDLERSSS
QLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSCDELSPVSPTQ
GGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQNGHLLEDDTY

>In-frame_BCAS3_ENST00000589222_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_2151aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGCQTLPSRPRGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFG
EDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEE
ECRQMQQPQQPPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPL
GSHQVFDFRSSSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAES
MSVTRSQSGSPVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSM
ASKYQSSQGDIGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCH
SKLDLERSSSQLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSC
DELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQ

>In-frame_BCAS3_ENST00000407086_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_2141aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELK
VSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEEECRQMQQPQQ
PPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPLGSHQVFDFRS
SSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAESMSVTRSQSGS
PVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSMASKYQSSQGD
IGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCHSKLDLERSSS
QLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSCDELSPVSPTQ
GGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQNGHLLEDDTY

>In-frame_BCAS3_ENST00000407086_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_2151aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGCQTLPSRPRGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFG
EDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEE
ECRQMQQPQQPPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPL
GSHQVFDFRSSSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAES
MSVTRSQSGSPVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSM
ASKYQSSQGDIGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCH
SKLDLERSSSQLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSC
DELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQ

>In-frame_BCAS3_ENST00000390652_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_2141aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELK
VSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEEECRQMQQPQQ
PPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPLGSHQVFDFRS
SSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAESMSVTRSQSGS
PVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSMASKYQSSQGD
IGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCHSKLDLERSSS
QLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSCDELSPVSPTQ
GGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQNGHLLEDDTY

>In-frame_BCAS3_ENST00000390652_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_2151aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGCQTLPSRPRGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFG
EDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEE
ECRQMQQPQQPPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPL
GSHQVFDFRSSSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAES
MSVTRSQSGSPVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSM
ASKYQSSQGDIGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCH
SKLDLERSSSQLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSC
DELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQ

>In-frame_BCAS3_ENST00000408905_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_2141aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELK
VSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEEECRQMQQPQQ
PPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPLGSHQVFDFRS
SSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAESMSVTRSQSGS
PVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSMASKYQSSQGD
IGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCHSKLDLERSSS
QLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSCDELSPVSPTQ
GGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQNGHLLEDDTY

>In-frame_BCAS3_ENST00000408905_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_2151aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGCQTLPSRPRGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFG
EDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEE
ECRQMQQPQQPPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPL
GSHQVFDFRSSSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAES
MSVTRSQSGSPVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSM
ASKYQSSQGDIGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCH
SKLDLERSSSQLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSC
DELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQ

>In-frame_BCAS3_ENST00000588462_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_2141aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELK
VSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEEECRQMQQPQQ
PPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPLGSHQVFDFRS
SSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAESMSVTRSQSGS
PVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSMASKYQSSQGD
IGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCHSKLDLERSSS
QLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSCDELSPVSPTQ
GGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQNGHLLEDDTY

>In-frame_BCAS3_ENST00000588462_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_2151aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSTGAVTSPTSTLESRDSGIIATLTSTSENVERTKTAGESSKELGSGGN
IKPWQSQKSSMDSCLTRVDENMTASTTSLNKIPERNLETVLSQSVQSIPLTLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPTRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHG
TRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVATHTCQADNAYTCLVPEFVHNVAALLC
RSPQLTATREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDTGDTIVSFLSKMIGKFP
SWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSTLTLKLT
FDLIEKGTLVLKSSSYKVVPVSLSEVTLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSM
FLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISTSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGTAAAAGY
LSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGTTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASE
GHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFTGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGCQTLPSRPRGPATWAMATSKPDIMIILLSKLMEEGDMFTKKGKVKEAAQRYQYALKKFPREGFG
EDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSTEAYTARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEE
ECRQMQQPQQPPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPL
GSHQVFDFRSSSSVGSPTRQTTQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQTRASPPAES
MSVTRSQSGSPVRTQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSPAVHSSTVIPTGATGQVAHSM
ASKYQSSQGDIGVSQSRLVTQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASTYPVCH
SKLDLERSSSQLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPATERSC
DELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFTNKTNNAQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCAS3_ENST00000589222_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_6423nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGG
GCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTA
AAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAG
GTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTG
AAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAG
GCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAG
CCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATA
TTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATC
CAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCC
AGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCT
AGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGC
CCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCA
CCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAG
ATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCA
GCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGAC
ATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGC
CTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGA
TACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGC
CAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGG
CCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGG
CCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAA
GGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCAC
CTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCC
TTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTAC
AGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCT
CGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAA

>In-frame_BCAS3_ENST00000589222_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6453nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTA
CCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAG
GGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGT
GAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCG
GAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAG
TTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAA
GAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAG
CATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAG
GCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTT
GGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCT
CCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCT
GTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGT
ATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCA
TTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCC
CAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATG
GCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGAT
GGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGA
CCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCAC
TCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAAC
GAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCC
TCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGT
GACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGAT
AAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACG
TCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAG
AATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAG
GCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGAC

>In-frame_BCAS3_ENST00000407086_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_6423nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGG
GCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTA
AAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAG
GTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTG
AAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAG
GCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAG
CCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATA
TTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATC
CAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCC
AGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCT
AGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGC
CCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCA
CCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAG
ATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCA
GCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGAC
ATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGC
CTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGA
TACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGC
CAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGG
CCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGG
CCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAA
GGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCAC
CTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCC
TTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTAC
AGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCT
CGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAA

>In-frame_BCAS3_ENST00000407086_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6453nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTA
CCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAG
GGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGT
GAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCG
GAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAG
TTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAA
GAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAG
CATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAG
GCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTT
GGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCT
CCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCT
GTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGT
ATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCA
TTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCC
CAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATG
GCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGAT
GGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGA
CCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCAC
TCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAAC
GAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCC
TCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGT
GACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGAT
AAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACG
TCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAG
AATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAG
GCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGAC

>In-frame_BCAS3_ENST00000390652_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_6423nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGG
GCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTA
AAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAG
GTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTG
AAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAG
GCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAG
CCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATA
TTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATC
CAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCC
AGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCT
AGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGC
CCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCA
CCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAG
ATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCA
GCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGAC
ATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGC
CTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGA
TACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGC
CAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGG
CCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGG
CCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAA
GGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCAC
CTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCC
TTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTAC
AGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCT
CGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAA

>In-frame_BCAS3_ENST00000390652_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6453nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTA
CCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAG
GGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGT
GAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCG
GAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAG
TTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAA
GAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAG
CATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAG
GCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTT
GGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCT
CCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCT
GTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGT
ATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCA
TTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCC
CAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATG
GCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGAT
GGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGA
CCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCAC
TCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAAC
GAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCC
TCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGT
GACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGAT
AAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACG
TCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAG
AATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAG
GCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGAC

>In-frame_BCAS3_ENST00000408905_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_6423nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGG
GCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTA
AAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAG
GTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTG
AAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAG
GCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAG
CCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATA
TTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATC
CAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCC
AGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCT
AGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGC
CCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCA
CCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAG
ATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCA
GCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGAC
ATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGC
CTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGA
TACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGC
CAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGG
CCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGG
CCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAA
GGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCAC
CTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCC
TTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTAC
AGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCT
CGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAA

>In-frame_BCAS3_ENST00000408905_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6453nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTA
CCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAG
GGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGT
GAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCG
GAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAG
TTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAA
GAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAG
CATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAG
GCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTT
GGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCT
CCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCT
GTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGT
ATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCA
TTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCC
CAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATG
GCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGAT
GGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGA
CCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCAC
TCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAAC
GAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCC
TCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGT
GACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGAT
AAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACG
TCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAG
AATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAG
GCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGAC

>In-frame_BCAS3_ENST00000588462_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_6423nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGG
GCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTA
AAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAG
GTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTG
AAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAG
GCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAG
CCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATA
TTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATC
CAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCC
AGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCT
AGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGC
CCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCA
CCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAG
ATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCA
GCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGAC
ATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGC
CTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGA
TACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGC
CAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGG
CCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGG
CCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAA
GGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCAC
CTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCC
TTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTAC
AGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCT
CGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAA

>In-frame_BCAS3_ENST00000588462_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6453nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTA
CCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAG
GGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGT
GAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCG
GAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAG
TTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAA
GAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAG
CATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAG
GCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTT
GGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCT
CCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCT
GTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGT
ATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCA
TTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCC
CAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATG
GCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGAT
GGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGA
CCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCAC
TCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAAC
GAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCC
TCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGT
GACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGAT
AAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACG
TCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAG
AATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAG
GCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCAS3_ENST00000589222_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_12235nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTCATGACTCGTCTGGGTTTCCTCC
TTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAGACCTCAGCAATCACCCAGCGGA
TAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTCCCACCCATCAGTACAAATGCAA
CTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGCATCATTGCTACATTAACAAGCT
ATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAACATAAAACCTTGGCAGTCTCAAA
AATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAATAAGATCCCAGAGAGAAATTTGG
AAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCAGCCACCAGCTCTGCCCACTTGG
AAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAGAGCATGGGTGGTGCTCGCACAC
AGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTTGAAGTGCCCAGCATCACTACAG
AGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCCAGCGTGAACCAAGGAGTAGTGA
TTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGTACAAGGATGAGACAGATCGCCT
CAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCTTCAGCCCACTCATCTATCACCA
GTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCGCAGGTGGTTGCCTATCACTATT
GTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGCCGCTCACCTCAGCTGACAGCCT
ATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGACCCCATGGCCTCCTTCCGGAGGG
GAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTAATTGATGGATTAAATGAAGCAG
AATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCTTCTTGGCTCAAACTAATTGTAA
CAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTAGAAGAGAATGAAGCCATAGACC
AGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTTAATGGCAAAATGGACAATACTA
CATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACATTTGACCTCATAGAGAAAGGCT
ATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAGTGCAATATGAAGTTCCCAACCC
AGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGATGAGCATATCTTCCAGGCCATCA
ATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATGTTCCTAATCAAGCGCAGAGACA
TGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACCAAATTTCTCTGTGATCCGAGGA
GTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATTGAACTGGGACATCACATCCTCA
AAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGGATCTCTTATAGCACAGAAGGTC
TTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATTTTGGGAGGTGCCAATATTAATT
ACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATGGTAGCCCTGCTGCTGGAGTTCG
GGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTACCTGAGCATTGTGGTGCTGCTGT
GCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTCCGAGGTCATCTGGAGGTTGTCA
AGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCCATCCAACAGGCCCTCATTGCTG
CAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAAGTAGAGCGAGCACAGATCAACA
GCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGCCGTTTGCTCTTGGAACAAGGGG
CGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGGCAGATTGTTGATCTTTTACTCA
CCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAAGGCCATCTAGGAACCGTGGACT
TTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCTTGTTTGAAGGGCCATCTCTCAG
TAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTGGATCTGGCAGCTTTCTATGGCG
ATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATGCGCCCTTTGGATAGGGCAGTGG
GGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAG
ACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACC
AGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCT
CTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTT
ACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACA
ACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTC
AGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAAC
AGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCC
CGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCA
CTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGG
CTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGA
GAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAA
CAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAG
TTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCA
TCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGT
TGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTC
AGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCG
GACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGT
CGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTG
TAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAA
TGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCA
CCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCT
GGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCA
GCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTA
ACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGG
CATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAACCAAAGAGACCGTTCGTGGAGT
CTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCATATGTTTTCACTGCACATTTTCAGGCTTGGTTTCCACATTCGAGGTAGTTCTC
TGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCAGAGGTGGCAGCCCACATGCTGAAATCCTTTGCATGCAGCCGACTGGGAAGCGG
CCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGTGCCCAGCCACATGCTCTCTCCCTCTCTTCAGATGCCAACGAGGAGATTTTCGT
GCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGGTCAGCTTTTTCCAGGAGACAATCGCTTTCACTGATGTTCTTGTTGTGTAATTG
TCTTTTTCCTTTTTTAAAAAATAAGGTGTTCTTGTTCGTTTTCTTCTAGAAACTTTAGAAAGAGTGCGATGCCCCTTTGCCTTTGCATCC
TTAGCCAGTGTCACCCACACAGCCAGCCGCAGCGCATTCTCATGCTGTGGCCCCTCCCCAGACCGCCAGCGCCCTGCAGCCACCAGGTCT
GCAGTGTGCATTAGGATTATTGCTGGTCTTCCTAGGGGGTAAAAGGATCAGAGAGAGAAGAATTAAGTGCTAAATTGGAAGAAAACCCCA
ATATAATTATGTAAAATGTCACTACATTGATTTTCCAAGAGGCATTGTAGGAACATGTCAAAAACAGCCAGCCCTTTAAATATTGCAGTC
AGCCAAGGAAATTAGATGAGAATTGTGGCTATTAAGAGAATTCACTGAGAGTTATTCTCTAGATTTTTAGCCGACAATTAACCACTAAAA
GCTGCTGCTTTTCCAGGGTGGGGGAGGGAATGAATACATAGAAAAACAAAAAAGATTGTTCTGGATTCTCAGTGAAAGGCTATAGGAAGT
CTGTTCTGGAGACATCTACTTTTTAGATCCTGATACATCACTGAGTGTCATACTCCACTAAAAGGAAACTCTAACCGAAGGCTGGCTGGT
GTGACAATCCCGTTAGTTGGATCTTCACCTACAGCCAGATTTTGTTCTAGTGGCCCTCTTCCTGTAAACCCAGATGGTGTCATACAGAAA
TTGTTTCTTTCAGAAGCAGATTGGAATCTCTTGGGACCATGAGACTGAGTCCCAATATTTCCACCCAGGGTCATGCCCGTTGTTGTCTAC
TTCCATTTTGAGATCTATAGTTTGATTATCTATTATTACAGGAACTGTTTCTTTTCTTTTTCTAGGAGTGTTTATGAGAGTGTGATATTT
TAAAGTCAGACGCAGCAAAAACTGTTTCAGGGTGAAGAAAGACCCCTTTCAGCCCTGTTTTGCAGCCCTGGGTGGGGGCATGAGATAGAC
AGCAAGCTTCTGATCTTGAAGCTTGTCTAGAAGACACATCTTCTAGGTCTCGTGGTCATTTGGTAGGCTGACCTTTGAGTGAGCGAGGCC
ACTATTGAGTGGATAGCAAGAACATTGGAACCAAAGCCTCGGCACAGGCCTGGCACTGGCTGTACATCAGCTCTTACAACTAAACAACTC
AACTAAGCAACTGAAACGAAACAAAGGAGCATTCGTTCTCTGTTGTTAGGAATCATTCTGCTCTGTTAGGGAAGGGCTGCAGGAAGGGCA
GTTTCCTGAATAAAAATCTGGCTGCGACCAGTCCCATGTGTCTGGTAAGTAAGTAAGTAAGTAAGTGCCCTTTGAAGGGATCATTAAGAC
ACAGGGAGCATGAACCTGAGATCAGAAGCATTTCTTTACTAATTTAGATTCTGCGAAATAGACGGACCTCTCCACCCCCAAACCTAAAAC
AGGCCAGGACTTGTCTCTGTGCTGAAAGCAAATAGCAAGACTAACTCAAGCCCCAGCCTCTTTCCACACTCCCTGATACCTAAGGACTGC
TTTCTCAGCTAGACCAGGGTGGGCATCAGCGACGCCTTCTCAGCTAGACCAGGGTAGGCATCAGCGTCCTCTCTCCATCTCTATACCCCT
CTCTCTCACATCAGGAAGATGAAATGTGTAGCTCTAGCGGCAACCTCTAGCCAGGAGCCCAGTGGCCTCTCAGATTGCTTTTTGGCCAGG
TCTCAGCACTGCTGGCATCTTTACATCTTACTCCTTAAAACCGCCTCTCGCTGAGGAGCCACTGCATTTTGAAGAATTTCTCAGTGTCTG
TCAGGAAAGTGCTCCTGCTCATTTGGAACGCCACACACCACCCGCACTCACCTGTCCAGGCGAATGAGCAGGTCCTGTAGCTTTACAAAT
ATGCCGCTGATGCCGCTTCTCCCCAGGGTCTCTCAGTTTTCCAGGACAAAAAGATTTAGGGCCTATACCCTATGGGCAAAACACCTAAAA
TGTCAACAGTCAAAATGCCATTCTTTTTGGCCATCATAAGAGGGAGTAGGTATCACTGCTGCATGCCAGTTGTTTTTGACTAGAATATGC
CAACCAGAGCTTGTTGGGGCAGGAGACGTTTTTCCTTACAAGCAGACTGCCTGTGCCCTGTGCCCTGTTTGCTACTTCACTGCCATGGAA
TGATCCGAGTACTGTATTTCAGAGCTGCCCCTTCCCCAGCAGCAAACACTCGCTGAGTCCATGTCTGGCTTCAGGTGGGAGGAAATGTTT
CAGATGAAACTTACTCAATTCATACCACCCTGAAATGGAGGACAGAGGTGACAAACTTCAGTTTAATAGGTTTCTCACCAAGTTGTATGT
TCCATTGGCCCAGGATTCTTGCACTAATGGGTTTCTATCACATCATGTCTATAAATGGGTGCACTTTACTGTTTGAATTTGTAACTGAAG
TACTGGATATTTAAGTGTGAGTAATGTCTTCATTAGAAAATAGCAGAACCGCTCTTGTCTTTTAGTGTATTTTTCAAGAAAAAAGGAAAG
GAAAGACATCAAGCAGTGGATCACAACATTTATAGCACAAGAAATAACTTGTATATAAGCATCAAAAAGATTAAGAATTTTTTAATATGA
AAAATATTTGCAGTGATTTTAAAGTGCTTTTCCAGCAATGTTCTTAGGGACTCCTGAGACACGGTTACTTTATCTACTGGATCAGTAAGG
CACACAATTAACAATTAACAATTAATGTTTATTTACAAAGTAAAGGGAAAACCTGTGTAACATGAGAATTTGGCATGACAAAATGGAGAC
CATTTTGTATCTGCTGTTGTATCTTGTCCGGGTTGCAGACGTGCACTATTAAAGTCCCAAGTTAATAGAGCACAAACCCTTCTCGCTCCT
CCCCCATGTGCCCCTCTTTTTAGATGTGTATAACTTAAACTCGATGGCTCAGGAAAATTCCACTAATTAGAATCATGTACAGTACCCCAG
GTCGTTGTCCAGATATACAAGTTTGCTAATGTAGTTAAGCCTGGATTATTAAACACTTTTCCTAAATTATTGTAAACAGAACAGCTTAGA
GAAAGGTATTCTCAGTCCTTAATATTGTATAGTAGTTTATGAGCCCCTCTCTAAATATTGGTATTTTTATATTCCAGAGATGTACCCAAT
AGAAAAAATTAAAAATTAATCAGTATCTAATTTAATATCCATAAGTATTTTTCCTTAGATTTTAGTCACGTACAGTGGGCTATGTGGATG
TCACTTGTGCTTCACCATAGTTTACCACTAGGTGTCACTGTGGCTCTGCACTGCGCTTGTTTTGTAGCAAAGAACAGCGGCATCCCCTCG
GGAGAGAGGAGCTGCTTCCAGGGCAACAGGCAAGCGGGCTCAGAGGTTCAGGAGAAGGCAACAGAGGCCTGGAAGGGGTCTTCGTGCATC
TGTGCCAGTTGTGCAAGACGAACTCTTTGAACACTACATGCTTTGGACTTCAGCCAGGCAGAGGCTGGAAGAAGGTTGACCAGAGCTCCC
TTGCTCTGGTAGAGGGATGGGTACATGGAGAAGCCCCTTCTTCCCCATGAGCCTCCCTCCTGTCAGTTCCTCTCAGCCTCCAGCTTTTAT
AACTCCAGAAGCGTCACAGTTGGGTGGTTTGATTCAGAGAGAGTTATTTTTCTACTGCAGAAATGCCTTGGACAAAACCAGTGCTCACTG
AATCTTTGCCACAAAATGGAATAGGCTATCCCAGGGGGCAAGAGGTGCCCGCCCCTGTGCCCAGCCTCCTCTTGATGCTCCCAGTGCCCA
GCAGCCTCGCACACCCTGCCTGTCTGTTCCTGGGCTGCCCATTTCTCAAGAAACCGACCTGCAAAGGCAGCCGGCTGCTGCCTCCACACC
GAGGGCTGTGCGGTCCTGCTGCTCGCTCACTGGGAGGTGCAGCTCTTTCTCCTCTTCCTCTAGGAATTCCAGACCGACCATCTACCATGA
CTAACAACAATGAACAAAGGGCTTAGGGGCAAGAGCTACCTGCAAAGACGTGTCATGGAACCCTTCACCATGCAATGCCTTGAACTCAGC
TCTGGCTGCTCCCAAGAAAAGGTGGCTGGCTGGGGGCCTGGACACAAGCACAATGGGGCTGGTGGAGCCACTGTGCAGAGCTACTTGAAT
AATCACTGGGTTTTCATCAACTCCTTTTGTCATACAGACCACTCAAGGGCTGAAGTGTTGGTAACCTTCATTTCGGTGTCCAAAGCCTCA
CAGCAGGTGAGCCACCCTGAGATGCTTGTGGCCACATGGTGGCCACAGTCAGAGCTTTGAAAGTCAGTACCAAATGAACGCATAATTGGA
CACCAAAAATCAAGTGTTACTTTCATGTTTCCTCACCCCATCATCTCATTGCCTCCTGCTGACTCTGATACCGACGCTGAGCTGACTTGC
CAGGCTGCCGCTGGACGCGTAGAGATCAGGCCAGCGCCGCGCTCATTTTTCCAGGTAGACCTACTCTGTGGAACGGAAGTGCCCTAGCTG
CTTTGTTTTTGTAGCACTTGCTGGCTGAATTTTTCTTTTGCTAATCGCTAACCAGAAAGTCTGGTTAGAGGGGGCTCAACTCAATCCCTT
TGGTCCCCAGCGCCAGACAAGAGTTAATTCTGGAAAATTCAGTACTTGAATGTACCTGCCTTATTGCATACCAATTTACTGGGGGGAAAA
AAAAAGTTAAGAGATGCCGGCTCCAGATCTCCACTTCATTCACAGGTGATTTTGGAAATCCTGTAAGTTACACTTCCTGTTCTGGTTTTG
TTTTGTTTTTTGTTTCCTTTGGCTGATTCCTGCTGAGTGAGGCCAGTTCCTCATCAGGCTCAGGGCAGGTGCCTTTTCAGGCGTGGCCTC
CTTTCCATCTAGCACAGCATCTTTGTCTCTGTTCTGTCTCCTCCAAATCCAAGATGATTTTAATTAGTACAGACATGTACAGTCTACAAT
TAAAGAGTGATTTGTACTAATATGATTTTGATTCTTCCTCCTCTTTGCTGTCCTTTCAAGACACTTGCTGGAAAAAGCTTTAATGCACTT
AGTTTTCCTTTAGGTTTTCTATGACTCAGATGTAAAGGACTTTCTCTGTACAGTATATTATCCAATGCATGTTTGTTCTCTCTCCTGATA
TATTGAACACCACACAGTTGTGAAGCCGTGCAGTGGGGATGCCCCACACCCCACAGAGGCATCTACCCCTGTGTATAAGGAAAGACATTT
TCCTTTGCTGTACTTGCTTGAGCAGTTTTATTGTCTGTACATGTGAGCTGTGTGAGATAGATGTGAAAAGTTCAAATGAATGCATTTTCC

>In-frame_BCAS3_ENST00000589222_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6922nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTCATGACTCGTCTGGGTTTCCTCC
TTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAGACCTCAGCAATCACCCAGCGGA
TAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTCCCACCCATCAGTACAAATGCAA
CTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGCATCATTGCTACATTAACAAGCT
ATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAACATAAAACCTTGGCAGTCTCAAA
AATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAATAAGATCCCAGAGAGAAATTTGG
AAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCAGCCACCAGCTCTGCCCACTTGG
AAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAGAGCATGGGTGGTGCTCGCACAC
AGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTTGAAGTGCCCAGCATCACTACAG
AGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCCAGCGTGAACCAAGGAGTAGTGA
TTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGTACAAGGATGAGACAGATCGCCT
CAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCTTCAGCCCACTCATCTATCACCA
GTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCGCAGGTGGTTGCCTATCACTATT
GTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGCCGCTCACCTCAGCTGACAGCCT
ATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGACCCCATGGCCTCCTTCCGGAGGG
GAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTAATTGATGGATTAAATGAAGCAG
AATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCTTCTTGGCTCAAACTAATTGTAA
CAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTAGAAGAGAATGAAGCCATAGACC
AGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTTAATGGCAAAATGGACAATACTA
CATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACATTTGACCTCATAGAGAAAGGCT
ATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAGTGCAATATGAAGTTCCCAACCC
AGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGATGAGCATATCTTCCAGGCCATCA
ATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATGTTCCTAATCAAGCGCAGAGACA
TGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACCAAATTTCTCTGTGATCCGAGGA
GTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATTGAACTGGGACATCACATCCTCA
AAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGGATCTCTTATAGCACAGAAGGTC
TTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATTTTGGGAGGTGCCAATATTAATT
ACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATGGTAGCCCTGCTGCTGGAGTTCG
GGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTACCTGAGCATTGTGGTGCTGCTGT
GCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTCCGAGGTCATCTGGAGGTTGTCA
AGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCCATCCAACAGGCCCTCATTGCTG
CAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAAGTAGAGCGAGCACAGATCAACA
GCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGCCGTTTGCTCTTGGAACAAGGGG
CGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGGCAGATTGTTGATCTTTTACTCA
CCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAAGGCCATCTAGGAACCGTGGACT
TTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCTTGTTTGAAGGGCCATCTCTCAG
TAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTGGATCTGGCAGCTTTCTATGGCG
ATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATGCGCCCTTTGGATAGGGCAGTGG
GGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTACCGAGTCGCCCACGAGGTCCAG
CCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAG
GTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGG
AACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCC
TGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACC
TGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGC
CACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTAC
AGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCC
CGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACT
TCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATT
ACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAAT
ACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGT
CTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGC
CCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGC
CCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCAC
AAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCC
AAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTG
GCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCT
CCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAA
CTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGA
CCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTC
CAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGT
ACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGC
CTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACG
ATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGA
AGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCC
CTATCAAACCAAAGAGACCGTTCGTGGAGTCTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCATATGTTTTCACTGCACATTTTCA
GGCTTGGTTTCCACATTCGAGGTAGTTCTCTGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCAGAGGTGGCAGCCCACATGCTGAA
ATCCTTTGCATGCAGCCGACTGGGAAGCGGCCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGTGCCCAGCCACATGCTCTCTCCCT
CTCTTCAGATGCCAACGAGGAGATTTTCGTGCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGGTCAGCTTTTTCCAGGAGACAATC

>In-frame_BCAS3_ENST00000407086_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_12215nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAA
CAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTCATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAA
GTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAGACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTG
ACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTCCCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTAT
GGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGCATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGC
ACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAACATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGT
TTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAATAAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCA
GTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCAGCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGAT
GAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAGAGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGC
TTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTTGAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGA
GATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCCAGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTC
GGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGTACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCC
CCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCTTCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACT
CCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCGCAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTAC
ACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGCCGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGG
GAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGACCCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAA
AATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTAATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTAT
GGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCTTCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAG
GAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTAGAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATC
CTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTTAATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCT
CATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACATTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCT
AGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAGTGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTG
ATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGATGAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGC
ACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATGTTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACAT
CCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACCAAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCC
TTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATTGAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGT
TTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGGATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCT
TTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATTTTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAAT
AATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATGGTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCT
TCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTACCTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTG
GATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTCCGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGAC
TGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCCATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACT
GAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAAGTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGA
GAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGCCGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAAC
CGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGGCAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAAC
ATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAAGGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCC
TCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCTTGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGAT
AACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTGGATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTC
CTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATGCGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTT
GTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTG
AGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTC
CCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATG
AACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCA
AAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTT
CTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAA
GCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCC
ATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTAC
ATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCC
ACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTAC
CGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCC
AGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCT
GGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGG
CTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGC
CAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATT
GGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAA
GAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCC
TATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCT
ATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCA
TCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCT
GCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCA
TTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGAC
ACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAAC
AAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTC
TTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTAC
AGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAACCAAAGAGACCGTTCGTGGAGTCTAATGTTTAAAAGACGTTT
TGTTGGAGTGAGACCCATATGTTTTCACTGCACATTTTCAGGCTTGGTTTCCACATTCGAGGTAGTTCTCTGGCTTAATTTCTCATGTAG
TTTCTGTGTGGTGTTCAGAGGTGGCAGCCCACATGCTGAAATCCTTTGCATGCAGCCGACTGGGAAGCGGCCTCCCGGGAGCCAGGACTT
CAGTTTCTCTTGTCTGTGCCCAGCCACATGCTCTCTCCCTCTCTTCAGATGCCAACGAGGAGATTTTCGTGCTGTGTGCTTTAACCCAGG
GAGATCAGACACACTGGTCAGCTTTTTCCAGGAGACAATCGCTTTCACTGATGTTCTTGTTGTGTAATTGTCTTTTTCCTTTTTTAAAAA
ATAAGGTGTTCTTGTTCGTTTTCTTCTAGAAACTTTAGAAAGAGTGCGATGCCCCTTTGCCTTTGCATCCTTAGCCAGTGTCACCCACAC
AGCCAGCCGCAGCGCATTCTCATGCTGTGGCCCCTCCCCAGACCGCCAGCGCCCTGCAGCCACCAGGTCTGCAGTGTGCATTAGGATTAT
TGCTGGTCTTCCTAGGGGGTAAAAGGATCAGAGAGAGAAGAATTAAGTGCTAAATTGGAAGAAAACCCCAATATAATTATGTAAAATGTC
ACTACATTGATTTTCCAAGAGGCATTGTAGGAACATGTCAAAAACAGCCAGCCCTTTAAATATTGCAGTCAGCCAAGGAAATTAGATGAG
AATTGTGGCTATTAAGAGAATTCACTGAGAGTTATTCTCTAGATTTTTAGCCGACAATTAACCACTAAAAGCTGCTGCTTTTCCAGGGTG
GGGGAGGGAATGAATACATAGAAAAACAAAAAAGATTGTTCTGGATTCTCAGTGAAAGGCTATAGGAAGTCTGTTCTGGAGACATCTACT
TTTTAGATCCTGATACATCACTGAGTGTCATACTCCACTAAAAGGAAACTCTAACCGAAGGCTGGCTGGTGTGACAATCCCGTTAGTTGG
ATCTTCACCTACAGCCAGATTTTGTTCTAGTGGCCCTCTTCCTGTAAACCCAGATGGTGTCATACAGAAATTGTTTCTTTCAGAAGCAGA
TTGGAATCTCTTGGGACCATGAGACTGAGTCCCAATATTTCCACCCAGGGTCATGCCCGTTGTTGTCTACTTCCATTTTGAGATCTATAG
TTTGATTATCTATTATTACAGGAACTGTTTCTTTTCTTTTTCTAGGAGTGTTTATGAGAGTGTGATATTTTAAAGTCAGACGCAGCAAAA
ACTGTTTCAGGGTGAAGAAAGACCCCTTTCAGCCCTGTTTTGCAGCCCTGGGTGGGGGCATGAGATAGACAGCAAGCTTCTGATCTTGAA
GCTTGTCTAGAAGACACATCTTCTAGGTCTCGTGGTCATTTGGTAGGCTGACCTTTGAGTGAGCGAGGCCACTATTGAGTGGATAGCAAG
AACATTGGAACCAAAGCCTCGGCACAGGCCTGGCACTGGCTGTACATCAGCTCTTACAACTAAACAACTCAACTAAGCAACTGAAACGAA
ACAAAGGAGCATTCGTTCTCTGTTGTTAGGAATCATTCTGCTCTGTTAGGGAAGGGCTGCAGGAAGGGCAGTTTCCTGAATAAAAATCTG
GCTGCGACCAGTCCCATGTGTCTGGTAAGTAAGTAAGTAAGTAAGTGCCCTTTGAAGGGATCATTAAGACACAGGGAGCATGAACCTGAG
ATCAGAAGCATTTCTTTACTAATTTAGATTCTGCGAAATAGACGGACCTCTCCACCCCCAAACCTAAAACAGGCCAGGACTTGTCTCTGT
GCTGAAAGCAAATAGCAAGACTAACTCAAGCCCCAGCCTCTTTCCACACTCCCTGATACCTAAGGACTGCTTTCTCAGCTAGACCAGGGT
GGGCATCAGCGACGCCTTCTCAGCTAGACCAGGGTAGGCATCAGCGTCCTCTCTCCATCTCTATACCCCTCTCTCTCACATCAGGAAGAT
GAAATGTGTAGCTCTAGCGGCAACCTCTAGCCAGGAGCCCAGTGGCCTCTCAGATTGCTTTTTGGCCAGGTCTCAGCACTGCTGGCATCT
TTACATCTTACTCCTTAAAACCGCCTCTCGCTGAGGAGCCACTGCATTTTGAAGAATTTCTCAGTGTCTGTCAGGAAAGTGCTCCTGCTC
ATTTGGAACGCCACACACCACCCGCACTCACCTGTCCAGGCGAATGAGCAGGTCCTGTAGCTTTACAAATATGCCGCTGATGCCGCTTCT
CCCCAGGGTCTCTCAGTTTTCCAGGACAAAAAGATTTAGGGCCTATACCCTATGGGCAAAACACCTAAAATGTCAACAGTCAAAATGCCA
TTCTTTTTGGCCATCATAAGAGGGAGTAGGTATCACTGCTGCATGCCAGTTGTTTTTGACTAGAATATGCCAACCAGAGCTTGTTGGGGC
AGGAGACGTTTTTCCTTACAAGCAGACTGCCTGTGCCCTGTGCCCTGTTTGCTACTTCACTGCCATGGAATGATCCGAGTACTGTATTTC
AGAGCTGCCCCTTCCCCAGCAGCAAACACTCGCTGAGTCCATGTCTGGCTTCAGGTGGGAGGAAATGTTTCAGATGAAACTTACTCAATT
CATACCACCCTGAAATGGAGGACAGAGGTGACAAACTTCAGTTTAATAGGTTTCTCACCAAGTTGTATGTTCCATTGGCCCAGGATTCTT
GCACTAATGGGTTTCTATCACATCATGTCTATAAATGGGTGCACTTTACTGTTTGAATTTGTAACTGAAGTACTGGATATTTAAGTGTGA
GTAATGTCTTCATTAGAAAATAGCAGAACCGCTCTTGTCTTTTAGTGTATTTTTCAAGAAAAAAGGAAAGGAAAGACATCAAGCAGTGGA
TCACAACATTTATAGCACAAGAAATAACTTGTATATAAGCATCAAAAAGATTAAGAATTTTTTAATATGAAAAATATTTGCAGTGATTTT
AAAGTGCTTTTCCAGCAATGTTCTTAGGGACTCCTGAGACACGGTTACTTTATCTACTGGATCAGTAAGGCACACAATTAACAATTAACA
ATTAATGTTTATTTACAAAGTAAAGGGAAAACCTGTGTAACATGAGAATTTGGCATGACAAAATGGAGACCATTTTGTATCTGCTGTTGT
ATCTTGTCCGGGTTGCAGACGTGCACTATTAAAGTCCCAAGTTAATAGAGCACAAACCCTTCTCGCTCCTCCCCCATGTGCCCCTCTTTT
TAGATGTGTATAACTTAAACTCGATGGCTCAGGAAAATTCCACTAATTAGAATCATGTACAGTACCCCAGGTCGTTGTCCAGATATACAA
GTTTGCTAATGTAGTTAAGCCTGGATTATTAAACACTTTTCCTAAATTATTGTAAACAGAACAGCTTAGAGAAAGGTATTCTCAGTCCTT
AATATTGTATAGTAGTTTATGAGCCCCTCTCTAAATATTGGTATTTTTATATTCCAGAGATGTACCCAATAGAAAAAATTAAAAATTAAT
CAGTATCTAATTTAATATCCATAAGTATTTTTCCTTAGATTTTAGTCACGTACAGTGGGCTATGTGGATGTCACTTGTGCTTCACCATAG
TTTACCACTAGGTGTCACTGTGGCTCTGCACTGCGCTTGTTTTGTAGCAAAGAACAGCGGCATCCCCTCGGGAGAGAGGAGCTGCTTCCA
GGGCAACAGGCAAGCGGGCTCAGAGGTTCAGGAGAAGGCAACAGAGGCCTGGAAGGGGTCTTCGTGCATCTGTGCCAGTTGTGCAAGACG
AACTCTTTGAACACTACATGCTTTGGACTTCAGCCAGGCAGAGGCTGGAAGAAGGTTGACCAGAGCTCCCTTGCTCTGGTAGAGGGATGG
GTACATGGAGAAGCCCCTTCTTCCCCATGAGCCTCCCTCCTGTCAGTTCCTCTCAGCCTCCAGCTTTTATAACTCCAGAAGCGTCACAGT
TGGGTGGTTTGATTCAGAGAGAGTTATTTTTCTACTGCAGAAATGCCTTGGACAAAACCAGTGCTCACTGAATCTTTGCCACAAAATGGA
ATAGGCTATCCCAGGGGGCAAGAGGTGCCCGCCCCTGTGCCCAGCCTCCTCTTGATGCTCCCAGTGCCCAGCAGCCTCGCACACCCTGCC
TGTCTGTTCCTGGGCTGCCCATTTCTCAAGAAACCGACCTGCAAAGGCAGCCGGCTGCTGCCTCCACACCGAGGGCTGTGCGGTCCTGCT
GCTCGCTCACTGGGAGGTGCAGCTCTTTCTCCTCTTCCTCTAGGAATTCCAGACCGACCATCTACCATGACTAACAACAATGAACAAAGG
GCTTAGGGGCAAGAGCTACCTGCAAAGACGTGTCATGGAACCCTTCACCATGCAATGCCTTGAACTCAGCTCTGGCTGCTCCCAAGAAAA
GGTGGCTGGCTGGGGGCCTGGACACAAGCACAATGGGGCTGGTGGAGCCACTGTGCAGAGCTACTTGAATAATCACTGGGTTTTCATCAA
CTCCTTTTGTCATACAGACCACTCAAGGGCTGAAGTGTTGGTAACCTTCATTTCGGTGTCCAAAGCCTCACAGCAGGTGAGCCACCCTGA
GATGCTTGTGGCCACATGGTGGCCACAGTCAGAGCTTTGAAAGTCAGTACCAAATGAACGCATAATTGGACACCAAAAATCAAGTGTTAC
TTTCATGTTTCCTCACCCCATCATCTCATTGCCTCCTGCTGACTCTGATACCGACGCTGAGCTGACTTGCCAGGCTGCCGCTGGACGCGT
AGAGATCAGGCCAGCGCCGCGCTCATTTTTCCAGGTAGACCTACTCTGTGGAACGGAAGTGCCCTAGCTGCTTTGTTTTTGTAGCACTTG
CTGGCTGAATTTTTCTTTTGCTAATCGCTAACCAGAAAGTCTGGTTAGAGGGGGCTCAACTCAATCCCTTTGGTCCCCAGCGCCAGACAA
GAGTTAATTCTGGAAAATTCAGTACTTGAATGTACCTGCCTTATTGCATACCAATTTACTGGGGGGAAAAAAAAAGTTAAGAGATGCCGG
CTCCAGATCTCCACTTCATTCACAGGTGATTTTGGAAATCCTGTAAGTTACACTTCCTGTTCTGGTTTTGTTTTGTTTTTTGTTTCCTTT
GGCTGATTCCTGCTGAGTGAGGCCAGTTCCTCATCAGGCTCAGGGCAGGTGCCTTTTCAGGCGTGGCCTCCTTTCCATCTAGCACAGCAT
CTTTGTCTCTGTTCTGTCTCCTCCAAATCCAAGATGATTTTAATTAGTACAGACATGTACAGTCTACAATTAAAGAGTGATTTGTACTAA
TATGATTTTGATTCTTCCTCCTCTTTGCTGTCCTTTCAAGACACTTGCTGGAAAAAGCTTTAATGCACTTAGTTTTCCTTTAGGTTTTCT
ATGACTCAGATGTAAAGGACTTTCTCTGTACAGTATATTATCCAATGCATGTTTGTTCTCTCTCCTGATATATTGAACACCACACAGTTG
TGAAGCCGTGCAGTGGGGATGCCCCACACCCCACAGAGGCATCTACCCCTGTGTATAAGGAAAGACATTTTCCTTTGCTGTACTTGCTTG
AGCAGTTTTATTGTCTGTACATGTGAGCTGTGTGAGATAGATGTGAAAAGTTCAAATGAATGCATTTTCCTGCCCCATGTATACAGATTG

>In-frame_BCAS3_ENST00000407086_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6902nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAA
CAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTCATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAA
GTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAGACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTG
ACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTCCCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTAT
GGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGCATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGC
ACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAACATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGT
TTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAATAAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCA
GTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCAGCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGAT
GAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAGAGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGC
TTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTTGAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGA
GATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCCAGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTC
GGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGTACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCC
CCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCTTCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACT
CCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCGCAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTAC
ACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGCCGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGG
GAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGACCCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAA
AATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTAATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTAT
GGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCTTCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAG
GAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTAGAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATC
CTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTTAATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCT
CATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACATTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCT
AGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAGTGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTG
ATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGATGAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGC
ACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATGTTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACAT
CCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACCAAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCC
TTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATTGAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGT
TTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGGATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCT
TTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATTTTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAAT
AATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATGGTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCT
TCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTACCTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTG
GATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTCCGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGAC
TGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCCATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACT
GAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAAGTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGA
GAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGCCGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAAC
CGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGGCAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAAC
ATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAAGGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCC
TCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCTTGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGAT
AACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTGGATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTC
CTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATGCGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTT
GTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTACCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACC
TCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCC
CAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTC
CTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCT
TATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTG
TGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCA
CCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAG
TACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCC
TCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTA
GGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACAC
ACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCC
CCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTAT
CAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTC
CCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCA
AGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGC
CAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGC
GCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACA
CCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCC
CCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCAT
TCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCC
ATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCC
AGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAG
AATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCA
TCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGG
ATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCT
GTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAACCAAAGAGACCG
TTCGTGGAGTCTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCATATGTTTTCACTGCACATTTTCAGGCTTGGTTTCCACATTCGA
GGTAGTTCTCTGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCAGAGGTGGCAGCCCACATGCTGAAATCCTTTGCATGCAGCCGAC
TGGGAAGCGGCCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGTGCCCAGCCACATGCTCTCTCCCTCTCTTCAGATGCCAACGAGG
AGATTTTCGTGCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGGTCAGCTTTTTCCAGGAGACAATCGCTTTCACTGATGTTCTTGT

>In-frame_BCAS3_ENST00000390652_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_12198nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCC
TCCATCTGTAGATGAGGCAGCAAACACACTCATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCA
ATACAGCATGGAAGTACAGGATGAAAATCAGACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTC
TCCACCAGCCAGTAGCCCCTGCTCTACACTCCCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCC
AACCTCTACCCTTGAAAGCAGAGATAGTGGCATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGA
AAGCAGTAAAGAATTAGGATCTGGAGGAAACATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGA
AAACATGACTGCTTCCACCTATAGTCTGAATAAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTT
GTATCTCATGCCACGGCCAAATTCAGTAGCAGCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACC
TTTGAGAACTTCTCTACGAATGCCAAGACAGAGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCC
TCCAGATATCTCCTTGAAGCCTCTGCTCTTTGAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGA
AATAGATGCTCAACTTCAAAGTTCAAATGCCAGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCAT
CTCCAGACTGGTGGCCCTCAGCTGCCATGGTACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGC
CAACAGAGAGCTGCCACTCACACAGCCACCTTCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCG
GCAGGAGGAGGCTATGCGAAGACTAGCCTCGCAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGA
ATTTGTCCACAATGTTGCTGCCTTGCTCTGCCGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAG
CATGCTGAGCCTTCGTTCCTGTGTTCAAGACCCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAG
AAAAATCCCAGATGAAGATTTCATCATTTTAATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATC
GTTTCTGAGTAAAATGATCGGAAAGTTTCCTTCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCT
GCCTTTCCATAGGATTTTTTTGGATCGACTAGAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAG
CAGCTCAGAGATCCAGAATAACATTTCACTTAATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAG
TCAAGGGTCCTATCTATATCTGAAACTTACATTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCC
TGTTTCGCTCTCAGAGGTTTATTTACTCCAGTGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGT
GGCAGTGGCCTCTCTCCACCCACTGACTGATGAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGA
TTTTCAGCAGAGAATGGAGAACCTCTCCATGTTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATG
GCTTATCTGGAGAGAAGAAGGAGAGAAAACCAAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCA
AGAGGGAAAACTAAACCGACAGCAGACTATTGAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGG
TGTATCATCCTCCATCCTCCAAGGTCTCTGGATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACAC
TCCAAATATAAAGGTCAGCCGACTGCTGATTTTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATG
TGTTCAGTCCCATCTTGGTTACACAGAAATGGTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGAC
TCCCCTGGGATATGCTGCAGCAGCAGGGTACCTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAA
CGGGCAGTGTGCTTTGGTTCATGCTGCACTCCGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCA
GCAGCAAGGAGTATTTAAGAAGAGCCATGCCATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCT
ACTTGATCTTCCAGAAAAAGATGAAGAGGAAGTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGC
TGCAGCCGGAAGGGGCAAACTGGAGGTGTGCCGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCC
ACTATTCAGCACAGTGCGCCAGGGCCACTGGCAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGG
CCGCACTCCCCTGATGATGGCTGCTTCCGAAGGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGA
CAAAGAAGGATTGACAGCCCTCAGCTGGGCTTGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGA
CCATGCTGACAAGAATGGCCGTACCCCACTGGATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGC
CATGATCGAGCACGTTGACTACAGTGGAATGCGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAA
GAAAGGAGCCAAGATAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGA
GGGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGG
TGAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGC
GGAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACA
GTTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGA
AGAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACA
GCATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGA
GGCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCT
TGGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTC
TCCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCC
TGTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAG
TATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCC
ATTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGC
CCAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAAT
GGCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGA
TGGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCG
ACCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCA
CTCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAA
CGAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTC
CTCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATG
TGACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGA
TAAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCAC
GTCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACA
GAATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCA
GGCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGA
CTCTCGGCAAGGGCAGACATCCCCTATCAAACCAAAGAGACCGTTCGTGGAGTCTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCA
TATGTTTTCACTGCACATTTTCAGGCTTGGTTTCCACATTCGAGGTAGTTCTCTGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCA
GAGGTGGCAGCCCACATGCTGAAATCCTTTGCATGCAGCCGACTGGGAAGCGGCCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGT
GCCCAGCCACATGCTCTCTCCCTCTCTTCAGATGCCAACGAGGAGATTTTCGTGCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGG
TCAGCTTTTTCCAGGAGACAATCGCTTTCACTGATGTTCTTGTTGTGTAATTGTCTTTTTCCTTTTTTAAAAAATAAGGTGTTCTTGTTC
GTTTTCTTCTAGAAACTTTAGAAAGAGTGCGATGCCCCTTTGCCTTTGCATCCTTAGCCAGTGTCACCCACACAGCCAGCCGCAGCGCAT
TCTCATGCTGTGGCCCCTCCCCAGACCGCCAGCGCCCTGCAGCCACCAGGTCTGCAGTGTGCATTAGGATTATTGCTGGTCTTCCTAGGG
GGTAAAAGGATCAGAGAGAGAAGAATTAAGTGCTAAATTGGAAGAAAACCCCAATATAATTATGTAAAATGTCACTACATTGATTTTCCA
AGAGGCATTGTAGGAACATGTCAAAAACAGCCAGCCCTTTAAATATTGCAGTCAGCCAAGGAAATTAGATGAGAATTGTGGCTATTAAGA
GAATTCACTGAGAGTTATTCTCTAGATTTTTAGCCGACAATTAACCACTAAAAGCTGCTGCTTTTCCAGGGTGGGGGAGGGAATGAATAC
ATAGAAAAACAAAAAAGATTGTTCTGGATTCTCAGTGAAAGGCTATAGGAAGTCTGTTCTGGAGACATCTACTTTTTAGATCCTGATACA
TCACTGAGTGTCATACTCCACTAAAAGGAAACTCTAACCGAAGGCTGGCTGGTGTGACAATCCCGTTAGTTGGATCTTCACCTACAGCCA
GATTTTGTTCTAGTGGCCCTCTTCCTGTAAACCCAGATGGTGTCATACAGAAATTGTTTCTTTCAGAAGCAGATTGGAATCTCTTGGGAC
CATGAGACTGAGTCCCAATATTTCCACCCAGGGTCATGCCCGTTGTTGTCTACTTCCATTTTGAGATCTATAGTTTGATTATCTATTATT
ACAGGAACTGTTTCTTTTCTTTTTCTAGGAGTGTTTATGAGAGTGTGATATTTTAAAGTCAGACGCAGCAAAAACTGTTTCAGGGTGAAG
AAAGACCCCTTTCAGCCCTGTTTTGCAGCCCTGGGTGGGGGCATGAGATAGACAGCAAGCTTCTGATCTTGAAGCTTGTCTAGAAGACAC
ATCTTCTAGGTCTCGTGGTCATTTGGTAGGCTGACCTTTGAGTGAGCGAGGCCACTATTGAGTGGATAGCAAGAACATTGGAACCAAAGC
CTCGGCACAGGCCTGGCACTGGCTGTACATCAGCTCTTACAACTAAACAACTCAACTAAGCAACTGAAACGAAACAAAGGAGCATTCGTT
CTCTGTTGTTAGGAATCATTCTGCTCTGTTAGGGAAGGGCTGCAGGAAGGGCAGTTTCCTGAATAAAAATCTGGCTGCGACCAGTCCCAT
GTGTCTGGTAAGTAAGTAAGTAAGTAAGTGCCCTTTGAAGGGATCATTAAGACACAGGGAGCATGAACCTGAGATCAGAAGCATTTCTTT
ACTAATTTAGATTCTGCGAAATAGACGGACCTCTCCACCCCCAAACCTAAAACAGGCCAGGACTTGTCTCTGTGCTGAAAGCAAATAGCA
AGACTAACTCAAGCCCCAGCCTCTTTCCACACTCCCTGATACCTAAGGACTGCTTTCTCAGCTAGACCAGGGTGGGCATCAGCGACGCCT
TCTCAGCTAGACCAGGGTAGGCATCAGCGTCCTCTCTCCATCTCTATACCCCTCTCTCTCACATCAGGAAGATGAAATGTGTAGCTCTAG
CGGCAACCTCTAGCCAGGAGCCCAGTGGCCTCTCAGATTGCTTTTTGGCCAGGTCTCAGCACTGCTGGCATCTTTACATCTTACTCCTTA
AAACCGCCTCTCGCTGAGGAGCCACTGCATTTTGAAGAATTTCTCAGTGTCTGTCAGGAAAGTGCTCCTGCTCATTTGGAACGCCACACA
CCACCCGCACTCACCTGTCCAGGCGAATGAGCAGGTCCTGTAGCTTTACAAATATGCCGCTGATGCCGCTTCTCCCCAGGGTCTCTCAGT
TTTCCAGGACAAAAAGATTTAGGGCCTATACCCTATGGGCAAAACACCTAAAATGTCAACAGTCAAAATGCCATTCTTTTTGGCCATCAT
AAGAGGGAGTAGGTATCACTGCTGCATGCCAGTTGTTTTTGACTAGAATATGCCAACCAGAGCTTGTTGGGGCAGGAGACGTTTTTCCTT
ACAAGCAGACTGCCTGTGCCCTGTGCCCTGTTTGCTACTTCACTGCCATGGAATGATCCGAGTACTGTATTTCAGAGCTGCCCCTTCCCC
AGCAGCAAACACTCGCTGAGTCCATGTCTGGCTTCAGGTGGGAGGAAATGTTTCAGATGAAACTTACTCAATTCATACCACCCTGAAATG
GAGGACAGAGGTGACAAACTTCAGTTTAATAGGTTTCTCACCAAGTTGTATGTTCCATTGGCCCAGGATTCTTGCACTAATGGGTTTCTA
TCACATCATGTCTATAAATGGGTGCACTTTACTGTTTGAATTTGTAACTGAAGTACTGGATATTTAAGTGTGAGTAATGTCTTCATTAGA
AAATAGCAGAACCGCTCTTGTCTTTTAGTGTATTTTTCAAGAAAAAAGGAAAGGAAAGACATCAAGCAGTGGATCACAACATTTATAGCA
CAAGAAATAACTTGTATATAAGCATCAAAAAGATTAAGAATTTTTTAATATGAAAAATATTTGCAGTGATTTTAAAGTGCTTTTCCAGCA
ATGTTCTTAGGGACTCCTGAGACACGGTTACTTTATCTACTGGATCAGTAAGGCACACAATTAACAATTAACAATTAATGTTTATTTACA
AAGTAAAGGGAAAACCTGTGTAACATGAGAATTTGGCATGACAAAATGGAGACCATTTTGTATCTGCTGTTGTATCTTGTCCGGGTTGCA
GACGTGCACTATTAAAGTCCCAAGTTAATAGAGCACAAACCCTTCTCGCTCCTCCCCCATGTGCCCCTCTTTTTAGATGTGTATAACTTA
AACTCGATGGCTCAGGAAAATTCCACTAATTAGAATCATGTACAGTACCCCAGGTCGTTGTCCAGATATACAAGTTTGCTAATGTAGTTA
AGCCTGGATTATTAAACACTTTTCCTAAATTATTGTAAACAGAACAGCTTAGAGAAAGGTATTCTCAGTCCTTAATATTGTATAGTAGTT
TATGAGCCCCTCTCTAAATATTGGTATTTTTATATTCCAGAGATGTACCCAATAGAAAAAATTAAAAATTAATCAGTATCTAATTTAATA
TCCATAAGTATTTTTCCTTAGATTTTAGTCACGTACAGTGGGCTATGTGGATGTCACTTGTGCTTCACCATAGTTTACCACTAGGTGTCA
CTGTGGCTCTGCACTGCGCTTGTTTTGTAGCAAAGAACAGCGGCATCCCCTCGGGAGAGAGGAGCTGCTTCCAGGGCAACAGGCAAGCGG
GCTCAGAGGTTCAGGAGAAGGCAACAGAGGCCTGGAAGGGGTCTTCGTGCATCTGTGCCAGTTGTGCAAGACGAACTCTTTGAACACTAC
ATGCTTTGGACTTCAGCCAGGCAGAGGCTGGAAGAAGGTTGACCAGAGCTCCCTTGCTCTGGTAGAGGGATGGGTACATGGAGAAGCCCC
TTCTTCCCCATGAGCCTCCCTCCTGTCAGTTCCTCTCAGCCTCCAGCTTTTATAACTCCAGAAGCGTCACAGTTGGGTGGTTTGATTCAG
AGAGAGTTATTTTTCTACTGCAGAAATGCCTTGGACAAAACCAGTGCTCACTGAATCTTTGCCACAAAATGGAATAGGCTATCCCAGGGG
GCAAGAGGTGCCCGCCCCTGTGCCCAGCCTCCTCTTGATGCTCCCAGTGCCCAGCAGCCTCGCACACCCTGCCTGTCTGTTCCTGGGCTG
CCCATTTCTCAAGAAACCGACCTGCAAAGGCAGCCGGCTGCTGCCTCCACACCGAGGGCTGTGCGGTCCTGCTGCTCGCTCACTGGGAGG
TGCAGCTCTTTCTCCTCTTCCTCTAGGAATTCCAGACCGACCATCTACCATGACTAACAACAATGAACAAAGGGCTTAGGGGCAAGAGCT
ACCTGCAAAGACGTGTCATGGAACCCTTCACCATGCAATGCCTTGAACTCAGCTCTGGCTGCTCCCAAGAAAAGGTGGCTGGCTGGGGGC
CTGGACACAAGCACAATGGGGCTGGTGGAGCCACTGTGCAGAGCTACTTGAATAATCACTGGGTTTTCATCAACTCCTTTTGTCATACAG
ACCACTCAAGGGCTGAAGTGTTGGTAACCTTCATTTCGGTGTCCAAAGCCTCACAGCAGGTGAGCCACCCTGAGATGCTTGTGGCCACAT
GGTGGCCACAGTCAGAGCTTTGAAAGTCAGTACCAAATGAACGCATAATTGGACACCAAAAATCAAGTGTTACTTTCATGTTTCCTCACC
CCATCATCTCATTGCCTCCTGCTGACTCTGATACCGACGCTGAGCTGACTTGCCAGGCTGCCGCTGGACGCGTAGAGATCAGGCCAGCGC
CGCGCTCATTTTTCCAGGTAGACCTACTCTGTGGAACGGAAGTGCCCTAGCTGCTTTGTTTTTGTAGCACTTGCTGGCTGAATTTTTCTT
TTGCTAATCGCTAACCAGAAAGTCTGGTTAGAGGGGGCTCAACTCAATCCCTTTGGTCCCCAGCGCCAGACAAGAGTTAATTCTGGAAAA
TTCAGTACTTGAATGTACCTGCCTTATTGCATACCAATTTACTGGGGGGAAAAAAAAAGTTAAGAGATGCCGGCTCCAGATCTCCACTTC
ATTCACAGGTGATTTTGGAAATCCTGTAAGTTACACTTCCTGTTCTGGTTTTGTTTTGTTTTTTGTTTCCTTTGGCTGATTCCTGCTGAG
TGAGGCCAGTTCCTCATCAGGCTCAGGGCAGGTGCCTTTTCAGGCGTGGCCTCCTTTCCATCTAGCACAGCATCTTTGTCTCTGTTCTGT
CTCCTCCAAATCCAAGATGATTTTAATTAGTACAGACATGTACAGTCTACAATTAAAGAGTGATTTGTACTAATATGATTTTGATTCTTC
CTCCTCTTTGCTGTCCTTTCAAGACACTTGCTGGAAAAAGCTTTAATGCACTTAGTTTTCCTTTAGGTTTTCTATGACTCAGATGTAAAG
GACTTTCTCTGTACAGTATATTATCCAATGCATGTTTGTTCTCTCTCCTGATATATTGAACACCACACAGTTGTGAAGCCGTGCAGTGGG
GATGCCCCACACCCCACAGAGGCATCTACCCCTGTGTATAAGGAAAGACATTTTCCTTTGCTGTACTTGCTTGAGCAGTTTTATTGTCTG
TACATGTGAGCTGTGTGAGATAGATGTGAAAAGTTCAAATGAATGCATTTTCCTGCCCCATGTATACAGATTGTCATCTGTACAAGGAAC

>In-frame_BCAS3_ENST00000390652_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6885nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCC
TCCATCTGTAGATGAGGCAGCAAACACACTCATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCA
ATACAGCATGGAAGTACAGGATGAAAATCAGACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTC
TCCACCAGCCAGTAGCCCCTGCTCTACACTCCCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCC
AACCTCTACCCTTGAAAGCAGAGATAGTGGCATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGA
AAGCAGTAAAGAATTAGGATCTGGAGGAAACATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGA
AAACATGACTGCTTCCACCTATAGTCTGAATAAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTT
GTATCTCATGCCACGGCCAAATTCAGTAGCAGCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACC
TTTGAGAACTTCTCTACGAATGCCAAGACAGAGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCC
TCCAGATATCTCCTTGAAGCCTCTGCTCTTTGAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGA
AATAGATGCTCAACTTCAAAGTTCAAATGCCAGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCAT
CTCCAGACTGGTGGCCCTCAGCTGCCATGGTACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGC
CAACAGAGAGCTGCCACTCACACAGCCACCTTCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCG
GCAGGAGGAGGCTATGCGAAGACTAGCCTCGCAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGA
ATTTGTCCACAATGTTGCTGCCTTGCTCTGCCGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAG
CATGCTGAGCCTTCGTTCCTGTGTTCAAGACCCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAG
AAAAATCCCAGATGAAGATTTCATCATTTTAATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATC
GTTTCTGAGTAAAATGATCGGAAAGTTTCCTTCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCT
GCCTTTCCATAGGATTTTTTTGGATCGACTAGAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAG
CAGCTCAGAGATCCAGAATAACATTTCACTTAATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAG
TCAAGGGTCCTATCTATATCTGAAACTTACATTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCC
TGTTTCGCTCTCAGAGGTTTATTTACTCCAGTGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGT
GGCAGTGGCCTCTCTCCACCCACTGACTGATGAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGA
TTTTCAGCAGAGAATGGAGAACCTCTCCATGTTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATG
GCTTATCTGGAGAGAAGAAGGAGAGAAAACCAAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCA
AGAGGGAAAACTAAACCGACAGCAGACTATTGAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGG
TGTATCATCCTCCATCCTCCAAGGTCTCTGGATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACAC
TCCAAATATAAAGGTCAGCCGACTGCTGATTTTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATG
TGTTCAGTCCCATCTTGGTTACACAGAAATGGTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGAC
TCCCCTGGGATATGCTGCAGCAGCAGGGTACCTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAA
CGGGCAGTGTGCTTTGGTTCATGCTGCACTCCGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCA
GCAGCAAGGAGTATTTAAGAAGAGCCATGCCATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCT
ACTTGATCTTCCAGAAAAAGATGAAGAGGAAGTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGC
TGCAGCCGGAAGGGGCAAACTGGAGGTGTGCCGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCC
ACTATTCAGCACAGTGCGCCAGGGCCACTGGCAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGG
CCGCACTCCCCTGATGATGGCTGCTTCCGAAGGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGA
CAAAGAAGGATTGACAGCCCTCAGCTGGGCTTGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGA
CCATGCTGACAAGAATGGCCGTACCCCACTGGATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGC
CATGATCGAGCACGTTGACTACAGTGGAATGCGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAA
GAAAGGAGCCAAGATAGGTTGTCAGACGTTACCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCAT
GATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGC
CCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTG
TCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGC
GAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGA
GATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCA
GTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGT
TGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCG
GGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACA
GACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCA
GGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCC
TCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGT
CAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCA
GCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCAC
AGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTA
TCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGG
AGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAG
CCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTT
AATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCT
TCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGAT
CCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATC
CAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGT
GTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACAT
TGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTC
TCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCA
GGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAACCAAAGAGACCGTTCGTGGAGTCTAATGT
TTAAAAGACGTTTTGTTGGAGTGAGACCCATATGTTTTCACTGCACATTTTCAGGCTTGGTTTCCACATTCGAGGTAGTTCTCTGGCTTA
ATTTCTCATGTAGTTTCTGTGTGGTGTTCAGAGGTGGCAGCCCACATGCTGAAATCCTTTGCATGCAGCCGACTGGGAAGCGGCCTCCCG
GGAGCCAGGACTTCAGTTTCTCTTGTCTGTGCCCAGCCACATGCTCTCTCCCTCTCTTCAGATGCCAACGAGGAGATTTTCGTGCTGTGT
GCTTTAACCCAGGGAGATCAGACACACTGGTCAGCTTTTTCCAGGAGACAATCGCTTTCACTGATGTTCTTGTTGTGTAATTGTCTTTTT

>In-frame_BCAS3_ENST00000408905_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_12167nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGG
GCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTA
AAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAG
GTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTG
AAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAG
GCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAG
CCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATA
TTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATC
CAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCC
AGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCT
AGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGC
CCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCA
CCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAG
ATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCA
GCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGAC
ATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGC
CTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGA
TACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGC
CAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGG
CCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGG
CCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAA
GGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCAC
CTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCC
TTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTAC
AGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCT
CGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAA
CCAAAGAGACCGTTCGTGGAGTCTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCATATGTTTTCACTGCACATTTTCAGGCTTGGT
TTCCACATTCGAGGTAGTTCTCTGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCAGAGGTGGCAGCCCACATGCTGAAATCCTTTG
CATGCAGCCGACTGGGAAGCGGCCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGTGCCCAGCCACATGCTCTCTCCCTCTCTTCAG
ATGCCAACGAGGAGATTTTCGTGCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGGTCAGCTTTTTCCAGGAGACAATCGCTTTCAC
TGATGTTCTTGTTGTGTAATTGTCTTTTTCCTTTTTTAAAAAATAAGGTGTTCTTGTTCGTTTTCTTCTAGAAACTTTAGAAAGAGTGCG
ATGCCCCTTTGCCTTTGCATCCTTAGCCAGTGTCACCCACACAGCCAGCCGCAGCGCATTCTCATGCTGTGGCCCCTCCCCAGACCGCCA
GCGCCCTGCAGCCACCAGGTCTGCAGTGTGCATTAGGATTATTGCTGGTCTTCCTAGGGGGTAAAAGGATCAGAGAGAGAAGAATTAAGT
GCTAAATTGGAAGAAAACCCCAATATAATTATGTAAAATGTCACTACATTGATTTTCCAAGAGGCATTGTAGGAACATGTCAAAAACAGC
CAGCCCTTTAAATATTGCAGTCAGCCAAGGAAATTAGATGAGAATTGTGGCTATTAAGAGAATTCACTGAGAGTTATTCTCTAGATTTTT
AGCCGACAATTAACCACTAAAAGCTGCTGCTTTTCCAGGGTGGGGGAGGGAATGAATACATAGAAAAACAAAAAAGATTGTTCTGGATTC
TCAGTGAAAGGCTATAGGAAGTCTGTTCTGGAGACATCTACTTTTTAGATCCTGATACATCACTGAGTGTCATACTCCACTAAAAGGAAA
CTCTAACCGAAGGCTGGCTGGTGTGACAATCCCGTTAGTTGGATCTTCACCTACAGCCAGATTTTGTTCTAGTGGCCCTCTTCCTGTAAA
CCCAGATGGTGTCATACAGAAATTGTTTCTTTCAGAAGCAGATTGGAATCTCTTGGGACCATGAGACTGAGTCCCAATATTTCCACCCAG
GGTCATGCCCGTTGTTGTCTACTTCCATTTTGAGATCTATAGTTTGATTATCTATTATTACAGGAACTGTTTCTTTTCTTTTTCTAGGAG
TGTTTATGAGAGTGTGATATTTTAAAGTCAGACGCAGCAAAAACTGTTTCAGGGTGAAGAAAGACCCCTTTCAGCCCTGTTTTGCAGCCC
TGGGTGGGGGCATGAGATAGACAGCAAGCTTCTGATCTTGAAGCTTGTCTAGAAGACACATCTTCTAGGTCTCGTGGTCATTTGGTAGGC
TGACCTTTGAGTGAGCGAGGCCACTATTGAGTGGATAGCAAGAACATTGGAACCAAAGCCTCGGCACAGGCCTGGCACTGGCTGTACATC
AGCTCTTACAACTAAACAACTCAACTAAGCAACTGAAACGAAACAAAGGAGCATTCGTTCTCTGTTGTTAGGAATCATTCTGCTCTGTTA
GGGAAGGGCTGCAGGAAGGGCAGTTTCCTGAATAAAAATCTGGCTGCGACCAGTCCCATGTGTCTGGTAAGTAAGTAAGTAAGTAAGTGC
CCTTTGAAGGGATCATTAAGACACAGGGAGCATGAACCTGAGATCAGAAGCATTTCTTTACTAATTTAGATTCTGCGAAATAGACGGACC
TCTCCACCCCCAAACCTAAAACAGGCCAGGACTTGTCTCTGTGCTGAAAGCAAATAGCAAGACTAACTCAAGCCCCAGCCTCTTTCCACA
CTCCCTGATACCTAAGGACTGCTTTCTCAGCTAGACCAGGGTGGGCATCAGCGACGCCTTCTCAGCTAGACCAGGGTAGGCATCAGCGTC
CTCTCTCCATCTCTATACCCCTCTCTCTCACATCAGGAAGATGAAATGTGTAGCTCTAGCGGCAACCTCTAGCCAGGAGCCCAGTGGCCT
CTCAGATTGCTTTTTGGCCAGGTCTCAGCACTGCTGGCATCTTTACATCTTACTCCTTAAAACCGCCTCTCGCTGAGGAGCCACTGCATT
TTGAAGAATTTCTCAGTGTCTGTCAGGAAAGTGCTCCTGCTCATTTGGAACGCCACACACCACCCGCACTCACCTGTCCAGGCGAATGAG
CAGGTCCTGTAGCTTTACAAATATGCCGCTGATGCCGCTTCTCCCCAGGGTCTCTCAGTTTTCCAGGACAAAAAGATTTAGGGCCTATAC
CCTATGGGCAAAACACCTAAAATGTCAACAGTCAAAATGCCATTCTTTTTGGCCATCATAAGAGGGAGTAGGTATCACTGCTGCATGCCA
GTTGTTTTTGACTAGAATATGCCAACCAGAGCTTGTTGGGGCAGGAGACGTTTTTCCTTACAAGCAGACTGCCTGTGCCCTGTGCCCTGT
TTGCTACTTCACTGCCATGGAATGATCCGAGTACTGTATTTCAGAGCTGCCCCTTCCCCAGCAGCAAACACTCGCTGAGTCCATGTCTGG
CTTCAGGTGGGAGGAAATGTTTCAGATGAAACTTACTCAATTCATACCACCCTGAAATGGAGGACAGAGGTGACAAACTTCAGTTTAATA
GGTTTCTCACCAAGTTGTATGTTCCATTGGCCCAGGATTCTTGCACTAATGGGTTTCTATCACATCATGTCTATAAATGGGTGCACTTTA
CTGTTTGAATTTGTAACTGAAGTACTGGATATTTAAGTGTGAGTAATGTCTTCATTAGAAAATAGCAGAACCGCTCTTGTCTTTTAGTGT
ATTTTTCAAGAAAAAAGGAAAGGAAAGACATCAAGCAGTGGATCACAACATTTATAGCACAAGAAATAACTTGTATATAAGCATCAAAAA
GATTAAGAATTTTTTAATATGAAAAATATTTGCAGTGATTTTAAAGTGCTTTTCCAGCAATGTTCTTAGGGACTCCTGAGACACGGTTAC
TTTATCTACTGGATCAGTAAGGCACACAATTAACAATTAACAATTAATGTTTATTTACAAAGTAAAGGGAAAACCTGTGTAACATGAGAA
TTTGGCATGACAAAATGGAGACCATTTTGTATCTGCTGTTGTATCTTGTCCGGGTTGCAGACGTGCACTATTAAAGTCCCAAGTTAATAG
AGCACAAACCCTTCTCGCTCCTCCCCCATGTGCCCCTCTTTTTAGATGTGTATAACTTAAACTCGATGGCTCAGGAAAATTCCACTAATT
AGAATCATGTACAGTACCCCAGGTCGTTGTCCAGATATACAAGTTTGCTAATGTAGTTAAGCCTGGATTATTAAACACTTTTCCTAAATT
ATTGTAAACAGAACAGCTTAGAGAAAGGTATTCTCAGTCCTTAATATTGTATAGTAGTTTATGAGCCCCTCTCTAAATATTGGTATTTTT
ATATTCCAGAGATGTACCCAATAGAAAAAATTAAAAATTAATCAGTATCTAATTTAATATCCATAAGTATTTTTCCTTAGATTTTAGTCA
CGTACAGTGGGCTATGTGGATGTCACTTGTGCTTCACCATAGTTTACCACTAGGTGTCACTGTGGCTCTGCACTGCGCTTGTTTTGTAGC
AAAGAACAGCGGCATCCCCTCGGGAGAGAGGAGCTGCTTCCAGGGCAACAGGCAAGCGGGCTCAGAGGTTCAGGAGAAGGCAACAGAGGC
CTGGAAGGGGTCTTCGTGCATCTGTGCCAGTTGTGCAAGACGAACTCTTTGAACACTACATGCTTTGGACTTCAGCCAGGCAGAGGCTGG
AAGAAGGTTGACCAGAGCTCCCTTGCTCTGGTAGAGGGATGGGTACATGGAGAAGCCCCTTCTTCCCCATGAGCCTCCCTCCTGTCAGTT
CCTCTCAGCCTCCAGCTTTTATAACTCCAGAAGCGTCACAGTTGGGTGGTTTGATTCAGAGAGAGTTATTTTTCTACTGCAGAAATGCCT
TGGACAAAACCAGTGCTCACTGAATCTTTGCCACAAAATGGAATAGGCTATCCCAGGGGGCAAGAGGTGCCCGCCCCTGTGCCCAGCCTC
CTCTTGATGCTCCCAGTGCCCAGCAGCCTCGCACACCCTGCCTGTCTGTTCCTGGGCTGCCCATTTCTCAAGAAACCGACCTGCAAAGGC
AGCCGGCTGCTGCCTCCACACCGAGGGCTGTGCGGTCCTGCTGCTCGCTCACTGGGAGGTGCAGCTCTTTCTCCTCTTCCTCTAGGAATT
CCAGACCGACCATCTACCATGACTAACAACAATGAACAAAGGGCTTAGGGGCAAGAGCTACCTGCAAAGACGTGTCATGGAACCCTTCAC
CATGCAATGCCTTGAACTCAGCTCTGGCTGCTCCCAAGAAAAGGTGGCTGGCTGGGGGCCTGGACACAAGCACAATGGGGCTGGTGGAGC
CACTGTGCAGAGCTACTTGAATAATCACTGGGTTTTCATCAACTCCTTTTGTCATACAGACCACTCAAGGGCTGAAGTGTTGGTAACCTT
CATTTCGGTGTCCAAAGCCTCACAGCAGGTGAGCCACCCTGAGATGCTTGTGGCCACATGGTGGCCACAGTCAGAGCTTTGAAAGTCAGT
ACCAAATGAACGCATAATTGGACACCAAAAATCAAGTGTTACTTTCATGTTTCCTCACCCCATCATCTCATTGCCTCCTGCTGACTCTGA
TACCGACGCTGAGCTGACTTGCCAGGCTGCCGCTGGACGCGTAGAGATCAGGCCAGCGCCGCGCTCATTTTTCCAGGTAGACCTACTCTG
TGGAACGGAAGTGCCCTAGCTGCTTTGTTTTTGTAGCACTTGCTGGCTGAATTTTTCTTTTGCTAATCGCTAACCAGAAAGTCTGGTTAG
AGGGGGCTCAACTCAATCCCTTTGGTCCCCAGCGCCAGACAAGAGTTAATTCTGGAAAATTCAGTACTTGAATGTACCTGCCTTATTGCA
TACCAATTTACTGGGGGGAAAAAAAAAGTTAAGAGATGCCGGCTCCAGATCTCCACTTCATTCACAGGTGATTTTGGAAATCCTGTAAGT
TACACTTCCTGTTCTGGTTTTGTTTTGTTTTTTGTTTCCTTTGGCTGATTCCTGCTGAGTGAGGCCAGTTCCTCATCAGGCTCAGGGCAG
GTGCCTTTTCAGGCGTGGCCTCCTTTCCATCTAGCACAGCATCTTTGTCTCTGTTCTGTCTCCTCCAAATCCAAGATGATTTTAATTAGT
ACAGACATGTACAGTCTACAATTAAAGAGTGATTTGTACTAATATGATTTTGATTCTTCCTCCTCTTTGCTGTCCTTTCAAGACACTTGC
TGGAAAAAGCTTTAATGCACTTAGTTTTCCTTTAGGTTTTCTATGACTCAGATGTAAAGGACTTTCTCTGTACAGTATATTATCCAATGC
ATGTTTGTTCTCTCTCCTGATATATTGAACACCACACAGTTGTGAAGCCGTGCAGTGGGGATGCCCCACACCCCACAGAGGCATCTACCC
CTGTGTATAAGGAAAGACATTTTCCTTTGCTGTACTTGCTTGAGCAGTTTTATTGTCTGTACATGTGAGCTGTGTGAGATAGATGTGAAA
AGTTCAAATGAATGCATTTTCCTGCCCCATGTATACAGATTGTCATCTGTACAAGGAACTGTATGTATGAAAGCAAATGTACTTATTTAT

>In-frame_BCAS3_ENST00000408905_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6854nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTA
CCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAG
GGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGT
GAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCG
GAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAG
TTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAA
GAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAG
CATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAG
GCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTT
GGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCT
CCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCT
GTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGT
ATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCA
TTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCC
CAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATG
GCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGAT
GGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGA
CCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCAC
TCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAAC
GAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCC
TCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGT
GACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGAT
AAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACG
TCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAG
AATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAG
GCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGAC
TCTCGGCAAGGGCAGACATCCCCTATCAAACCAAAGAGACCGTTCGTGGAGTCTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCAT
ATGTTTTCACTGCACATTTTCAGGCTTGGTTTCCACATTCGAGGTAGTTCTCTGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCAG
AGGTGGCAGCCCACATGCTGAAATCCTTTGCATGCAGCCGACTGGGAAGCGGCCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGTG
CCCAGCCACATGCTCTCTCCCTCTCTTCAGATGCCAACGAGGAGATTTTCGTGCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGGT
CAGCTTTTTCCAGGAGACAATCGCTTTCACTGATGTTCTTGTTGTGTAATTGTCTTTTTCCTTTTTTAAAAAATAAGGTGTTCTTGTTCG

>In-frame_BCAS3_ENST00000588462_chr17_58952099_+_TANC2_ENST00000424789_chr17_61271352_+_12167nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTCCAGCCACATGG
GCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAGGGGGACATGTTTTATAAGAAAGGTAAAGTA
AAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGTGAGGACTTGAAAACTTTCCGGGAACTAAAG
GTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCGGAGGAATTTGCTACTAAGGCCCTGGAGCTG
AAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAGTTCGCAGCAGCCTTAGAGGACCTGAACGAG
GCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAAGAGTGTAGACAGATGCAGCAGCCACAGCAG
CCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAGCATGAAGACATATACTCTGTACAGGATATA
TTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAGGCCCGGCCCAGCCAGGGGCTCCCGGTCATC
CAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTTGGCTCTCATCAGGTTTTTGACTTCCGGTCC
AGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCTCCAACTCATCAGAACTCACATTACAGGCCT
AGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCTGTGGGAGGACAGGGCAAAGAATACCCAAGC
CCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGTATGAGTGTCTATAGATCCCAGTCTGGTTCA
CCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCATTATCCAAAATGGCCCAGCGGCCCTACCAG
ATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCCCAGATTGTGAGAAGTAACCAGCCCAGCCCA
GCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATGGCCAGTAAATACCAGTCTTCACAAGGAGAC
ATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGATGGAAGGCCGGTGCAGCATGTCCAAGCCAGC
CTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGACCTTCCTCAGCATACCGAGGTGGCGTGAGA
TACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCACTCAAAACTAGATCTGGAGCGCTCCTCCAGC
CAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAACGAAATCAAACCGCACCCGCCAACTCCCAGG
CCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCCTCCACCTCCAACCTAACTCCGACCTTCCGG
CCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGTGACGAGCTGTCGCCAGTGTCTCCAACTCAA
GGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGATAAAACAGCACGGACTCAGCAGTACCCCCAC
CTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACGTCTCCAGGCAACCTGCCTCAGCCTGAGTCC
TTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAGAATGGCCATTTGCTGGAGGACGATTATTAC
AGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAGGCCTCCTCCTATCCCGACGTGAAGGTAGCT
CGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGACTCTCGGCAAGGGCAGACATCCCCTATCAAA
CCAAAGAGACCGTTCGTGGAGTCTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCATATGTTTTCACTGCACATTTTCAGGCTTGGT
TTCCACATTCGAGGTAGTTCTCTGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCAGAGGTGGCAGCCCACATGCTGAAATCCTTTG
CATGCAGCCGACTGGGAAGCGGCCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGTGCCCAGCCACATGCTCTCTCCCTCTCTTCAG
ATGCCAACGAGGAGATTTTCGTGCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGGTCAGCTTTTTCCAGGAGACAATCGCTTTCAC
TGATGTTCTTGTTGTGTAATTGTCTTTTTCCTTTTTTAAAAAATAAGGTGTTCTTGTTCGTTTTCTTCTAGAAACTTTAGAAAGAGTGCG
ATGCCCCTTTGCCTTTGCATCCTTAGCCAGTGTCACCCACACAGCCAGCCGCAGCGCATTCTCATGCTGTGGCCCCTCCCCAGACCGCCA
GCGCCCTGCAGCCACCAGGTCTGCAGTGTGCATTAGGATTATTGCTGGTCTTCCTAGGGGGTAAAAGGATCAGAGAGAGAAGAATTAAGT
GCTAAATTGGAAGAAAACCCCAATATAATTATGTAAAATGTCACTACATTGATTTTCCAAGAGGCATTGTAGGAACATGTCAAAAACAGC
CAGCCCTTTAAATATTGCAGTCAGCCAAGGAAATTAGATGAGAATTGTGGCTATTAAGAGAATTCACTGAGAGTTATTCTCTAGATTTTT
AGCCGACAATTAACCACTAAAAGCTGCTGCTTTTCCAGGGTGGGGGAGGGAATGAATACATAGAAAAACAAAAAAGATTGTTCTGGATTC
TCAGTGAAAGGCTATAGGAAGTCTGTTCTGGAGACATCTACTTTTTAGATCCTGATACATCACTGAGTGTCATACTCCACTAAAAGGAAA
CTCTAACCGAAGGCTGGCTGGTGTGACAATCCCGTTAGTTGGATCTTCACCTACAGCCAGATTTTGTTCTAGTGGCCCTCTTCCTGTAAA
CCCAGATGGTGTCATACAGAAATTGTTTCTTTCAGAAGCAGATTGGAATCTCTTGGGACCATGAGACTGAGTCCCAATATTTCCACCCAG
GGTCATGCCCGTTGTTGTCTACTTCCATTTTGAGATCTATAGTTTGATTATCTATTATTACAGGAACTGTTTCTTTTCTTTTTCTAGGAG
TGTTTATGAGAGTGTGATATTTTAAAGTCAGACGCAGCAAAAACTGTTTCAGGGTGAAGAAAGACCCCTTTCAGCCCTGTTTTGCAGCCC
TGGGTGGGGGCATGAGATAGACAGCAAGCTTCTGATCTTGAAGCTTGTCTAGAAGACACATCTTCTAGGTCTCGTGGTCATTTGGTAGGC
TGACCTTTGAGTGAGCGAGGCCACTATTGAGTGGATAGCAAGAACATTGGAACCAAAGCCTCGGCACAGGCCTGGCACTGGCTGTACATC
AGCTCTTACAACTAAACAACTCAACTAAGCAACTGAAACGAAACAAAGGAGCATTCGTTCTCTGTTGTTAGGAATCATTCTGCTCTGTTA
GGGAAGGGCTGCAGGAAGGGCAGTTTCCTGAATAAAAATCTGGCTGCGACCAGTCCCATGTGTCTGGTAAGTAAGTAAGTAAGTAAGTGC
CCTTTGAAGGGATCATTAAGACACAGGGAGCATGAACCTGAGATCAGAAGCATTTCTTTACTAATTTAGATTCTGCGAAATAGACGGACC
TCTCCACCCCCAAACCTAAAACAGGCCAGGACTTGTCTCTGTGCTGAAAGCAAATAGCAAGACTAACTCAAGCCCCAGCCTCTTTCCACA
CTCCCTGATACCTAAGGACTGCTTTCTCAGCTAGACCAGGGTGGGCATCAGCGACGCCTTCTCAGCTAGACCAGGGTAGGCATCAGCGTC
CTCTCTCCATCTCTATACCCCTCTCTCTCACATCAGGAAGATGAAATGTGTAGCTCTAGCGGCAACCTCTAGCCAGGAGCCCAGTGGCCT
CTCAGATTGCTTTTTGGCCAGGTCTCAGCACTGCTGGCATCTTTACATCTTACTCCTTAAAACCGCCTCTCGCTGAGGAGCCACTGCATT
TTGAAGAATTTCTCAGTGTCTGTCAGGAAAGTGCTCCTGCTCATTTGGAACGCCACACACCACCCGCACTCACCTGTCCAGGCGAATGAG
CAGGTCCTGTAGCTTTACAAATATGCCGCTGATGCCGCTTCTCCCCAGGGTCTCTCAGTTTTCCAGGACAAAAAGATTTAGGGCCTATAC
CCTATGGGCAAAACACCTAAAATGTCAACAGTCAAAATGCCATTCTTTTTGGCCATCATAAGAGGGAGTAGGTATCACTGCTGCATGCCA
GTTGTTTTTGACTAGAATATGCCAACCAGAGCTTGTTGGGGCAGGAGACGTTTTTCCTTACAAGCAGACTGCCTGTGCCCTGTGCCCTGT
TTGCTACTTCACTGCCATGGAATGATCCGAGTACTGTATTTCAGAGCTGCCCCTTCCCCAGCAGCAAACACTCGCTGAGTCCATGTCTGG
CTTCAGGTGGGAGGAAATGTTTCAGATGAAACTTACTCAATTCATACCACCCTGAAATGGAGGACAGAGGTGACAAACTTCAGTTTAATA
GGTTTCTCACCAAGTTGTATGTTCCATTGGCCCAGGATTCTTGCACTAATGGGTTTCTATCACATCATGTCTATAAATGGGTGCACTTTA
CTGTTTGAATTTGTAACTGAAGTACTGGATATTTAAGTGTGAGTAATGTCTTCATTAGAAAATAGCAGAACCGCTCTTGTCTTTTAGTGT
ATTTTTCAAGAAAAAAGGAAAGGAAAGACATCAAGCAGTGGATCACAACATTTATAGCACAAGAAATAACTTGTATATAAGCATCAAAAA
GATTAAGAATTTTTTAATATGAAAAATATTTGCAGTGATTTTAAAGTGCTTTTCCAGCAATGTTCTTAGGGACTCCTGAGACACGGTTAC
TTTATCTACTGGATCAGTAAGGCACACAATTAACAATTAACAATTAATGTTTATTTACAAAGTAAAGGGAAAACCTGTGTAACATGAGAA
TTTGGCATGACAAAATGGAGACCATTTTGTATCTGCTGTTGTATCTTGTCCGGGTTGCAGACGTGCACTATTAAAGTCCCAAGTTAATAG
AGCACAAACCCTTCTCGCTCCTCCCCCATGTGCCCCTCTTTTTAGATGTGTATAACTTAAACTCGATGGCTCAGGAAAATTCCACTAATT
AGAATCATGTACAGTACCCCAGGTCGTTGTCCAGATATACAAGTTTGCTAATGTAGTTAAGCCTGGATTATTAAACACTTTTCCTAAATT
ATTGTAAACAGAACAGCTTAGAGAAAGGTATTCTCAGTCCTTAATATTGTATAGTAGTTTATGAGCCCCTCTCTAAATATTGGTATTTTT
ATATTCCAGAGATGTACCCAATAGAAAAAATTAAAAATTAATCAGTATCTAATTTAATATCCATAAGTATTTTTCCTTAGATTTTAGTCA
CGTACAGTGGGCTATGTGGATGTCACTTGTGCTTCACCATAGTTTACCACTAGGTGTCACTGTGGCTCTGCACTGCGCTTGTTTTGTAGC
AAAGAACAGCGGCATCCCCTCGGGAGAGAGGAGCTGCTTCCAGGGCAACAGGCAAGCGGGCTCAGAGGTTCAGGAGAAGGCAACAGAGGC
CTGGAAGGGGTCTTCGTGCATCTGTGCCAGTTGTGCAAGACGAACTCTTTGAACACTACATGCTTTGGACTTCAGCCAGGCAGAGGCTGG
AAGAAGGTTGACCAGAGCTCCCTTGCTCTGGTAGAGGGATGGGTACATGGAGAAGCCCCTTCTTCCCCATGAGCCTCCCTCCTGTCAGTT
CCTCTCAGCCTCCAGCTTTTATAACTCCAGAAGCGTCACAGTTGGGTGGTTTGATTCAGAGAGAGTTATTTTTCTACTGCAGAAATGCCT
TGGACAAAACCAGTGCTCACTGAATCTTTGCCACAAAATGGAATAGGCTATCCCAGGGGGCAAGAGGTGCCCGCCCCTGTGCCCAGCCTC
CTCTTGATGCTCCCAGTGCCCAGCAGCCTCGCACACCCTGCCTGTCTGTTCCTGGGCTGCCCATTTCTCAAGAAACCGACCTGCAAAGGC
AGCCGGCTGCTGCCTCCACACCGAGGGCTGTGCGGTCCTGCTGCTCGCTCACTGGGAGGTGCAGCTCTTTCTCCTCTTCCTCTAGGAATT
CCAGACCGACCATCTACCATGACTAACAACAATGAACAAAGGGCTTAGGGGCAAGAGCTACCTGCAAAGACGTGTCATGGAACCCTTCAC
CATGCAATGCCTTGAACTCAGCTCTGGCTGCTCCCAAGAAAAGGTGGCTGGCTGGGGGCCTGGACACAAGCACAATGGGGCTGGTGGAGC
CACTGTGCAGAGCTACTTGAATAATCACTGGGTTTTCATCAACTCCTTTTGTCATACAGACCACTCAAGGGCTGAAGTGTTGGTAACCTT
CATTTCGGTGTCCAAAGCCTCACAGCAGGTGAGCCACCCTGAGATGCTTGTGGCCACATGGTGGCCACAGTCAGAGCTTTGAAAGTCAGT
ACCAAATGAACGCATAATTGGACACCAAAAATCAAGTGTTACTTTCATGTTTCCTCACCCCATCATCTCATTGCCTCCTGCTGACTCTGA
TACCGACGCTGAGCTGACTTGCCAGGCTGCCGCTGGACGCGTAGAGATCAGGCCAGCGCCGCGCTCATTTTTCCAGGTAGACCTACTCTG
TGGAACGGAAGTGCCCTAGCTGCTTTGTTTTTGTAGCACTTGCTGGCTGAATTTTTCTTTTGCTAATCGCTAACCAGAAAGTCTGGTTAG
AGGGGGCTCAACTCAATCCCTTTGGTCCCCAGCGCCAGACAAGAGTTAATTCTGGAAAATTCAGTACTTGAATGTACCTGCCTTATTGCA
TACCAATTTACTGGGGGGAAAAAAAAAGTTAAGAGATGCCGGCTCCAGATCTCCACTTCATTCACAGGTGATTTTGGAAATCCTGTAAGT
TACACTTCCTGTTCTGGTTTTGTTTTGTTTTTTGTTTCCTTTGGCTGATTCCTGCTGAGTGAGGCCAGTTCCTCATCAGGCTCAGGGCAG
GTGCCTTTTCAGGCGTGGCCTCCTTTCCATCTAGCACAGCATCTTTGTCTCTGTTCTGTCTCCTCCAAATCCAAGATGATTTTAATTAGT
ACAGACATGTACAGTCTACAATTAAAGAGTGATTTGTACTAATATGATTTTGATTCTTCCTCCTCTTTGCTGTCCTTTCAAGACACTTGC
TGGAAAAAGCTTTAATGCACTTAGTTTTCCTTTAGGTTTTCTATGACTCAGATGTAAAGGACTTTCTCTGTACAGTATATTATCCAATGC
ATGTTTGTTCTCTCTCCTGATATATTGAACACCACACAGTTGTGAAGCCGTGCAGTGGGGATGCCCCACACCCCACAGAGGCATCTACCC
CTGTGTATAAGGAAAGACATTTTCCTTTGCTGTACTTGCTTGAGCAGTTTTATTGTCTGTACATGTGAGCTGTGTGAGATAGATGTGAAA
AGTTCAAATGAATGCATTTTCCTGCCCCATGTATACAGATTGTCATCTGTACAAGGAACTGTATGTATGAAAGCAAATGTACTTATTTAT

>In-frame_BCAS3_ENST00000588462_chr17_58952099_+_TANC2_ENST00000389520_chr17_61271352_+_6854nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGTGATGCTGAACAGGAGCTTGGCCCCCCTCCATCTGTAGATGAGGCAGCAAACACACTC
ATGACTCGTCTGGGTTTCCTCCTTGGAGAGAAAGTCACAGAAGTTCAGCCAGGTGACCAATACAGCATGGAAGTACAGGATGAAAATCAG
ACCTCAGCAATCACCCAGCGGATAAGTCCTTGTTCCACTCTGACTAGCAGCACTGCCTCTCCACCAGCCAGTAGCCCCTGCTCTACACTC
CCACCCATCAGTACAAATGCAACTGCCAAGGACTGCAGCTATGGGGCTGTTACTAGTCCAACCTCTACCCTTGAAAGCAGAGATAGTGGC
ATCATTGCTACATTAACAAGCTATTCTGAAAATGTGGAACGCACAAAATATGCTGGGGAAAGCAGTAAAGAATTAGGATCTGGAGGAAAC
ATAAAACCTTGGCAGTCTCAAAAATCCAGCATGGACTCCTGTTTGTATCGAGTAGATGAAAACATGACTGCTTCCACCTATAGTCTGAAT
AAGATCCCAGAGAGAAATTTGGAAACAGTGTTATCTCAATCAGTACAGTCTATTCCTTTGTATCTCATGCCACGGCCAAATTCAGTAGCA
GCCACCAGCTCTGCCCACTTGGAAGACCTTGCTTACCTGGATGAGCAGAGACATACACCTTTGAGAACTTCTCTACGAATGCCAAGACAG
AGCATGGGTGGTGCTCGCACACAGCAGGATTTAAGAGTTCGCTTTGCACCTTATAGGCCTCCAGATATCTCCTTGAAGCCTCTGCTCTTT
GAAGTGCCCAGCATCACTACAGAGTCAGTGTTTGTTGGCCGAGATTGGGTTTTCCACGAAATAGATGCTCAACTTCAAAGTTCAAATGCC
AGCGTGAACCAAGGAGTAGTGATTGTGGGAAACATTGGATTCGGCAAAACTGCCATCATCTCCAGACTGGTGGCCCTCAGCTGCCATGGT
ACAAGGATGAGACAGATCGCCTCAGACAGCCCACATGCCTCCCCCAAACATGTGGATGCCAACAGAGAGCTGCCACTCACACAGCCACCT
TCAGCCCACTCATCTATCACCAGTGGAAGCTGCCCAGGAACTCCGGAAATGCGCAGGCGGCAGGAGGAGGCTATGCGAAGACTAGCCTCG
CAGGTGGTTGCCTATCACTATTGTCAAGCAGATAATGCCTACACTTGCTTGGTGCCAGAATTTGTCCACAATGTTGCTGCCTTGCTCTGC
CGCTCACCTCAGCTGACAGCCTATCGGGAGCAGCTTCTTCGGGAACCTCACCTGCAGAGCATGCTGAGCCTTCGTTCCTGTGTTCAAGAC
CCCATGGCCTCCTTCCGGAGGGGAGTTCTGGAGCCACTAGAAAATCTCCATAAAGAGAGAAAAATCCCAGATGAAGATTTCATCATTTTA
ATTGATGGATTAAATGAAGCAGAATTTCACAAACCGGATTATGGGGATACAATTGTATCGTTTCTGAGTAAAATGATCGGAAAGTTTCCT
TCTTGGCTCAAACTAATTGTAACAGTTAGGACCAGTTTACAGGAAATTACCAAGCTGCTGCCTTTCCATAGGATTTTTTTGGATCGACTA
GAAGAGAATGAAGCCATAGACCAGGACCTGCAGGCTTACATCCTGCACCGGATACACAGCAGCTCAGAGATCCAGAATAACATTTCACTT
AATGGCAAAATGGACAATACTACATTTGGCAAACTCAGTTCTCATCTCAAGACCCTCAGTCAAGGGTCCTATCTATATCTGAAACTTACA
TTTGACCTCATAGAGAAAGGCTATCTAGTGTTAAAGAGCTCTAGCTACAAAGTAGTTCCTGTTTCGCTCTCAGAGGTTTATTTACTCCAG
TGCAATATGAAGTTCCCAACCCAGTCTTCCTTTGACCGGGTGATGCCTCTCCTGAATGTGGCAGTGGCCTCTCTCCACCCACTGACTGAT
GAGCATATCTTCCAGGCCATCAATGCTGGGAGCATTGAAGGCACACTAGAATGGGAGGATTTTCAGCAGAGAATGGAGAACCTCTCCATG
TTCCTAATCAAGCGCAGAGACATGACTCGTATGTTTGTACATCCTTCTTTTCGAGAATGGCTTATCTGGAGAGAAGAAGGAGAGAAAACC
AAATTTCTCTGTGATCCGAGGAGTGGTCACACGTTACTTGCCTTCTGGTTTTCCCGCCAAGAGGGAAAACTAAACCGACAGCAGACTATT
GAACTGGGACATCACATCCTCAAAGCACACATTTTTAAGGGTTTGAGTAAAAAAGTTGGTGTATCATCCTCCATCCTCCAAGGTCTCTGG
ATCTCTTATAGCACAGAAGGTCTTTCCATGGCACTGGCGTCTTTACGAAATCTCTACACTCCAAATATAAAGGTCAGCCGACTGCTGATT
TTGGGAGGTGCCAATATTAATTACCGGACAGAGGTTTTAAATAATGCTCCAATTCTATGTGTTCAGTCCCATCTTGGTTACACAGAAATG
GTAGCCCTGCTGCTGGAGTTCGGGGCCAACGTGGATGCCTCTTCTGAAAGTGGCCTGACTCCCCTGGGATATGCTGCAGCAGCAGGGTAC
CTGAGCATTGTGGTGCTGCTGTGCAAGAAACGGGCCAAGGTGGATCATTTGGATAAGAACGGGCAGTGTGCTTTGGTTCATGCTGCACTC
CGAGGTCATCTGGAGGTTGTCAAGTTTTTGATTCAGTGTGACTGGACGATGGCCGGCCAGCAGCAAGGAGTATTTAAGAAGAGCCATGCC
ATCCAACAGGCCCTCATTGCTGCAGCCAGCATGGGTTATACTGAGATTGTCTCCTACCTACTTGATCTTCCAGAAAAAGATGAAGAGGAA
GTAGAGCGAGCACAGATCAACAGCTTTGACAGTCTCTGGGGAGAGACAGCCCTAACAGCTGCAGCCGGAAGGGGCAAACTGGAGGTGTGC
CGTTTGCTCTTGGAACAAGGGGCGGCAGTGGCCCAGCCAAACCGCCGAGGAGCAGTGCCACTATTCAGCACAGTGCGCCAGGGCCACTGG
CAGATTGTTGATCTTTTACTCACCCATGGAGCTGATGTCAACATGGCAGACAAGCAGGGCCGCACTCCCCTGATGATGGCTGCTTCCGAA
GGCCATCTAGGAACCGTGGACTTTCTGCTTGCACAAGGTGCCTCCATTGCTCTTATGGACAAAGAAGGATTGACAGCCCTCAGCTGGGCT
TGTTTGAAGGGCCATCTCTCAGTAGTACGTTCTCTGGTGGATAACGGAGCTGCCACAGACCATGCTGACAAGAATGGCCGTACCCCACTG
GATCTGGCAGCTTTCTATGGCGATGCTGAGGTGGTCCAGTTCCTGGTAGATCATGGGGCCATGATCGAGCACGTTGACTACAGTGGAATG
CGCCCTTTGGATAGGGCAGTGGGGTGCCGGAACACTTCTGTTGTTGTCACTCTTCTGAAGAAAGGAGCCAAGATAGGTTGTCAGACGTTA
CCGAGTCGCCCACGAGGTCCAGCCACATGGGCGATGGCCACCTCCAAGCCAGACATCATGATCATCCTGTTGAGCAAGCTGATGGAAGAG
GGGGACATGTTTTATAAGAAAGGTAAAGTAAAGGAAGCTGCCCAGCGCTACCAGTACGCCCTGAAGAAGTTCCCTAGAGAAGGGTTTGGT
GAGGACTTGAAAACTTTCCGGGAACTAAAGGTGTCTCTCCTCCTCAACCTCTCTCGGTGTCGCAGGAAAATGAACGATTTTGGAATGGCG
GAGGAATTTGCTACTAAGGCCCTGGAGCTGAAACCGAAATCTTATGAAGCTTACTATGCGAGAGCAAGGGCAAAACGCAGCAGCAGACAG
TTCGCAGCAGCCTTAGAGGACCTGAACGAGGCCATCAAGCTGTGTCCCAACAACCGTGAGATCCAGAGACTTCTGCTGAGAGTGGAAGAA
GAGTGTAGACAGATGCAGCAGCCACAGCAGCCACCGCCGCCACCGCAGCCTCAGCAGCAGTTGCCGGAAGAAGCAGAACCTGAGCCACAG
CATGAAGACATATACTCTGTACAGGATATATTCGAGGAGGAGTACCTGGAACAGGATGTTGAAAATGTTTCCATTGGCCTCCAGACAGAG
GCCCGGCCCAGCCAGGGGCTCCCGGTCATCCAGAGCCCACCCTCCTCTCCCCCGCATCGGGACTCAGCCTACATCTCCAGCTCACCTCTT
GGCTCTCATCAGGTTTTTGACTTCCGGTCCAGTAGTTCTGTAGGCTCTCCCACTAGACAGACCTATCAGTCCACCTCACCTGCCCTTTCT
CCAACTCATCAGAACTCACATTACAGGCCTAGCCCACCACACACTTCCCCGGCTCATCAGGGAGGATCTTACCGTTTCAGCCCCCCTCCT
GTGGGAGGACAGGGCAAAGAATACCCAAGCCCTCCCCCTTCCCCTCTCCGGAGAGGCCCTCAGTATCGGGCCAGCCCTCCAGCTGAAAGT
ATGAGTGTCTATAGATCCCAGTCTGGTTCACCCGTGCGCTATCAGCAGGAAACAAGCGTCAGTCAGCTTCCTGGCAGACCCAAATCTCCA
TTATCCAAAATGGCCCAGCGGCCCTACCAGATGCCTCAGCTCCCTGTGGCAGTTCCCCAGCAAGGGCTCAGGCTACAGCCTGCCAAGGCC
CAGATTGTGAGAAGTAACCAGCCCAGCCCAGCCGTCCATTCAAGCACCGTCATCCCCACAGGAGCCTATGGCCAAGTAGCCCATTCAATG
GCCAGTAAATACCAGTCTTCACAAGGAGACATAGGAGTCAGCCAGAGCCGGTTGGTTTATCAAGGGTCAATTGGGGGAATCGTAGGGGAT
GGAAGGCCGGTGCAGCATGTCCAAGCCAGCCTGAGTGCAGGCGCCATCTGTCAGCATGGAGGATTGACCAAAGAGGATCTTCCACAGCGA
CCTTCCTCAGCATACCGAGGTGGCGTGAGATACAGCCAGACACCACAGATCGGACGCAGCCAGTCAGCATCCTATTACCCAGTCTGTCAC
TCAAAACTAGATCTGGAGCGCTCCTCCAGCCAACTAGGTTCCCCTGATGTGTCGCATTTAATCAGAAGACCTATCAGTGTCAACCCTAAC
GAAATCAAACCGCACCCGCCAACTCCCAGGCCGTTGCTGCATTCCCAAAGTGTAGGCCTTCGCTTCTCTCCATCTAGCAATAGTATCTCC
TCCACCTCCAACCTAACTCCGACCTTCCGGCCATCTTCTTCCATCCAGCAAATGGAGATCCCACTGAAACCTGCATATGAGAGGTCATGT
GACGAGCTGTCGCCAGTGTCTCCAACTCAAGGAGGTTACCCCAGTGAGCCCACCCGATCCAGGACCACACCATTCATGGGGATCATAGAT
AAAACAGCACGGACTCAGCAGTACCCCCACCTCCACCAGCAGAATCGGACCTGGGCAGTGTCATCTGTGGACACCGTCCTCAGTCCCACG
TCTCCAGGCAACCTGCCTCAGCCTGAGTCCTTCAGTCCACCATCATCCATCAGCAACATTGCCTTTTATAACAAAACCAACAATGCACAG
AATGGCCATTTGCTGGAGGACGATTATTACAGCCCCCATGGGATGCTGGCTAACGGGTCTCGTGGAGACCTCTTGGAGCGAGTCAGCCAG
GCCTCCTCCTATCCCGACGTGAAGGTAGCTCGGACTCTACCTGTGGCTCAGGCATACCAGGACAACCTGTACAGGCAGCTGTCCCGAGAC
TCTCGGCAAGGGCAGACATCCCCTATCAAACCAAAGAGACCGTTCGTGGAGTCTAATGTTTAAAAGACGTTTTGTTGGAGTGAGACCCAT
ATGTTTTCACTGCACATTTTCAGGCTTGGTTTCCACATTCGAGGTAGTTCTCTGGCTTAATTTCTCATGTAGTTTCTGTGTGGTGTTCAG
AGGTGGCAGCCCACATGCTGAAATCCTTTGCATGCAGCCGACTGGGAAGCGGCCTCCCGGGAGCCAGGACTTCAGTTTCTCTTGTCTGTG
CCCAGCCACATGCTCTCTCCCTCTCTTCAGATGCCAACGAGGAGATTTTCGTGCTGTGTGCTTTAACCCAGGGAGATCAGACACACTGGT
CAGCTTTTTCCAGGAGACAATCGCTTTCACTGATGTTCTTGTTGTGTAATTGTCTTTTTCCTTTTTTAAAAAATAAGGTGTTCTTGTTCG


Top

FusionGenePPI for BCAS3_TANC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2BTANC2LATS2, YWHAB, PPP1CC, PPP1CA, XPO1, NR2C2, BRAP, CDC5L, ZYX, PAK7, KCTD3, KIF13B, CGN, ZBTB21, KSR1, GIGYF1, LPIN3, MAPRE1, LRFN1, RTKN, DENND4C, MAST3, SH3RF3, DENND1A, SH3PXD2A, SRGAP2, PPM1H, PTPN13, RALGPS2, EIF4E2, SIPA1L1, NF1, CDC25C, CBY1, GIGYF2, INPP5E


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCAS3_TANC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BCAS3_TANC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource