FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3962

FusionGeneSummary for BCAS3_RNF169

check button Fusion gene summary
Fusion gene informationFusion gene name: BCAS3_RNF169
Fusion gene ID: 3962
HgeneTgene
Gene symbol

BCAS3

RNF169

Gene ID

54828

254225

Gene nameBCAS3, microtubule associated cell migration factorring finger protein 169
SynonymsGAOB1|MAAB-
Cytomap

17q23.2

11q13.4

Type of geneprotein-codingprotein-coding
Descriptionbreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab1E3 ubiquitin-protein ligase RNF169RING-type E3 ubiquitin transferase RNF169
Modification date2018052320180520
UniProtAcc

Q9H6U6

Q8NCN4

Ensembl transtripts involved in fusion geneENST00000589222, ENST00000407086, 
ENST00000390652, ENST00000408905, 
ENST00000588462, ENST00000585744, 
ENST00000588874, ENST00000585812, 
ENST00000299563, 
Fusion gene scores* DoF score40 X 23 X 15=138008 X 6 X 3=144
# samples 478
** MAII scorelog2(47/13800*10)=-4.87586369998789
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/144*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BCAS3 [Title/Abstract] AND RNF169 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

HgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

HgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058

TgeneRNF169

GO:0006974

cellular response to DNA damage stimulus

22733822

TgeneRNF169

GO:2000780

negative regulation of double-strand break repair

22742833


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A18R-01ABCAS3chr17

58786686

+RNF169chr11

74521229

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000589222ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+
In-frameENST00000407086ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+
In-frameENST00000390652ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+
In-frameENST00000408905ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+
In-frameENST00000588462ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+
intron-3CDSENST00000585744ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+
intron-3CDSENST00000588874ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+
intron-3CDSENST00000585812ENST00000299563BCAS3chr17

58786686

+RNF169chr11

74521229

+

Top

FusionProtFeatures for BCAS3_RNF169


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCAS3

Q9H6U6

RNF169

Q8NCN4

Probable E3 ubiquitin-protein ligase that acts as anegative regulator of double-strand breaks (DSBs) repair followingDNA damage. Recruited to DSB repair sites by recognizing andbinding ubiquitin catalyzed by RNF168 and competes with TP53BP1and BRCA1 for association with RNF168-modified chromatin, therebyacting as a negative regulator of DSBs repair. E3 ubiquitin-protein ligase activity is not required for regulation of DSBsrepair. {ECO:0000269|PubMed:22492721, ECO:0000269|PubMed:22733822,ECO:0000269|PubMed:22742833}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRNF169chr17:58786686chr11:74521229ENST00000299563+16205_213192709MotifNote=UMI motif
TgeneRNF169chr17:58786686chr11:74521229ENST00000299563+16665_682192709MotifNote=MIU motif
TgeneRNF169chr17:58786686chr11:74521229ENST00000299563+16689_701192709MotifNote=LR motif

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRNF169chr17:58786686chr11:74521229ENST00000299563+1668_107192709Zinc fingerRING-type


Top

FusionGeneSequence for BCAS3_RNF169


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCAS3_ENST00000589222_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_624aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPLREEKLQEEKPSEDQIHKLLPEDTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHRS
AFVSKNNSYSLAFLAGKLNSKVERSQSCSDTAQERAKSRVRAVPGNKAKVTTMTPASNPIIGVLLSTQNNRCVSAPDLTIEKRLPFSSLS
SLASLHKPERSVSPESNDSISEELNHFKPIVCSPCTPPKRLPDGRVLSPLIIKSTPRNLNRSLQKQTSTEASPRILKKWEQIFQERQIKK
TLSKATLTSLAPEMGEELLGSEGIHSSKEKPLVAVNTRLSGGQVLSETTGPTSADLDHFPSVSQTKAEQDSDNKSSTEIPLETCCSSELK
GGGSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRH

>In-frame_BCAS3_ENST00000407086_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_624aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPLREEKLQEEKPSEDQIHKLLPEDTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHRS
AFVSKNNSYSLAFLAGKLNSKVERSQSCSDTAQERAKSRVRAVPGNKAKVTTMTPASNPIIGVLLSTQNNRCVSAPDLTIEKRLPFSSLS
SLASLHKPERSVSPESNDSISEELNHFKPIVCSPCTPPKRLPDGRVLSPLIIKSTPRNLNRSLQKQTSTEASPRILKKWEQIFQERQIKK
TLSKATLTSLAPEMGEELLGSEGIHSSKEKPLVAVNTRLSGGQVLSETTGPTSADLDHFPSVSQTKAEQDSDNKSSTEIPLETCCSSELK
GGGSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRH

>In-frame_BCAS3_ENST00000390652_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_624aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPLREEKLQEEKPSEDQIHKLLPEDTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHRS
AFVSKNNSYSLAFLAGKLNSKVERSQSCSDTAQERAKSRVRAVPGNKAKVTTMTPASNPIIGVLLSTQNNRCVSAPDLTIEKRLPFSSLS
SLASLHKPERSVSPESNDSISEELNHFKPIVCSPCTPPKRLPDGRVLSPLIIKSTPRNLNRSLQKQTSTEASPRILKKWEQIFQERQIKK
TLSKATLTSLAPEMGEELLGSEGIHSSKEKPLVAVNTRLSGGQVLSETTGPTSADLDHFPSVSQTKAEQDSDNKSSTEIPLETCCSSELK
GGGSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRH

>In-frame_BCAS3_ENST00000408905_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_624aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPLREEKLQEEKPSEDQIHKLLPEDTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHRS
AFVSKNNSYSLAFLAGKLNSKVERSQSCSDTAQERAKSRVRAVPGNKAKVTTMTPASNPIIGVLLSTQNNRCVSAPDLTIEKRLPFSSLS
SLASLHKPERSVSPESNDSISEELNHFKPIVCSPCTPPKRLPDGRVLSPLIIKSTPRNLNRSLQKQTSTEASPRILKKWEQIFQERQIKK
TLSKATLTSLAPEMGEELLGSEGIHSSKEKPLVAVNTRLSGGQVLSETTGPTSADLDHFPSVSQTKAEQDSDNKSSTEIPLETCCSSELK
GGGSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRH

>In-frame_BCAS3_ENST00000588462_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_624aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPLREEKLQEEKPSEDQIHKLLPEDTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHRS
AFVSKNNSYSLAFLAGKLNSKVERSQSCSDTAQERAKSRVRAVPGNKAKVTTMTPASNPIIGVLLSTQNNRCVSAPDLTIEKRLPFSSLS
SLASLHKPERSVSPESNDSISEELNHFKPIVCSPCTPPKRLPDGRVLSPLIIKSTPRNLNRSLQKQTSTEASPRILKKWEQIFQERQIKK
TLSKATLTSLAPEMGEELLGSEGIHSSKEKPLVAVNTRLSGGQVLSETTGPTSADLDHFPSVSQTKAEQDSDNKSSTEIPLETCCSSELK
GGGSGTSLEREQFEGLGSTPDAKLDKTCISRAMKITTVNSVLPQNSVLGGVLKTKQQLKTLNHFDLTNGVLVESLSEEPLPSLRRGRKRH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCAS3_ENST00000589222_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_1872nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAA
GATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTG
AAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCG
GCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGAC
ACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATC
ATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCA
TCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATT
GTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAAC
AGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAG
ACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAG
CCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCC
TCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAA
GGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGC
AGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACA
TTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACAC
TGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTC
CTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGG

>In-frame_BCAS3_ENST00000407086_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_1872nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAA
GATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTG
AAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCG
GCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGAC
ACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATC
ATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCA
TCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATT
GTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAAC
AGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAG
ACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAG
CCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCC
TCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAA
GGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGC
AGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACA
TTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACAC
TGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTC
CTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGG

>In-frame_BCAS3_ENST00000390652_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_1872nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAA
GATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTG
AAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCG
GCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGAC
ACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATC
ATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCA
TCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATT
GTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAAC
AGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAG
ACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAG
CCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCC
TCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAA
GGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGC
AGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACA
TTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACAC
TGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTC
CTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGG

>In-frame_BCAS3_ENST00000408905_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_1872nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAA
GATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTG
AAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCG
GCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGAC
ACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATC
ATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCA
TCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATT
GTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAAC
AGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAG
ACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAG
CCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCC
TCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAA
GGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGC
AGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACA
TTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACAC
TGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTC
CTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGG

>In-frame_BCAS3_ENST00000588462_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_1872nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAA
GATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTG
AAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCG
GCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGAC
ACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATC
ATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCA
TCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATT
GTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAAC
AGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAG
ACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAG
CCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCC
TCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAA
GGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGC
AGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACA
TTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACAC
TGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTC
CTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCAS3_ENST00000589222_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_7623nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAAGATCAAATCCACAAGCTGTTAC
CAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTGAAAACAAATCTGGAACGTTGTC
CTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCGGCATTTGTTTCCAAGAACAACT
CCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGACACAGCCCAGGAAAGAGCGAAGA
GCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATCATTGGTGTCCTCTTGTCAACTC
AAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCATCCTTGGCTTCCCTGCATAAGC
CAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATTGTCTGCTCACCATGTACTCCTC
CCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAACAGAAGCCTGCAGAAGCAGACTT
CTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAGACCCTTTCAAAAGCCACTCTTA
CCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAGCCACTTGTGGCTGTAAATACAA
GATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCCTCTGTTAGCCAAACAAAAGCAG
AACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAAGGGGGAGGCAGTGGGACTTCTT
TGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGCAGAGCCATGAAAATCACCACAG
TTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACATTAAATCATTTTGATCTGACTA
ATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACACTGCAAGACCAAGCACTTAGAAC
AAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTCCTGCGAGAGATGGAGCAGAAGC
TTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGGACTGTGAGCCGGCGAAAAGGAA
GTGTGGATCAGTATCTCCTACGGTCCAGCAACATGGCCGGGGCCAAGTAGCACCTAATGAAGTGTTACCTATTTTTAAAAGGTCTTAGGC
CTTGATCATTTATCCTGAAGAGCTGAGTGTTCTCACTTTGGTTTTATTTTAATGGCAAAACACTGTCTAATATGGTTCTGAGAGGTTCCA
GGGCCTTTGTAGTCAATATCCAAGGGAAAAGCATCTCCGTTTCTCTGTGACCCAGGCCAGAAGCCTGAGTGACCCATCCCTAAGGGCTTC
TGGGCCAAACCTGGCAGCACCCACTGGGAATGAGATTTGGAACGGCCTCAGGAGCATAATGGCCACAGTTAGTAATGGTAAAGAGGGGAT
ACCTTCTTAAACTGATAGACTTCCTGACTTCTTTCAGCAGGGTATTGTTTTAAATCAGCCTTGCAGATAAAAATTAATTCCATCTTTTTC
AGACAAGTGAACAATTTAGTTCCTTGGCAGATCCAAAATGATAGATGGTTATGTTACGCTTTCTGCTGTCCCTTGCCAAAAATAAGTAAA
TATATCAGTTAAGATTATGCCTTTACAAAAGTTAATTTACATTCTCTGTTTAAAAAATAATATTTGGTGAATGCTATATAGTTGACAGAG
CACATTTACAGACCTTATTAATTTAGTCTTTCCAAGAGACCTCTCATGTAACTGGCATTAGCCCCATTTTTAGATGATGAAACTGCAGTG
CAGATGTTCTGGTTCTCTCAACTACCAAGTGGCATAACCCATGGATTTTCTAAAGGTTTCCCAAATAGATCACAACCTAAGGGTGTGCCA
GGGGAGCCTAGGGGAAGCTAGGCTGGGCATTGAACACTGATAGTGCAGAATCCACATGCAAACAAGATCGACAGGGTGGATAAACATATA
TGTGCATTATCCCCATCCCCCACAGTTTAGAGCCTTCTGCTTTTCTGGGGGTTTCAGCCTATGAGACAAACTATAATCAGGCTTCATTAT
TACTTTTCAAATGGCCAAGGGTTATCTGCAATGTTGATCTAAAATCCTAAAAAATCACCCTGAAGTCAGGCAAGGAACAATACTTAAACT
CCATACTATGGAAACAAGGTATCTAGCTGGATGCAGCTGGTAAATTCAGTCCCATGGACCTTTGGGGGTTTATTTTCCTTAGCAGCTGAC
ACCATGTGTCTTTTGCATCCCTGGTGGTGCTTGGTGCTTCTGCCCATCTGGGCTCATTGAGAATAGGGATGAAGATATGATTTTAGGGAA
TTTCTGATGGGCTGGCATGCCCCATGTAGTATGAGTTACTATATAAAGTCATGTGACTGGCATTTTAACAGACCTTCCAGAGCTTATATA
TCCCAATATATGTTGTTTCCTTTGAGTAGCCCCAGCAGGATACTGCTTAGTTTTTCCAGTGCCATTGGTGAAAGCATTTCTGGAACTGTC
TTCAAAGACTAGAAACACTGACTCCCAAAATGCTAGAACTGGAAGGGACCTTAATGGTTATCTATTCCAGCCTCCTCCTAAGGTCCTCCT
CAGCTTCTAGACCTAGAAGCCAAAGTCCAGAACAGTGACCCATTGATCAAGGCAGATAGTATAACTCCTTTTAAGTGTTCTCAGATTTGC
CTTTTCTCAGGGCAAATCTTCAGTGTTTTGTGGTTATTTGTGGTTGAGAGAGAGAGAGAATGTAATGTCTGAGACTAGCCAGCAGCTATT
TGAAGCCTCTGGGAAAGAAGGTGGCTTATCAAGTGGGTTTGTAGTAATGAGTGCTGCTGTAAAGCAGAGCCATTTTCTTGTGCAGCTCAT
AGTTCCCAAACAGTTCCCAAACAGAAATTCCAGAGATGTCTTAAACATTGTGGTCATCATTGAGATAGGTGGAATCTCTTTGGTGACTAC
GTTGGTGGGGAACATCACTCACCTGAATGTATGCATTCTGTGTTCTCTGTGTGTGTGCACATATGCAGATGTATGTTTTAAAAACATTTA
CCAAACTCATGATTTTGTAGTCACACCACTTCAGTTCTGGGCCCTACCAACAATTTATGTCCTCCAAGAGCTGCTGGAGGGCATGTTTGT
GCCCAAAACAGAAGAGCTGGCTCTGGTTTACAGAAGACAGGGAGGGTGACCTTACTATAAATGCCCTTAGAGGAAACTTATCAGTTACTG
CCATTTCACGCATTTCCTTTTTGATCTTAGTAAATATTATTGGAAGGCTAGTCTTGTTGGTAGGAGCAAAGACACTTATTTTTCCACTTG
CCATCTTTCTCTATATCTCCAGTAATTTGAAAAACACTTTTCAGTTGGAATTGATTTTTGTCTTTGGTAAAAAGAAATATTTTTAATAGA
TAAAAGATATATATTTTAAATATTTCCCCAAATTAATACTTTCATTTTAAGAATTGCATAGCAGTTGTAACAAGTGCAGAATGAAGAACA
AATTCTTGTTAAGCAAATAGTCCAAACTCTAGGTCCAGCTTACTGCCTTCCCCCCTTGTACCTACAGTGATGCCTAGGATGGTATTGACA
GTTGTTTTCTAAACTTCCTGCTGAGCAACAGTCCTTCAAATATAGGTAGAGTGGTCTAGGTTAAGGAGGGAGGAGGGTTGATCTTTAATC
AGGTTGGCTTTGGAGGAAGGAAAAACCACTAAGGTATTATCTGAATTTTAAGATGCTTCCCATCCTTAATAACTAAAACCTGAATGCTTT
TCTTTCTGAAAAATCTCCCTCTCTCCTTCCATGATTCTGAAGTTGGTTAAAAGTCGATATGTTGATGTGTATTATTTGGGGGAACAGAAA
AGGACAAGGAAGGAAACAGAACGATGGGAAGGGTTTGTGAGCTAGAATAAGAGGTGCAGGATTTCACAAAACAAATTCCTCACAAATCAT
TGAAGCCCAGTTCACCATACAAATTACCCATGTCTTACTCTGTTCCTTGTATATATGCATTCTGGGTTTTTTTATTATTAAAGGGGAAGT
TAGGGGGGAGGGTGAAGGTCAGTCTGAGGGGAAATCCAGGAAATGTGGTGCCCTTAGAAGGGGGCTGTCAGCTCTTTTCCATAGAGAGGG
AAAGAAACTTTGAGAAAATGTTCTTGACCCATTGATTGTATCTGCTGGAAGAAGTCATCTGGGCCTGTTGGGTTGGTATCAGATCAGGGG
ATTATGCATCCAGCCCCTGGCCCCTTTAATCTATTTGCCTCTTTTTAAAAAAGGTTAAGTCTTCTTGGGTGAGGCTTGCCAGGGAAACTC
CTAAGTGGCTTCACTTATTTTTTAAATTTTAATTTAATTTTTAAATTTTTGCTTGGAAGCAGCACTGGTAATAAATGTTTTATTTTTTGT
TCATTTTCCCTAAAGGAAAAATGTCCTTAAGAGATTAAAGCTCTTAATTGATTACTGTCTGGTTACAAACTGGCAAACTGACTAAAATGG
GAAGCTGCCACCGTGCCTGACTCATGTAGCTGATGACCGAAGGCTCATCCTTTCTTTTCTATTTGACAGACATTTACTGAGCTTCAGACT
TGAGCCAACCCTGAGCTGGACTGTGGAGATAAAGCAGTTCCTGCTCTTGAGGAGCTCAATGTCTAATGGAATGCATTTGAATGTATGTGT
GGCTGGAGAGTTCATTTATGGTCTTAGGAAAGCCATTTCTGGTCCCATTTAGAAAACTGACCAGCACCCAGCAAGCTGCATTCTACATTT
TAGAGACCCCATTGGTATTTGTGAATTTGATTGCACCACCGCTTTTCCTTTACTAAGTAATGTTATGGAAGGAGAATGAATTTTCTCCTC
TAGTGATTACAGGACATTAACATCTCTTCAGAAGCTGCTTTTAGCTTAAGCCCCAAGAAGTGAGGTGGGTTGTGGATCACTGACATGGTC
AGGGGAGGCCCACACCTCAATTCAGTAACCACCTAATCTCTCCCCCAACCTGATCTCTCATCAGAGCTGGCAGCAACTTGGGATTCCTTT
CCTTTTTCCTGCCTAACTTTTCATTGAAATGTCTAGTAGGAGAGTGAGAAAAGAGAACAAAGGCTGGGTCACAGTCATAGAATGTTACAG
CTGGAATGGGCATGGAAATCATCCAAGTTAAACTTCTTCTCTGCCCCCCGCCCCCACTTTTTTTTTTTTTTTTTTTTAACCAAACGAACT
TGTGATCCAGTGCCCTATTTTATAGTGTGGTTTTCCAGGGTCTGAATAAATAATCATTAAAGTTTGACACACGCAGACACACGCACCAAT
GATGGGGATACCCCCAAATGATTTAGGAGGTTATTTTATTTTAATAGTTTTTTCTTCCTGATTTTTTTCAGTTAGTTAGAGTTAAATGTA
CCTATAGCCCCTGAATACATGCTCAGGTAGAGAAAGTCTCCATAGTATAAGTAAGTAATATGAATGTGGAATCTTGGAAAGTGATATATT
TTGATTGGAATAATTTTAATTAAATTTAATGATTTTAATTAAGAATTAAAAGCCAGCTAGCCAAATTTTCTTTAAAAATTGGAAACTCAT
TATGGTCTTAAATTGTCCTCAGGCAGCCTTTTCCTCATCAACCCATAGAGTGGTCTTTTGAACTGGTATCTAAACATACCTGGTTATGAA
TTCTCAAAAGAGAAAGCAGGTCTGGGGCGGGGTGGTCAGGAGACAGATTCTAGGGAAAGTGCTGAAGAGATTTTCTTCTGAAGATGATCT
AGGAAATGCATCTTTATACATGATTGTTAGCTGCTGTAGCTTTCTGAAGAAGATTGTAGAAAAGAGACTAAGATATATGCAAGGGTCACC
AGTTTAGAGATCAGTCAAATTGGAAAAAGTGCCAAGACTGGATGTGCAGATTGTTCTATGTATTATCAGTATTTTTTTCCTCTTAAGAAA
AAAATTTACTCTCTCTCCTTTGTGAGTAAATGCCTCCTTAATGCCTTTTAAGTAAGGTGGCAACTTTTAACTGTCATCTTGTGAGAGGCA
ACCTCAAACTCTAAGCAGACTCCCTCTCTCCCTTTCTGGTGTCTTAAATCAAGAACTAGTTTGAAGCCAAGGCAAAGCAAGGTTTGTTCA
TCTTCCTTTCCTGTCATTTAAGGTAAAACAGGCAATGAACTCGCTCTTCAAATACCATAGTTCAAGAGTAGCTGTTGGCCCTGGTTCCAG
ATTAATATAGCAGCAGGCAGATTGCCCCTTCTTGGGGCCACCACCCTCCAAAGCTGTGCCACCAATGAGAGCATTGGGTTCAAGTTTGCA
TCAAACATGGTATTACCAACGCTGAGCCTCCAGCAGAGCACTTAAAAGTCCTAGTGAGAGAATAGATACTATGCAAGGGAAAAAAATTTA
AATGCCAACGAATAGTTTTTTTTTTTTTGAACCTGATACACTGTTTGTTTACTCTCAACTCTTTGTACAAATATTATTGTCCTAAGGGCC
TTTTCCCCTCCTGCCTAGAAAATAGGTTGTGTATTGGTTTTATTCAACCTGCTGTCTGCTTTAGGATTGGAGAAGGTACCTGGATCCTTG
TGGACTGCCACTGCTGGCTGCCTCCTCTCCAACTCATCAGAAGAGCATTTTGACAAAGACAGAGGACTTGGACCAGGGCATGCCCTGTTG
GGGATGTTTCTGTCAGCAAGGACATGGCATGGAATCAAGTGGGCTGATGTGTTGTTATTTAAACAGTACCAAAGTGCATTCTTCAATGTA

>In-frame_BCAS3_ENST00000407086_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_7603nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAAGATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGG
AAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTGAAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCA
GAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCGGCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTG
GCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGACACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCA
GGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATCATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCG
GCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCATCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCT
GAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATTGTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGC
CGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAACAGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGG
ATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAGACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATG
GGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAGCCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTC
CTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCCTCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAA
AGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAAGGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAG
GGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGCAGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAA
AACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACATTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGC
CTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACACTGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAA
CTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTCCTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGAC
CGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGGACTGTGAGCCGGCGAAAAGGAAGTGTGGATCAGTATCTCCTA
CGGTCCAGCAACATGGCCGGGGCCAAGTAGCACCTAATGAAGTGTTACCTATTTTTAAAAGGTCTTAGGCCTTGATCATTTATCCTGAAG
AGCTGAGTGTTCTCACTTTGGTTTTATTTTAATGGCAAAACACTGTCTAATATGGTTCTGAGAGGTTCCAGGGCCTTTGTAGTCAATATC
CAAGGGAAAAGCATCTCCGTTTCTCTGTGACCCAGGCCAGAAGCCTGAGTGACCCATCCCTAAGGGCTTCTGGGCCAAACCTGGCAGCAC
CCACTGGGAATGAGATTTGGAACGGCCTCAGGAGCATAATGGCCACAGTTAGTAATGGTAAAGAGGGGATACCTTCTTAAACTGATAGAC
TTCCTGACTTCTTTCAGCAGGGTATTGTTTTAAATCAGCCTTGCAGATAAAAATTAATTCCATCTTTTTCAGACAAGTGAACAATTTAGT
TCCTTGGCAGATCCAAAATGATAGATGGTTATGTTACGCTTTCTGCTGTCCCTTGCCAAAAATAAGTAAATATATCAGTTAAGATTATGC
CTTTACAAAAGTTAATTTACATTCTCTGTTTAAAAAATAATATTTGGTGAATGCTATATAGTTGACAGAGCACATTTACAGACCTTATTA
ATTTAGTCTTTCCAAGAGACCTCTCATGTAACTGGCATTAGCCCCATTTTTAGATGATGAAACTGCAGTGCAGATGTTCTGGTTCTCTCA
ACTACCAAGTGGCATAACCCATGGATTTTCTAAAGGTTTCCCAAATAGATCACAACCTAAGGGTGTGCCAGGGGAGCCTAGGGGAAGCTA
GGCTGGGCATTGAACACTGATAGTGCAGAATCCACATGCAAACAAGATCGACAGGGTGGATAAACATATATGTGCATTATCCCCATCCCC
CACAGTTTAGAGCCTTCTGCTTTTCTGGGGGTTTCAGCCTATGAGACAAACTATAATCAGGCTTCATTATTACTTTTCAAATGGCCAAGG
GTTATCTGCAATGTTGATCTAAAATCCTAAAAAATCACCCTGAAGTCAGGCAAGGAACAATACTTAAACTCCATACTATGGAAACAAGGT
ATCTAGCTGGATGCAGCTGGTAAATTCAGTCCCATGGACCTTTGGGGGTTTATTTTCCTTAGCAGCTGACACCATGTGTCTTTTGCATCC
CTGGTGGTGCTTGGTGCTTCTGCCCATCTGGGCTCATTGAGAATAGGGATGAAGATATGATTTTAGGGAATTTCTGATGGGCTGGCATGC
CCCATGTAGTATGAGTTACTATATAAAGTCATGTGACTGGCATTTTAACAGACCTTCCAGAGCTTATATATCCCAATATATGTTGTTTCC
TTTGAGTAGCCCCAGCAGGATACTGCTTAGTTTTTCCAGTGCCATTGGTGAAAGCATTTCTGGAACTGTCTTCAAAGACTAGAAACACTG
ACTCCCAAAATGCTAGAACTGGAAGGGACCTTAATGGTTATCTATTCCAGCCTCCTCCTAAGGTCCTCCTCAGCTTCTAGACCTAGAAGC
CAAAGTCCAGAACAGTGACCCATTGATCAAGGCAGATAGTATAACTCCTTTTAAGTGTTCTCAGATTTGCCTTTTCTCAGGGCAAATCTT
CAGTGTTTTGTGGTTATTTGTGGTTGAGAGAGAGAGAGAATGTAATGTCTGAGACTAGCCAGCAGCTATTTGAAGCCTCTGGGAAAGAAG
GTGGCTTATCAAGTGGGTTTGTAGTAATGAGTGCTGCTGTAAAGCAGAGCCATTTTCTTGTGCAGCTCATAGTTCCCAAACAGTTCCCAA
ACAGAAATTCCAGAGATGTCTTAAACATTGTGGTCATCATTGAGATAGGTGGAATCTCTTTGGTGACTACGTTGGTGGGGAACATCACTC
ACCTGAATGTATGCATTCTGTGTTCTCTGTGTGTGTGCACATATGCAGATGTATGTTTTAAAAACATTTACCAAACTCATGATTTTGTAG
TCACACCACTTCAGTTCTGGGCCCTACCAACAATTTATGTCCTCCAAGAGCTGCTGGAGGGCATGTTTGTGCCCAAAACAGAAGAGCTGG
CTCTGGTTTACAGAAGACAGGGAGGGTGACCTTACTATAAATGCCCTTAGAGGAAACTTATCAGTTACTGCCATTTCACGCATTTCCTTT
TTGATCTTAGTAAATATTATTGGAAGGCTAGTCTTGTTGGTAGGAGCAAAGACACTTATTTTTCCACTTGCCATCTTTCTCTATATCTCC
AGTAATTTGAAAAACACTTTTCAGTTGGAATTGATTTTTGTCTTTGGTAAAAAGAAATATTTTTAATAGATAAAAGATATATATTTTAAA
TATTTCCCCAAATTAATACTTTCATTTTAAGAATTGCATAGCAGTTGTAACAAGTGCAGAATGAAGAACAAATTCTTGTTAAGCAAATAG
TCCAAACTCTAGGTCCAGCTTACTGCCTTCCCCCCTTGTACCTACAGTGATGCCTAGGATGGTATTGACAGTTGTTTTCTAAACTTCCTG
CTGAGCAACAGTCCTTCAAATATAGGTAGAGTGGTCTAGGTTAAGGAGGGAGGAGGGTTGATCTTTAATCAGGTTGGCTTTGGAGGAAGG
AAAAACCACTAAGGTATTATCTGAATTTTAAGATGCTTCCCATCCTTAATAACTAAAACCTGAATGCTTTTCTTTCTGAAAAATCTCCCT
CTCTCCTTCCATGATTCTGAAGTTGGTTAAAAGTCGATATGTTGATGTGTATTATTTGGGGGAACAGAAAAGGACAAGGAAGGAAACAGA
ACGATGGGAAGGGTTTGTGAGCTAGAATAAGAGGTGCAGGATTTCACAAAACAAATTCCTCACAAATCATTGAAGCCCAGTTCACCATAC
AAATTACCCATGTCTTACTCTGTTCCTTGTATATATGCATTCTGGGTTTTTTTATTATTAAAGGGGAAGTTAGGGGGGAGGGTGAAGGTC
AGTCTGAGGGGAAATCCAGGAAATGTGGTGCCCTTAGAAGGGGGCTGTCAGCTCTTTTCCATAGAGAGGGAAAGAAACTTTGAGAAAATG
TTCTTGACCCATTGATTGTATCTGCTGGAAGAAGTCATCTGGGCCTGTTGGGTTGGTATCAGATCAGGGGATTATGCATCCAGCCCCTGG
CCCCTTTAATCTATTTGCCTCTTTTTAAAAAAGGTTAAGTCTTCTTGGGTGAGGCTTGCCAGGGAAACTCCTAAGTGGCTTCACTTATTT
TTTAAATTTTAATTTAATTTTTAAATTTTTGCTTGGAAGCAGCACTGGTAATAAATGTTTTATTTTTTGTTCATTTTCCCTAAAGGAAAA
ATGTCCTTAAGAGATTAAAGCTCTTAATTGATTACTGTCTGGTTACAAACTGGCAAACTGACTAAAATGGGAAGCTGCCACCGTGCCTGA
CTCATGTAGCTGATGACCGAAGGCTCATCCTTTCTTTTCTATTTGACAGACATTTACTGAGCTTCAGACTTGAGCCAACCCTGAGCTGGA
CTGTGGAGATAAAGCAGTTCCTGCTCTTGAGGAGCTCAATGTCTAATGGAATGCATTTGAATGTATGTGTGGCTGGAGAGTTCATTTATG
GTCTTAGGAAAGCCATTTCTGGTCCCATTTAGAAAACTGACCAGCACCCAGCAAGCTGCATTCTACATTTTAGAGACCCCATTGGTATTT
GTGAATTTGATTGCACCACCGCTTTTCCTTTACTAAGTAATGTTATGGAAGGAGAATGAATTTTCTCCTCTAGTGATTACAGGACATTAA
CATCTCTTCAGAAGCTGCTTTTAGCTTAAGCCCCAAGAAGTGAGGTGGGTTGTGGATCACTGACATGGTCAGGGGAGGCCCACACCTCAA
TTCAGTAACCACCTAATCTCTCCCCCAACCTGATCTCTCATCAGAGCTGGCAGCAACTTGGGATTCCTTTCCTTTTTCCTGCCTAACTTT
TCATTGAAATGTCTAGTAGGAGAGTGAGAAAAGAGAACAAAGGCTGGGTCACAGTCATAGAATGTTACAGCTGGAATGGGCATGGAAATC
ATCCAAGTTAAACTTCTTCTCTGCCCCCCGCCCCCACTTTTTTTTTTTTTTTTTTTTAACCAAACGAACTTGTGATCCAGTGCCCTATTT
TATAGTGTGGTTTTCCAGGGTCTGAATAAATAATCATTAAAGTTTGACACACGCAGACACACGCACCAATGATGGGGATACCCCCAAATG
ATTTAGGAGGTTATTTTATTTTAATAGTTTTTTCTTCCTGATTTTTTTCAGTTAGTTAGAGTTAAATGTACCTATAGCCCCTGAATACAT
GCTCAGGTAGAGAAAGTCTCCATAGTATAAGTAAGTAATATGAATGTGGAATCTTGGAAAGTGATATATTTTGATTGGAATAATTTTAAT
TAAATTTAATGATTTTAATTAAGAATTAAAAGCCAGCTAGCCAAATTTTCTTTAAAAATTGGAAACTCATTATGGTCTTAAATTGTCCTC
AGGCAGCCTTTTCCTCATCAACCCATAGAGTGGTCTTTTGAACTGGTATCTAAACATACCTGGTTATGAATTCTCAAAAGAGAAAGCAGG
TCTGGGGCGGGGTGGTCAGGAGACAGATTCTAGGGAAAGTGCTGAAGAGATTTTCTTCTGAAGATGATCTAGGAAATGCATCTTTATACA
TGATTGTTAGCTGCTGTAGCTTTCTGAAGAAGATTGTAGAAAAGAGACTAAGATATATGCAAGGGTCACCAGTTTAGAGATCAGTCAAAT
TGGAAAAAGTGCCAAGACTGGATGTGCAGATTGTTCTATGTATTATCAGTATTTTTTTCCTCTTAAGAAAAAAATTTACTCTCTCTCCTT
TGTGAGTAAATGCCTCCTTAATGCCTTTTAAGTAAGGTGGCAACTTTTAACTGTCATCTTGTGAGAGGCAACCTCAAACTCTAAGCAGAC
TCCCTCTCTCCCTTTCTGGTGTCTTAAATCAAGAACTAGTTTGAAGCCAAGGCAAAGCAAGGTTTGTTCATCTTCCTTTCCTGTCATTTA
AGGTAAAACAGGCAATGAACTCGCTCTTCAAATACCATAGTTCAAGAGTAGCTGTTGGCCCTGGTTCCAGATTAATATAGCAGCAGGCAG
ATTGCCCCTTCTTGGGGCCACCACCCTCCAAAGCTGTGCCACCAATGAGAGCATTGGGTTCAAGTTTGCATCAAACATGGTATTACCAAC
GCTGAGCCTCCAGCAGAGCACTTAAAAGTCCTAGTGAGAGAATAGATACTATGCAAGGGAAAAAAATTTAAATGCCAACGAATAGTTTTT
TTTTTTTTGAACCTGATACACTGTTTGTTTACTCTCAACTCTTTGTACAAATATTATTGTCCTAAGGGCCTTTTCCCCTCCTGCCTAGAA
AATAGGTTGTGTATTGGTTTTATTCAACCTGCTGTCTGCTTTAGGATTGGAGAAGGTACCTGGATCCTTGTGGACTGCCACTGCTGGCTG
CCTCCTCTCCAACTCATCAGAAGAGCATTTTGACAAAGACAGAGGACTTGGACCAGGGCATGCCCTGTTGGGGATGTTTCTGTCAGCAAG
GACATGGCATGGAATCAAGTGGGCTGATGTGTTGTTATTTAAACAGTACCAAAGTGCATTCTTCAATGTATGTTTGCCTGCTTGAAGCAA

>In-frame_BCAS3_ENST00000390652_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_7586nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGA
AGAAAAGTTACAAGAGGAAAAACCCTCTGAAGATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGA
ACAGAAAAAAAGAGATGAACCATTAGTACTGAAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTC
TCGAGGCCAGATGACACAGACACATCGCTCGGCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTC
CAAGGTGGAAAGGAGTCAGAGCTGTAGTGACACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGT
CACAACTATGACTCCAGCCTCCAACCCCATCATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCAT
CGAAAAGCGTCTACCCTTCAGCTCCCTTTCATCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCAT
CTCCGAAGAACTAAACCATTTCAAGCCCATTGTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCT
CATCATCAAATCAACTCCACGCAACCTAAACAGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGA
ACAGATCTTTCAGGAGCGGCAGATCAAAAAGACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGG
CTCTGAAGGTATCCATTCTAGCAAGGAGAAGCCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGG
ACCCACCTCTGCTGATCTTGATCATTTCCCCTCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCC
ACTGGAAACCTGCTGTTCCTCAGAACTCAAAGGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCC
AGATGCCAAGTTAGACAAAACCTGTATAAGCAGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGG
AGTCCTCAAAACAAAGCAACAATTGAAGACATTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACT
TCCTTCTTTGCGTCGAGGCCGGAAAAGACACTGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGG
GGAGGTGGGTCTGGCCCCAACAGACCCAGTCCTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCA
GTTGCAGCGCATGTTCGACAATGAGAGGCGGACTGTGAGCCGGCGAAAAGGAAGTGTGGATCAGTATCTCCTACGGTCCAGCAACATGGC
CGGGGCCAAGTAGCACCTAATGAAGTGTTACCTATTTTTAAAAGGTCTTAGGCCTTGATCATTTATCCTGAAGAGCTGAGTGTTCTCACT
TTGGTTTTATTTTAATGGCAAAACACTGTCTAATATGGTTCTGAGAGGTTCCAGGGCCTTTGTAGTCAATATCCAAGGGAAAAGCATCTC
CGTTTCTCTGTGACCCAGGCCAGAAGCCTGAGTGACCCATCCCTAAGGGCTTCTGGGCCAAACCTGGCAGCACCCACTGGGAATGAGATT
TGGAACGGCCTCAGGAGCATAATGGCCACAGTTAGTAATGGTAAAGAGGGGATACCTTCTTAAACTGATAGACTTCCTGACTTCTTTCAG
CAGGGTATTGTTTTAAATCAGCCTTGCAGATAAAAATTAATTCCATCTTTTTCAGACAAGTGAACAATTTAGTTCCTTGGCAGATCCAAA
ATGATAGATGGTTATGTTACGCTTTCTGCTGTCCCTTGCCAAAAATAAGTAAATATATCAGTTAAGATTATGCCTTTACAAAAGTTAATT
TACATTCTCTGTTTAAAAAATAATATTTGGTGAATGCTATATAGTTGACAGAGCACATTTACAGACCTTATTAATTTAGTCTTTCCAAGA
GACCTCTCATGTAACTGGCATTAGCCCCATTTTTAGATGATGAAACTGCAGTGCAGATGTTCTGGTTCTCTCAACTACCAAGTGGCATAA
CCCATGGATTTTCTAAAGGTTTCCCAAATAGATCACAACCTAAGGGTGTGCCAGGGGAGCCTAGGGGAAGCTAGGCTGGGCATTGAACAC
TGATAGTGCAGAATCCACATGCAAACAAGATCGACAGGGTGGATAAACATATATGTGCATTATCCCCATCCCCCACAGTTTAGAGCCTTC
TGCTTTTCTGGGGGTTTCAGCCTATGAGACAAACTATAATCAGGCTTCATTATTACTTTTCAAATGGCCAAGGGTTATCTGCAATGTTGA
TCTAAAATCCTAAAAAATCACCCTGAAGTCAGGCAAGGAACAATACTTAAACTCCATACTATGGAAACAAGGTATCTAGCTGGATGCAGC
TGGTAAATTCAGTCCCATGGACCTTTGGGGGTTTATTTTCCTTAGCAGCTGACACCATGTGTCTTTTGCATCCCTGGTGGTGCTTGGTGC
TTCTGCCCATCTGGGCTCATTGAGAATAGGGATGAAGATATGATTTTAGGGAATTTCTGATGGGCTGGCATGCCCCATGTAGTATGAGTT
ACTATATAAAGTCATGTGACTGGCATTTTAACAGACCTTCCAGAGCTTATATATCCCAATATATGTTGTTTCCTTTGAGTAGCCCCAGCA
GGATACTGCTTAGTTTTTCCAGTGCCATTGGTGAAAGCATTTCTGGAACTGTCTTCAAAGACTAGAAACACTGACTCCCAAAATGCTAGA
ACTGGAAGGGACCTTAATGGTTATCTATTCCAGCCTCCTCCTAAGGTCCTCCTCAGCTTCTAGACCTAGAAGCCAAAGTCCAGAACAGTG
ACCCATTGATCAAGGCAGATAGTATAACTCCTTTTAAGTGTTCTCAGATTTGCCTTTTCTCAGGGCAAATCTTCAGTGTTTTGTGGTTAT
TTGTGGTTGAGAGAGAGAGAGAATGTAATGTCTGAGACTAGCCAGCAGCTATTTGAAGCCTCTGGGAAAGAAGGTGGCTTATCAAGTGGG
TTTGTAGTAATGAGTGCTGCTGTAAAGCAGAGCCATTTTCTTGTGCAGCTCATAGTTCCCAAACAGTTCCCAAACAGAAATTCCAGAGAT
GTCTTAAACATTGTGGTCATCATTGAGATAGGTGGAATCTCTTTGGTGACTACGTTGGTGGGGAACATCACTCACCTGAATGTATGCATT
CTGTGTTCTCTGTGTGTGTGCACATATGCAGATGTATGTTTTAAAAACATTTACCAAACTCATGATTTTGTAGTCACACCACTTCAGTTC
TGGGCCCTACCAACAATTTATGTCCTCCAAGAGCTGCTGGAGGGCATGTTTGTGCCCAAAACAGAAGAGCTGGCTCTGGTTTACAGAAGA
CAGGGAGGGTGACCTTACTATAAATGCCCTTAGAGGAAACTTATCAGTTACTGCCATTTCACGCATTTCCTTTTTGATCTTAGTAAATAT
TATTGGAAGGCTAGTCTTGTTGGTAGGAGCAAAGACACTTATTTTTCCACTTGCCATCTTTCTCTATATCTCCAGTAATTTGAAAAACAC
TTTTCAGTTGGAATTGATTTTTGTCTTTGGTAAAAAGAAATATTTTTAATAGATAAAAGATATATATTTTAAATATTTCCCCAAATTAAT
ACTTTCATTTTAAGAATTGCATAGCAGTTGTAACAAGTGCAGAATGAAGAACAAATTCTTGTTAAGCAAATAGTCCAAACTCTAGGTCCA
GCTTACTGCCTTCCCCCCTTGTACCTACAGTGATGCCTAGGATGGTATTGACAGTTGTTTTCTAAACTTCCTGCTGAGCAACAGTCCTTC
AAATATAGGTAGAGTGGTCTAGGTTAAGGAGGGAGGAGGGTTGATCTTTAATCAGGTTGGCTTTGGAGGAAGGAAAAACCACTAAGGTAT
TATCTGAATTTTAAGATGCTTCCCATCCTTAATAACTAAAACCTGAATGCTTTTCTTTCTGAAAAATCTCCCTCTCTCCTTCCATGATTC
TGAAGTTGGTTAAAAGTCGATATGTTGATGTGTATTATTTGGGGGAACAGAAAAGGACAAGGAAGGAAACAGAACGATGGGAAGGGTTTG
TGAGCTAGAATAAGAGGTGCAGGATTTCACAAAACAAATTCCTCACAAATCATTGAAGCCCAGTTCACCATACAAATTACCCATGTCTTA
CTCTGTTCCTTGTATATATGCATTCTGGGTTTTTTTATTATTAAAGGGGAAGTTAGGGGGGAGGGTGAAGGTCAGTCTGAGGGGAAATCC
AGGAAATGTGGTGCCCTTAGAAGGGGGCTGTCAGCTCTTTTCCATAGAGAGGGAAAGAAACTTTGAGAAAATGTTCTTGACCCATTGATT
GTATCTGCTGGAAGAAGTCATCTGGGCCTGTTGGGTTGGTATCAGATCAGGGGATTATGCATCCAGCCCCTGGCCCCTTTAATCTATTTG
CCTCTTTTTAAAAAAGGTTAAGTCTTCTTGGGTGAGGCTTGCCAGGGAAACTCCTAAGTGGCTTCACTTATTTTTTAAATTTTAATTTAA
TTTTTAAATTTTTGCTTGGAAGCAGCACTGGTAATAAATGTTTTATTTTTTGTTCATTTTCCCTAAAGGAAAAATGTCCTTAAGAGATTA
AAGCTCTTAATTGATTACTGTCTGGTTACAAACTGGCAAACTGACTAAAATGGGAAGCTGCCACCGTGCCTGACTCATGTAGCTGATGAC
CGAAGGCTCATCCTTTCTTTTCTATTTGACAGACATTTACTGAGCTTCAGACTTGAGCCAACCCTGAGCTGGACTGTGGAGATAAAGCAG
TTCCTGCTCTTGAGGAGCTCAATGTCTAATGGAATGCATTTGAATGTATGTGTGGCTGGAGAGTTCATTTATGGTCTTAGGAAAGCCATT
TCTGGTCCCATTTAGAAAACTGACCAGCACCCAGCAAGCTGCATTCTACATTTTAGAGACCCCATTGGTATTTGTGAATTTGATTGCACC
ACCGCTTTTCCTTTACTAAGTAATGTTATGGAAGGAGAATGAATTTTCTCCTCTAGTGATTACAGGACATTAACATCTCTTCAGAAGCTG
CTTTTAGCTTAAGCCCCAAGAAGTGAGGTGGGTTGTGGATCACTGACATGGTCAGGGGAGGCCCACACCTCAATTCAGTAACCACCTAAT
CTCTCCCCCAACCTGATCTCTCATCAGAGCTGGCAGCAACTTGGGATTCCTTTCCTTTTTCCTGCCTAACTTTTCATTGAAATGTCTAGT
AGGAGAGTGAGAAAAGAGAACAAAGGCTGGGTCACAGTCATAGAATGTTACAGCTGGAATGGGCATGGAAATCATCCAAGTTAAACTTCT
TCTCTGCCCCCCGCCCCCACTTTTTTTTTTTTTTTTTTTTAACCAAACGAACTTGTGATCCAGTGCCCTATTTTATAGTGTGGTTTTCCA
GGGTCTGAATAAATAATCATTAAAGTTTGACACACGCAGACACACGCACCAATGATGGGGATACCCCCAAATGATTTAGGAGGTTATTTT
ATTTTAATAGTTTTTTCTTCCTGATTTTTTTCAGTTAGTTAGAGTTAAATGTACCTATAGCCCCTGAATACATGCTCAGGTAGAGAAAGT
CTCCATAGTATAAGTAAGTAATATGAATGTGGAATCTTGGAAAGTGATATATTTTGATTGGAATAATTTTAATTAAATTTAATGATTTTA
ATTAAGAATTAAAAGCCAGCTAGCCAAATTTTCTTTAAAAATTGGAAACTCATTATGGTCTTAAATTGTCCTCAGGCAGCCTTTTCCTCA
TCAACCCATAGAGTGGTCTTTTGAACTGGTATCTAAACATACCTGGTTATGAATTCTCAAAAGAGAAAGCAGGTCTGGGGCGGGGTGGTC
AGGAGACAGATTCTAGGGAAAGTGCTGAAGAGATTTTCTTCTGAAGATGATCTAGGAAATGCATCTTTATACATGATTGTTAGCTGCTGT
AGCTTTCTGAAGAAGATTGTAGAAAAGAGACTAAGATATATGCAAGGGTCACCAGTTTAGAGATCAGTCAAATTGGAAAAAGTGCCAAGA
CTGGATGTGCAGATTGTTCTATGTATTATCAGTATTTTTTTCCTCTTAAGAAAAAAATTTACTCTCTCTCCTTTGTGAGTAAATGCCTCC
TTAATGCCTTTTAAGTAAGGTGGCAACTTTTAACTGTCATCTTGTGAGAGGCAACCTCAAACTCTAAGCAGACTCCCTCTCTCCCTTTCT
GGTGTCTTAAATCAAGAACTAGTTTGAAGCCAAGGCAAAGCAAGGTTTGTTCATCTTCCTTTCCTGTCATTTAAGGTAAAACAGGCAATG
AACTCGCTCTTCAAATACCATAGTTCAAGAGTAGCTGTTGGCCCTGGTTCCAGATTAATATAGCAGCAGGCAGATTGCCCCTTCTTGGGG
CCACCACCCTCCAAAGCTGTGCCACCAATGAGAGCATTGGGTTCAAGTTTGCATCAAACATGGTATTACCAACGCTGAGCCTCCAGCAGA
GCACTTAAAAGTCCTAGTGAGAGAATAGATACTATGCAAGGGAAAAAAATTTAAATGCCAACGAATAGTTTTTTTTTTTTTGAACCTGAT
ACACTGTTTGTTTACTCTCAACTCTTTGTACAAATATTATTGTCCTAAGGGCCTTTTCCCCTCCTGCCTAGAAAATAGGTTGTGTATTGG
TTTTATTCAACCTGCTGTCTGCTTTAGGATTGGAGAAGGTACCTGGATCCTTGTGGACTGCCACTGCTGGCTGCCTCCTCTCCAACTCAT
CAGAAGAGCATTTTGACAAAGACAGAGGACTTGGACCAGGGCATGCCCTGTTGGGGATGTTTCTGTCAGCAAGGACATGGCATGGAATCA
AGTGGGCTGATGTGTTGTTATTTAAACAGTACCAAAGTGCATTCTTCAATGTATGTTTGCCTGCTTGAAGCAAGGCCCAAGTTGAGAATA

>In-frame_BCAS3_ENST00000408905_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_7555nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAA
GATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTG
AAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCG
GCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGAC
ACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATC
ATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCA
TCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATT
GTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAAC
AGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAG
ACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAG
CCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCC
TCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAA
GGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGC
AGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACA
TTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACAC
TGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTC
CTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGG
ACTGTGAGCCGGCGAAAAGGAAGTGTGGATCAGTATCTCCTACGGTCCAGCAACATGGCCGGGGCCAAGTAGCACCTAATGAAGTGTTAC
CTATTTTTAAAAGGTCTTAGGCCTTGATCATTTATCCTGAAGAGCTGAGTGTTCTCACTTTGGTTTTATTTTAATGGCAAAACACTGTCT
AATATGGTTCTGAGAGGTTCCAGGGCCTTTGTAGTCAATATCCAAGGGAAAAGCATCTCCGTTTCTCTGTGACCCAGGCCAGAAGCCTGA
GTGACCCATCCCTAAGGGCTTCTGGGCCAAACCTGGCAGCACCCACTGGGAATGAGATTTGGAACGGCCTCAGGAGCATAATGGCCACAG
TTAGTAATGGTAAAGAGGGGATACCTTCTTAAACTGATAGACTTCCTGACTTCTTTCAGCAGGGTATTGTTTTAAATCAGCCTTGCAGAT
AAAAATTAATTCCATCTTTTTCAGACAAGTGAACAATTTAGTTCCTTGGCAGATCCAAAATGATAGATGGTTATGTTACGCTTTCTGCTG
TCCCTTGCCAAAAATAAGTAAATATATCAGTTAAGATTATGCCTTTACAAAAGTTAATTTACATTCTCTGTTTAAAAAATAATATTTGGT
GAATGCTATATAGTTGACAGAGCACATTTACAGACCTTATTAATTTAGTCTTTCCAAGAGACCTCTCATGTAACTGGCATTAGCCCCATT
TTTAGATGATGAAACTGCAGTGCAGATGTTCTGGTTCTCTCAACTACCAAGTGGCATAACCCATGGATTTTCTAAAGGTTTCCCAAATAG
ATCACAACCTAAGGGTGTGCCAGGGGAGCCTAGGGGAAGCTAGGCTGGGCATTGAACACTGATAGTGCAGAATCCACATGCAAACAAGAT
CGACAGGGTGGATAAACATATATGTGCATTATCCCCATCCCCCACAGTTTAGAGCCTTCTGCTTTTCTGGGGGTTTCAGCCTATGAGACA
AACTATAATCAGGCTTCATTATTACTTTTCAAATGGCCAAGGGTTATCTGCAATGTTGATCTAAAATCCTAAAAAATCACCCTGAAGTCA
GGCAAGGAACAATACTTAAACTCCATACTATGGAAACAAGGTATCTAGCTGGATGCAGCTGGTAAATTCAGTCCCATGGACCTTTGGGGG
TTTATTTTCCTTAGCAGCTGACACCATGTGTCTTTTGCATCCCTGGTGGTGCTTGGTGCTTCTGCCCATCTGGGCTCATTGAGAATAGGG
ATGAAGATATGATTTTAGGGAATTTCTGATGGGCTGGCATGCCCCATGTAGTATGAGTTACTATATAAAGTCATGTGACTGGCATTTTAA
CAGACCTTCCAGAGCTTATATATCCCAATATATGTTGTTTCCTTTGAGTAGCCCCAGCAGGATACTGCTTAGTTTTTCCAGTGCCATTGG
TGAAAGCATTTCTGGAACTGTCTTCAAAGACTAGAAACACTGACTCCCAAAATGCTAGAACTGGAAGGGACCTTAATGGTTATCTATTCC
AGCCTCCTCCTAAGGTCCTCCTCAGCTTCTAGACCTAGAAGCCAAAGTCCAGAACAGTGACCCATTGATCAAGGCAGATAGTATAACTCC
TTTTAAGTGTTCTCAGATTTGCCTTTTCTCAGGGCAAATCTTCAGTGTTTTGTGGTTATTTGTGGTTGAGAGAGAGAGAGAATGTAATGT
CTGAGACTAGCCAGCAGCTATTTGAAGCCTCTGGGAAAGAAGGTGGCTTATCAAGTGGGTTTGTAGTAATGAGTGCTGCTGTAAAGCAGA
GCCATTTTCTTGTGCAGCTCATAGTTCCCAAACAGTTCCCAAACAGAAATTCCAGAGATGTCTTAAACATTGTGGTCATCATTGAGATAG
GTGGAATCTCTTTGGTGACTACGTTGGTGGGGAACATCACTCACCTGAATGTATGCATTCTGTGTTCTCTGTGTGTGTGCACATATGCAG
ATGTATGTTTTAAAAACATTTACCAAACTCATGATTTTGTAGTCACACCACTTCAGTTCTGGGCCCTACCAACAATTTATGTCCTCCAAG
AGCTGCTGGAGGGCATGTTTGTGCCCAAAACAGAAGAGCTGGCTCTGGTTTACAGAAGACAGGGAGGGTGACCTTACTATAAATGCCCTT
AGAGGAAACTTATCAGTTACTGCCATTTCACGCATTTCCTTTTTGATCTTAGTAAATATTATTGGAAGGCTAGTCTTGTTGGTAGGAGCA
AAGACACTTATTTTTCCACTTGCCATCTTTCTCTATATCTCCAGTAATTTGAAAAACACTTTTCAGTTGGAATTGATTTTTGTCTTTGGT
AAAAAGAAATATTTTTAATAGATAAAAGATATATATTTTAAATATTTCCCCAAATTAATACTTTCATTTTAAGAATTGCATAGCAGTTGT
AACAAGTGCAGAATGAAGAACAAATTCTTGTTAAGCAAATAGTCCAAACTCTAGGTCCAGCTTACTGCCTTCCCCCCTTGTACCTACAGT
GATGCCTAGGATGGTATTGACAGTTGTTTTCTAAACTTCCTGCTGAGCAACAGTCCTTCAAATATAGGTAGAGTGGTCTAGGTTAAGGAG
GGAGGAGGGTTGATCTTTAATCAGGTTGGCTTTGGAGGAAGGAAAAACCACTAAGGTATTATCTGAATTTTAAGATGCTTCCCATCCTTA
ATAACTAAAACCTGAATGCTTTTCTTTCTGAAAAATCTCCCTCTCTCCTTCCATGATTCTGAAGTTGGTTAAAAGTCGATATGTTGATGT
GTATTATTTGGGGGAACAGAAAAGGACAAGGAAGGAAACAGAACGATGGGAAGGGTTTGTGAGCTAGAATAAGAGGTGCAGGATTTCACA
AAACAAATTCCTCACAAATCATTGAAGCCCAGTTCACCATACAAATTACCCATGTCTTACTCTGTTCCTTGTATATATGCATTCTGGGTT
TTTTTATTATTAAAGGGGAAGTTAGGGGGGAGGGTGAAGGTCAGTCTGAGGGGAAATCCAGGAAATGTGGTGCCCTTAGAAGGGGGCTGT
CAGCTCTTTTCCATAGAGAGGGAAAGAAACTTTGAGAAAATGTTCTTGACCCATTGATTGTATCTGCTGGAAGAAGTCATCTGGGCCTGT
TGGGTTGGTATCAGATCAGGGGATTATGCATCCAGCCCCTGGCCCCTTTAATCTATTTGCCTCTTTTTAAAAAAGGTTAAGTCTTCTTGG
GTGAGGCTTGCCAGGGAAACTCCTAAGTGGCTTCACTTATTTTTTAAATTTTAATTTAATTTTTAAATTTTTGCTTGGAAGCAGCACTGG
TAATAAATGTTTTATTTTTTGTTCATTTTCCCTAAAGGAAAAATGTCCTTAAGAGATTAAAGCTCTTAATTGATTACTGTCTGGTTACAA
ACTGGCAAACTGACTAAAATGGGAAGCTGCCACCGTGCCTGACTCATGTAGCTGATGACCGAAGGCTCATCCTTTCTTTTCTATTTGACA
GACATTTACTGAGCTTCAGACTTGAGCCAACCCTGAGCTGGACTGTGGAGATAAAGCAGTTCCTGCTCTTGAGGAGCTCAATGTCTAATG
GAATGCATTTGAATGTATGTGTGGCTGGAGAGTTCATTTATGGTCTTAGGAAAGCCATTTCTGGTCCCATTTAGAAAACTGACCAGCACC
CAGCAAGCTGCATTCTACATTTTAGAGACCCCATTGGTATTTGTGAATTTGATTGCACCACCGCTTTTCCTTTACTAAGTAATGTTATGG
AAGGAGAATGAATTTTCTCCTCTAGTGATTACAGGACATTAACATCTCTTCAGAAGCTGCTTTTAGCTTAAGCCCCAAGAAGTGAGGTGG
GTTGTGGATCACTGACATGGTCAGGGGAGGCCCACACCTCAATTCAGTAACCACCTAATCTCTCCCCCAACCTGATCTCTCATCAGAGCT
GGCAGCAACTTGGGATTCCTTTCCTTTTTCCTGCCTAACTTTTCATTGAAATGTCTAGTAGGAGAGTGAGAAAAGAGAACAAAGGCTGGG
TCACAGTCATAGAATGTTACAGCTGGAATGGGCATGGAAATCATCCAAGTTAAACTTCTTCTCTGCCCCCCGCCCCCACTTTTTTTTTTT
TTTTTTTTTAACCAAACGAACTTGTGATCCAGTGCCCTATTTTATAGTGTGGTTTTCCAGGGTCTGAATAAATAATCATTAAAGTTTGAC
ACACGCAGACACACGCACCAATGATGGGGATACCCCCAAATGATTTAGGAGGTTATTTTATTTTAATAGTTTTTTCTTCCTGATTTTTTT
CAGTTAGTTAGAGTTAAATGTACCTATAGCCCCTGAATACATGCTCAGGTAGAGAAAGTCTCCATAGTATAAGTAAGTAATATGAATGTG
GAATCTTGGAAAGTGATATATTTTGATTGGAATAATTTTAATTAAATTTAATGATTTTAATTAAGAATTAAAAGCCAGCTAGCCAAATTT
TCTTTAAAAATTGGAAACTCATTATGGTCTTAAATTGTCCTCAGGCAGCCTTTTCCTCATCAACCCATAGAGTGGTCTTTTGAACTGGTA
TCTAAACATACCTGGTTATGAATTCTCAAAAGAGAAAGCAGGTCTGGGGCGGGGTGGTCAGGAGACAGATTCTAGGGAAAGTGCTGAAGA
GATTTTCTTCTGAAGATGATCTAGGAAATGCATCTTTATACATGATTGTTAGCTGCTGTAGCTTTCTGAAGAAGATTGTAGAAAAGAGAC
TAAGATATATGCAAGGGTCACCAGTTTAGAGATCAGTCAAATTGGAAAAAGTGCCAAGACTGGATGTGCAGATTGTTCTATGTATTATCA
GTATTTTTTTCCTCTTAAGAAAAAAATTTACTCTCTCTCCTTTGTGAGTAAATGCCTCCTTAATGCCTTTTAAGTAAGGTGGCAACTTTT
AACTGTCATCTTGTGAGAGGCAACCTCAAACTCTAAGCAGACTCCCTCTCTCCCTTTCTGGTGTCTTAAATCAAGAACTAGTTTGAAGCC
AAGGCAAAGCAAGGTTTGTTCATCTTCCTTTCCTGTCATTTAAGGTAAAACAGGCAATGAACTCGCTCTTCAAATACCATAGTTCAAGAG
TAGCTGTTGGCCCTGGTTCCAGATTAATATAGCAGCAGGCAGATTGCCCCTTCTTGGGGCCACCACCCTCCAAAGCTGTGCCACCAATGA
GAGCATTGGGTTCAAGTTTGCATCAAACATGGTATTACCAACGCTGAGCCTCCAGCAGAGCACTTAAAAGTCCTAGTGAGAGAATAGATA
CTATGCAAGGGAAAAAAATTTAAATGCCAACGAATAGTTTTTTTTTTTTTGAACCTGATACACTGTTTGTTTACTCTCAACTCTTTGTAC
AAATATTATTGTCCTAAGGGCCTTTTCCCCTCCTGCCTAGAAAATAGGTTGTGTATTGGTTTTATTCAACCTGCTGTCTGCTTTAGGATT
GGAGAAGGTACCTGGATCCTTGTGGACTGCCACTGCTGGCTGCCTCCTCTCCAACTCATCAGAAGAGCATTTTGACAAAGACAGAGGACT
TGGACCAGGGCATGCCCTGTTGGGGATGTTTCTGTCAGCAAGGACATGGCATGGAATCAAGTGGGCTGATGTGTTGTTATTTAAACAGTA

>In-frame_BCAS3_ENST00000588462_chr17_58786686_+_RNF169_ENST00000299563_chr11_74521229_+_7555nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTCTGAGAGAAGAAAAGTTACAAGAGGAAAAACCCTCTGAA
GATCAAATCCACAAGCTGTTACCAGAGGATACAGAAACAGGGAAAAGGAAAATGGATGAACAGAAAAAAAGAGATGAACCATTAGTACTG
AAAACAAATCTGGAACGTTGTCCTGCACGTCTCTCAGATTCAGAGAATGAAGAACCTTCTCGAGGCCAGATGACACAGACACATCGCTCG
GCATTTGTTTCCAAGAACAACTCCTACTCCTTAGCTTTCCTGGCAGGGAAGCTAAACTCCAAGGTGGAAAGGAGTCAGAGCTGTAGTGAC
ACAGCCCAGGAAAGAGCGAAGAGCAGAGTCAGAGCAGTTCCAGGCAACAAAGCCAAGGTCACAACTATGACTCCAGCCTCCAACCCCATC
ATTGGTGTCCTCTTGTCAACTCAAAACAACCGCTGCGTCTCGGCCCCTGACTTAACCATCGAAAAGCGTCTACCCTTCAGCTCCCTTTCA
TCCTTGGCTTCCCTGCATAAGCCAGAGCGTTCTGTCAGCCCTGAGAGCAATGACAGCATCTCCGAAGAACTAAACCATTTCAAGCCCATT
GTCTGCTCACCATGTACTCCTCCCAAGAGACTCCCTGATGGCCGTGTGCTAAGTCCTCTCATCATCAAATCAACTCCACGCAACCTAAAC
AGAAGCCTGCAGAAGCAGACTTCTTATGAGGCCAGTCCACGGATCCTCAAAAAGTGGGAACAGATCTTTCAGGAGCGGCAGATCAAAAAG
ACCCTTTCAAAAGCCACTCTTACCTCTCTGGCTCCTGAAATGGGGGAAGAGTTACTAGGCTCTGAAGGTATCCATTCTAGCAAGGAGAAG
CCACTTGTGGCTGTAAATACAAGATTATCTGGTGGGCAGGTCCTCTCTGAGTATACTGGACCCACCTCTGCTGATCTTGATCATTTCCCC
TCTGTTAGCCAAACAAAAGCAGAACAGGACAGTGATAATAAAAGTAGCACTGAGATCCCACTGGAAACCTGCTGTTCCTCAGAACTCAAA
GGGGGAGGCAGTGGGACTTCTTTGGAGAGGGAGCAGTTTGAGGGGTTAGGGTCAACTCCAGATGCCAAGTTAGACAAAACCTGTATAAGC
AGAGCCATGAAAATCACCACAGTTAATTCAGTGCTACCCCAAAACAGTGTTTTGGGTGGAGTCCTCAAAACAAAGCAACAATTGAAGACA
TTAAATCATTTTGATCTGACTAATGGTGTTCTAGTTGAGAGCCTAAGTGAAGAGCCACTTCCTTCTTTGCGTCGAGGCCGGAAAAGACAC
TGCAAGACCAAGCACTTAGAACAAAATGGCTCCCTTAAAAAACTGCGACAAACCAGTGGGGAGGTGGGTCTGGCCCCAACAGACCCAGTC
CTGCGAGAGATGGAGCAGAAGCTTCAGCAAGAGGAAGAAGACCGACAGTTGGCTCTGCAGTTGCAGCGCATGTTCGACAATGAGAGGCGG
ACTGTGAGCCGGCGAAAAGGAAGTGTGGATCAGTATCTCCTACGGTCCAGCAACATGGCCGGGGCCAAGTAGCACCTAATGAAGTGTTAC
CTATTTTTAAAAGGTCTTAGGCCTTGATCATTTATCCTGAAGAGCTGAGTGTTCTCACTTTGGTTTTATTTTAATGGCAAAACACTGTCT
AATATGGTTCTGAGAGGTTCCAGGGCCTTTGTAGTCAATATCCAAGGGAAAAGCATCTCCGTTTCTCTGTGACCCAGGCCAGAAGCCTGA
GTGACCCATCCCTAAGGGCTTCTGGGCCAAACCTGGCAGCACCCACTGGGAATGAGATTTGGAACGGCCTCAGGAGCATAATGGCCACAG
TTAGTAATGGTAAAGAGGGGATACCTTCTTAAACTGATAGACTTCCTGACTTCTTTCAGCAGGGTATTGTTTTAAATCAGCCTTGCAGAT
AAAAATTAATTCCATCTTTTTCAGACAAGTGAACAATTTAGTTCCTTGGCAGATCCAAAATGATAGATGGTTATGTTACGCTTTCTGCTG
TCCCTTGCCAAAAATAAGTAAATATATCAGTTAAGATTATGCCTTTACAAAAGTTAATTTACATTCTCTGTTTAAAAAATAATATTTGGT
GAATGCTATATAGTTGACAGAGCACATTTACAGACCTTATTAATTTAGTCTTTCCAAGAGACCTCTCATGTAACTGGCATTAGCCCCATT
TTTAGATGATGAAACTGCAGTGCAGATGTTCTGGTTCTCTCAACTACCAAGTGGCATAACCCATGGATTTTCTAAAGGTTTCCCAAATAG
ATCACAACCTAAGGGTGTGCCAGGGGAGCCTAGGGGAAGCTAGGCTGGGCATTGAACACTGATAGTGCAGAATCCACATGCAAACAAGAT
CGACAGGGTGGATAAACATATATGTGCATTATCCCCATCCCCCACAGTTTAGAGCCTTCTGCTTTTCTGGGGGTTTCAGCCTATGAGACA
AACTATAATCAGGCTTCATTATTACTTTTCAAATGGCCAAGGGTTATCTGCAATGTTGATCTAAAATCCTAAAAAATCACCCTGAAGTCA
GGCAAGGAACAATACTTAAACTCCATACTATGGAAACAAGGTATCTAGCTGGATGCAGCTGGTAAATTCAGTCCCATGGACCTTTGGGGG
TTTATTTTCCTTAGCAGCTGACACCATGTGTCTTTTGCATCCCTGGTGGTGCTTGGTGCTTCTGCCCATCTGGGCTCATTGAGAATAGGG
ATGAAGATATGATTTTAGGGAATTTCTGATGGGCTGGCATGCCCCATGTAGTATGAGTTACTATATAAAGTCATGTGACTGGCATTTTAA
CAGACCTTCCAGAGCTTATATATCCCAATATATGTTGTTTCCTTTGAGTAGCCCCAGCAGGATACTGCTTAGTTTTTCCAGTGCCATTGG
TGAAAGCATTTCTGGAACTGTCTTCAAAGACTAGAAACACTGACTCCCAAAATGCTAGAACTGGAAGGGACCTTAATGGTTATCTATTCC
AGCCTCCTCCTAAGGTCCTCCTCAGCTTCTAGACCTAGAAGCCAAAGTCCAGAACAGTGACCCATTGATCAAGGCAGATAGTATAACTCC
TTTTAAGTGTTCTCAGATTTGCCTTTTCTCAGGGCAAATCTTCAGTGTTTTGTGGTTATTTGTGGTTGAGAGAGAGAGAGAATGTAATGT
CTGAGACTAGCCAGCAGCTATTTGAAGCCTCTGGGAAAGAAGGTGGCTTATCAAGTGGGTTTGTAGTAATGAGTGCTGCTGTAAAGCAGA
GCCATTTTCTTGTGCAGCTCATAGTTCCCAAACAGTTCCCAAACAGAAATTCCAGAGATGTCTTAAACATTGTGGTCATCATTGAGATAG
GTGGAATCTCTTTGGTGACTACGTTGGTGGGGAACATCACTCACCTGAATGTATGCATTCTGTGTTCTCTGTGTGTGTGCACATATGCAG
ATGTATGTTTTAAAAACATTTACCAAACTCATGATTTTGTAGTCACACCACTTCAGTTCTGGGCCCTACCAACAATTTATGTCCTCCAAG
AGCTGCTGGAGGGCATGTTTGTGCCCAAAACAGAAGAGCTGGCTCTGGTTTACAGAAGACAGGGAGGGTGACCTTACTATAAATGCCCTT
AGAGGAAACTTATCAGTTACTGCCATTTCACGCATTTCCTTTTTGATCTTAGTAAATATTATTGGAAGGCTAGTCTTGTTGGTAGGAGCA
AAGACACTTATTTTTCCACTTGCCATCTTTCTCTATATCTCCAGTAATTTGAAAAACACTTTTCAGTTGGAATTGATTTTTGTCTTTGGT
AAAAAGAAATATTTTTAATAGATAAAAGATATATATTTTAAATATTTCCCCAAATTAATACTTTCATTTTAAGAATTGCATAGCAGTTGT
AACAAGTGCAGAATGAAGAACAAATTCTTGTTAAGCAAATAGTCCAAACTCTAGGTCCAGCTTACTGCCTTCCCCCCTTGTACCTACAGT
GATGCCTAGGATGGTATTGACAGTTGTTTTCTAAACTTCCTGCTGAGCAACAGTCCTTCAAATATAGGTAGAGTGGTCTAGGTTAAGGAG
GGAGGAGGGTTGATCTTTAATCAGGTTGGCTTTGGAGGAAGGAAAAACCACTAAGGTATTATCTGAATTTTAAGATGCTTCCCATCCTTA
ATAACTAAAACCTGAATGCTTTTCTTTCTGAAAAATCTCCCTCTCTCCTTCCATGATTCTGAAGTTGGTTAAAAGTCGATATGTTGATGT
GTATTATTTGGGGGAACAGAAAAGGACAAGGAAGGAAACAGAACGATGGGAAGGGTTTGTGAGCTAGAATAAGAGGTGCAGGATTTCACA
AAACAAATTCCTCACAAATCATTGAAGCCCAGTTCACCATACAAATTACCCATGTCTTACTCTGTTCCTTGTATATATGCATTCTGGGTT
TTTTTATTATTAAAGGGGAAGTTAGGGGGGAGGGTGAAGGTCAGTCTGAGGGGAAATCCAGGAAATGTGGTGCCCTTAGAAGGGGGCTGT
CAGCTCTTTTCCATAGAGAGGGAAAGAAACTTTGAGAAAATGTTCTTGACCCATTGATTGTATCTGCTGGAAGAAGTCATCTGGGCCTGT
TGGGTTGGTATCAGATCAGGGGATTATGCATCCAGCCCCTGGCCCCTTTAATCTATTTGCCTCTTTTTAAAAAAGGTTAAGTCTTCTTGG
GTGAGGCTTGCCAGGGAAACTCCTAAGTGGCTTCACTTATTTTTTAAATTTTAATTTAATTTTTAAATTTTTGCTTGGAAGCAGCACTGG
TAATAAATGTTTTATTTTTTGTTCATTTTCCCTAAAGGAAAAATGTCCTTAAGAGATTAAAGCTCTTAATTGATTACTGTCTGGTTACAA
ACTGGCAAACTGACTAAAATGGGAAGCTGCCACCGTGCCTGACTCATGTAGCTGATGACCGAAGGCTCATCCTTTCTTTTCTATTTGACA
GACATTTACTGAGCTTCAGACTTGAGCCAACCCTGAGCTGGACTGTGGAGATAAAGCAGTTCCTGCTCTTGAGGAGCTCAATGTCTAATG
GAATGCATTTGAATGTATGTGTGGCTGGAGAGTTCATTTATGGTCTTAGGAAAGCCATTTCTGGTCCCATTTAGAAAACTGACCAGCACC
CAGCAAGCTGCATTCTACATTTTAGAGACCCCATTGGTATTTGTGAATTTGATTGCACCACCGCTTTTCCTTTACTAAGTAATGTTATGG
AAGGAGAATGAATTTTCTCCTCTAGTGATTACAGGACATTAACATCTCTTCAGAAGCTGCTTTTAGCTTAAGCCCCAAGAAGTGAGGTGG
GTTGTGGATCACTGACATGGTCAGGGGAGGCCCACACCTCAATTCAGTAACCACCTAATCTCTCCCCCAACCTGATCTCTCATCAGAGCT
GGCAGCAACTTGGGATTCCTTTCCTTTTTCCTGCCTAACTTTTCATTGAAATGTCTAGTAGGAGAGTGAGAAAAGAGAACAAAGGCTGGG
TCACAGTCATAGAATGTTACAGCTGGAATGGGCATGGAAATCATCCAAGTTAAACTTCTTCTCTGCCCCCCGCCCCCACTTTTTTTTTTT
TTTTTTTTTAACCAAACGAACTTGTGATCCAGTGCCCTATTTTATAGTGTGGTTTTCCAGGGTCTGAATAAATAATCATTAAAGTTTGAC
ACACGCAGACACACGCACCAATGATGGGGATACCCCCAAATGATTTAGGAGGTTATTTTATTTTAATAGTTTTTTCTTCCTGATTTTTTT
CAGTTAGTTAGAGTTAAATGTACCTATAGCCCCTGAATACATGCTCAGGTAGAGAAAGTCTCCATAGTATAAGTAAGTAATATGAATGTG
GAATCTTGGAAAGTGATATATTTTGATTGGAATAATTTTAATTAAATTTAATGATTTTAATTAAGAATTAAAAGCCAGCTAGCCAAATTT
TCTTTAAAAATTGGAAACTCATTATGGTCTTAAATTGTCCTCAGGCAGCCTTTTCCTCATCAACCCATAGAGTGGTCTTTTGAACTGGTA
TCTAAACATACCTGGTTATGAATTCTCAAAAGAGAAAGCAGGTCTGGGGCGGGGTGGTCAGGAGACAGATTCTAGGGAAAGTGCTGAAGA
GATTTTCTTCTGAAGATGATCTAGGAAATGCATCTTTATACATGATTGTTAGCTGCTGTAGCTTTCTGAAGAAGATTGTAGAAAAGAGAC
TAAGATATATGCAAGGGTCACCAGTTTAGAGATCAGTCAAATTGGAAAAAGTGCCAAGACTGGATGTGCAGATTGTTCTATGTATTATCA
GTATTTTTTTCCTCTTAAGAAAAAAATTTACTCTCTCTCCTTTGTGAGTAAATGCCTCCTTAATGCCTTTTAAGTAAGGTGGCAACTTTT
AACTGTCATCTTGTGAGAGGCAACCTCAAACTCTAAGCAGACTCCCTCTCTCCCTTTCTGGTGTCTTAAATCAAGAACTAGTTTGAAGCC
AAGGCAAAGCAAGGTTTGTTCATCTTCCTTTCCTGTCATTTAAGGTAAAACAGGCAATGAACTCGCTCTTCAAATACCATAGTTCAAGAG
TAGCTGTTGGCCCTGGTTCCAGATTAATATAGCAGCAGGCAGATTGCCCCTTCTTGGGGCCACCACCCTCCAAAGCTGTGCCACCAATGA
GAGCATTGGGTTCAAGTTTGCATCAAACATGGTATTACCAACGCTGAGCCTCCAGCAGAGCACTTAAAAGTCCTAGTGAGAGAATAGATA
CTATGCAAGGGAAAAAAATTTAAATGCCAACGAATAGTTTTTTTTTTTTTGAACCTGATACACTGTTTGTTTACTCTCAACTCTTTGTAC
AAATATTATTGTCCTAAGGGCCTTTTCCCCTCCTGCCTAGAAAATAGGTTGTGTATTGGTTTTATTCAACCTGCTGTCTGCTTTAGGATT
GGAGAAGGTACCTGGATCCTTGTGGACTGCCACTGCTGGCTGCCTCCTCTCCAACTCATCAGAAGAGCATTTTGACAAAGACAGAGGACT
TGGACCAGGGCATGCCCTGTTGGGGATGTTTCTGTCAGCAAGGACATGGCATGGAATCAAGTGGGCTGATGTGTTGTTATTTAAACAGTA


Top

FusionGenePPI for BCAS3_RNF169


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2BRNF169UBC, HIST2H2AC, HIST2H2BE, UBE2E1, DYRK1B, DYRK1A, BRCA1, HIST1H2BG, HIST1H3A, USP7, CDC14B, DCAF7, KLHDC2, IL16, CAPZB, CAPZA1, TUBB4B, RPS3, DDB1, C1QBP, HNRNPU


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCAS3_RNF169


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BCAS3_RNF169


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource