FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39490

FusionGeneSummary for TRIM27_PTPRR

check button Fusion gene summary
Fusion gene informationFusion gene name: TRIM27_PTPRR
Fusion gene ID: 39490
HgeneTgene
Gene symbol

TRIM27

PTPRR

Gene ID

5987

5801

Gene nametripartite motif containing 27protein tyrosine phosphatase, receptor type R
SynonymsRFP|RNF76EC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Cytomap

6p22.1

12q15

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein RFPRFP transforming proteinRING finger protein 76RING-type E3 ubiquitin transferase TRIM27ret finger proteintripartite motif protein TRIM27tripartite motif-containing protein 27receptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1
Modification date2018052220180519
UniProtAcc

P14373

Q15256

Ensembl transtripts involved in fusion geneENST00000377194, ENST00000377199, 
ENST00000498117, ENST00000459807, 
ENST00000412687, ENST00000437160, 
ENST00000427689, ENST00000435528, 
ENST00000485666, ENST00000468364, 
ENST00000455861, ENST00000417660, 
ENST00000400720, ENST00000495323, 
ENST00000491158, ENST00000437415, 
ENST00000468047, ENST00000431123, 
ENST00000452265, 
ENST00000283228, 
ENST00000440835, ENST00000537619, 
ENST00000378778, ENST00000342084, 
ENST00000549308, 
Fusion gene scores* DoF score3 X 4 X 3=3633 X 13 X 10=4290
# samples 431
** MAII scorelog2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(31/4290*10)=-3.79063752711267
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TRIM27 [Title/Abstract] AND PTPRR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTRIM27

GO:0000122

negative regulation of transcription by RNA polymerase II

10976108

HgeneTRIM27

GO:0006469

negative regulation of protein kinase activity

22128329

HgeneTRIM27

GO:0032897

negative regulation of viral transcription

18248090

HgeneTRIM27

GO:0034314

Arp2/3 complex-mediated actin nucleation

23452853

HgeneTRIM27

GO:0042147

retrograde transport, endosome to Golgi

23452853

HgeneTRIM27

GO:0045087

innate immune response

18248090

HgeneTRIM27

GO:0045814

negative regulation of gene expression, epigenetic

10976108

HgeneTRIM27

GO:0051091

positive regulation of DNA binding transcription factor activity

23077300

HgeneTRIM27

GO:0070206

protein trimerization

17156811


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A23Z-01ATRIM27chr6

28879473

-PTPRRchr12

71050597

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000377194ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
In-frameENST00000377194ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377194ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377194ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377194ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377194ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
In-frameENST00000377199ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
In-frameENST00000377199ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377199ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377199ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377199ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
5CDS-5UTRENST00000377199ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000498117ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000498117ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000498117ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000498117ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000498117ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000498117ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000459807ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000459807ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000459807ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000459807ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000459807ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000459807ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000412687ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000412687ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000412687ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000412687ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000412687ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000412687ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000437160ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000437160ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437160ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437160ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437160ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437160ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000427689ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000427689ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000427689ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000427689ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000427689ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000427689ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000435528ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000435528ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000435528ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000435528ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000435528ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000435528ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000485666ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000485666ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000485666ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000485666ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000485666ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000485666ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000468364ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000468364ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468364ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468364ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468364ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468364ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000455861ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000455861ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000455861ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000455861ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000455861ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000455861ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000417660ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000417660ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000417660ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000417660ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000417660ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000417660ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000400720ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000400720ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000400720ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000400720ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000400720ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000400720ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000495323ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000495323ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000495323ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000495323ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000495323ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000495323ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000491158ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000491158ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000491158ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000491158ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000491158ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000491158ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000437415ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000437415ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437415ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437415ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437415ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000437415ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000468047ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000468047ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468047ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468047ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468047ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000468047ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000431123ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000431123ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000431123ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000431123ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000431123ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000431123ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000452265ENST00000283228TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-3CDSENST00000452265ENST00000440835TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000452265ENST00000537619TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000452265ENST00000378778TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000452265ENST00000342084TRIM27chr6

28879473

-PTPRRchr12

71050597

-
intron-5UTRENST00000452265ENST00000549308TRIM27chr6

28879473

-PTPRRchr12

71050597

-

Top

FusionProtFeatures for TRIM27_PTPRR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TRIM27

P14373

PTPRR

Q15256

E3 ubiquitin-protein ligase that mediates ubiquitinationof PIK3C2B and inhibits its activity; mediates the formation of'Lys-48'-linked polyubiquitin chains; the function inhibits CD4 T-cell activation. Acts as a regulator of retrograde transport:together with MAGEL2, mediates the formation of 'Lys-63'-linkedpolyubiquitin chains at 'Lys-220' of WASHC1, leading to promoteendosomal F-actin assembly (PubMed:23452853). Has atranscriptional repressor activity by cooperating with EPC1.Induces apoptosis by activating Jun N-terminal kinase and p38kinase and also increases caspase-3-like activity independently ofmitochondrial events. May function in male germ cell development.Has DNA-binding activity and preferentially bound to double-stranded DNA. {ECO:0000269|PubMed:10976108,ECO:0000269|PubMed:12807881, ECO:0000269|PubMed:22128329,ECO:0000269|PubMed:23452853}. Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377194-49132_172256359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377199-48132_172256514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377194-4916_57256359Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377194-4996_127256359Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377199-4816_57256514Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377199-4896_127256514Zinc fingerB box-type
TgenePTPRRchr6:28879473chr12:71050597ENST00000378778-811393_647382452DomainTyrosine-protein phosphatase
TgenePTPRRchr6:28879473chr12:71050597ENST00000440835-710393_647343413DomainTyrosine-protein phosphatase
TgenePTPRRchr6:28879473chr12:71050597ENST00000549308-811393_647343413DomainTyrosine-protein phosphatase
TgenePTPRRchr6:28879473chr12:71050597ENST00000283228-1114588_594588658RegionSubstrate binding
TgenePTPRRchr6:28879473chr12:71050597ENST00000342084-1013588_594476546RegionSubstrate binding
TgenePTPRRchr6:28879473chr12:71050597ENST00000378778-811588_594382452RegionSubstrate binding
TgenePTPRRchr6:28879473chr12:71050597ENST00000440835-710588_594343413RegionSubstrate binding
TgenePTPRRchr6:28879473chr12:71050597ENST00000549308-811588_594343413RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377194-49282_311256359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377199-48282_311256514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000400720-18132_172-119514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000400720-18282_311-119514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000412687-19132_172-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000412687-19282_311-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000417660-19132_172-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000417660-19282_311-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000427689-19132_172-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000427689-19282_311-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000431123-18132_172-97514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000431123-18282_311-97514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000435528-18132_172-119514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000435528-18282_311-119514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000437160-18132_172-119514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000437160-18282_311-119514Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000452265-19132_172-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000452265-19282_311-119359Coiled coilOntology_term=ECO:0000255
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377194-49298_492256359DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000377199-48298_492256514DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000400720-18298_492-119514DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000412687-19298_492-119359DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000417660-19298_492-119359DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000427689-19298_492-119359DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000431123-18298_492-97514DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000435528-18298_492-119514DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000437160-18298_492-119514DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000452265-19298_492-119359DomainB30.2/SPRY
HgeneTRIM27chr6:28879473chr12:71050597ENST00000400720-1816_57-119514Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000400720-1896_127-119514Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000412687-1916_57-119359Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000412687-1996_127-119359Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000417660-1916_57-119359Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000417660-1996_127-119359Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000427689-1916_57-119359Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000427689-1996_127-119359Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000431123-1816_57-97514Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000431123-1896_127-97514Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000435528-1816_57-119514Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000435528-1896_127-119514Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000437160-1816_57-119514Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000437160-1896_127-119514Zinc fingerB box-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000452265-1916_57-119359Zinc fingerRING-type
HgeneTRIM27chr6:28879473chr12:71050597ENST00000452265-1996_127-119359Zinc fingerB box-type
TgenePTPRRchr6:28879473chr12:71050597ENST00000283228-1114393_647588658DomainTyrosine-protein phosphatase
TgenePTPRRchr6:28879473chr12:71050597ENST00000342084-1013393_647476546DomainTyrosine-protein phosphatase
TgenePTPRRchr6:28879473chr12:71050597ENST00000283228-111422_227588658Topological domainExtracellular
TgenePTPRRchr6:28879473chr12:71050597ENST00000283228-1114249_657588658Topological domainCytoplasmic
TgenePTPRRchr6:28879473chr12:71050597ENST00000342084-101322_227476546Topological domainExtracellular
TgenePTPRRchr6:28879473chr12:71050597ENST00000342084-1013249_657476546Topological domainCytoplasmic
TgenePTPRRchr6:28879473chr12:71050597ENST00000378778-81122_227382452Topological domainExtracellular
TgenePTPRRchr6:28879473chr12:71050597ENST00000378778-811249_657382452Topological domainCytoplasmic
TgenePTPRRchr6:28879473chr12:71050597ENST00000440835-71022_227343413Topological domainExtracellular
TgenePTPRRchr6:28879473chr12:71050597ENST00000440835-710249_657343413Topological domainCytoplasmic
TgenePTPRRchr6:28879473chr12:71050597ENST00000549308-81122_227343413Topological domainExtracellular
TgenePTPRRchr6:28879473chr12:71050597ENST00000549308-811249_657343413Topological domainCytoplasmic
TgenePTPRRchr6:28879473chr12:71050597ENST00000283228-1114228_248588658TransmembraneHelical
TgenePTPRRchr6:28879473chr12:71050597ENST00000342084-1013228_248476546TransmembraneHelical
TgenePTPRRchr6:28879473chr12:71050597ENST00000378778-811228_248382452TransmembraneHelical
TgenePTPRRchr6:28879473chr12:71050597ENST00000440835-710228_248343413TransmembraneHelical
TgenePTPRRchr6:28879473chr12:71050597ENST00000549308-811228_248343413TransmembraneHelical


Top

FusionGeneSequence for TRIM27_PTPRR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TRIM27_ENST00000377194_chr6_28879473_-_PTPRR_ENST00000283228_chr12_71050597_-_326aa
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPG
GEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLTHSLKEHETRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSSAGIGRTGCFIATS

>In-frame_TRIM27_ENST00000377194_chr6_28879473_-_PTPRR_ENST00000440835_chr12_71050597_-_326aa
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPG
GEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLTHSLKEHETRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSSAGIGRTGCFIATS

>In-frame_TRIM27_ENST00000377199_chr6_28879473_-_PTPRR_ENST00000283228_chr12_71050597_-_326aa
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPG
GEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLTHSLKEHETRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSSAGIGRTGCFIATS

>In-frame_TRIM27_ENST00000377199_chr6_28879473_-_PTPRR_ENST00000440835_chr12_71050597_-_326aa
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPG
GEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLTHSLKEHETRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSSAGIGRTGCFIATS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TRIM27_ENST00000377194_chr6_28879473_-_PTPRR_ENST00000283228_chr12_71050597_-_978nt
ATGGCCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGAC
TGCGGCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTC
CCGCAGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGC
GGCGAGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGC
TCCCGCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTA
AAAAGAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAG
AAGATTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCC
ATCTACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAG
CAGCAGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCC
ATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAA

>In-frame_TRIM27_ENST00000377194_chr6_28879473_-_PTPRR_ENST00000440835_chr12_71050597_-_978nt
ATGGCCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGAC
TGCGGCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTC
CCGCAGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGC
GGCGAGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGC
TCCCGCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTA
AAAAGAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAG
AAGATTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCC
ATCTACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAG
CAGCAGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCC
ATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAA

>In-frame_TRIM27_ENST00000377199_chr6_28879473_-_PTPRR_ENST00000283228_chr12_71050597_-_978nt
ATGGCCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGAC
TGCGGCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTC
CCGCAGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGC
GGCGAGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGC
TCCCGCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTA
AAAAGAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAG
AAGATTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCC
ATCTACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAG
CAGCAGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCC
ATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAA

>In-frame_TRIM27_ENST00000377199_chr6_28879473_-_PTPRR_ENST00000440835_chr12_71050597_-_978nt
ATGGCCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGAC
TGCGGCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTC
CCGCAGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGC
GGCGAGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGC
TCCCGCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTA
AAAAGAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAG
AAGATTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCC
ATCTACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAG
CAGCAGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCC
ATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TRIM27_ENST00000377194_chr6_28879473_-_PTPRR_ENST00000283228_chr12_71050597_-_2436nt
TTTACGCTGCCGCCGGCATCCGCTCGGACGCGGCCACGTTGTCTTGCGCGCTTTGCCCGCCTGGCCCTGGGACTCTGACCCTCGGCTACC
CTTTCCTGCCCCACTAGCGTGGCCGCGAGCCTCGGTGAGCCGGCCGTATTCCCGCTCTCGCTTAGGGGGCACAGGCGCAGGCATCGGCCC
GGCCACTCCAAGCCTTCGGTGCGCGGGCGCGTCTGGGATACGGGCCCGGGAGGCGCCGCCCTCCGTCCGCCCGGTGCCTCTCAGGAACAG
CGAACCGGAGAGAGCGCCGGAGAGTTGGGCTCAGTGCAGAGCTCGGCGCCGGGGCCCATGCCCGTGCGCCCCCGCAGGCCGGCGCCATGG
CCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGACTGCG
GCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTCCCGC
AGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGCGGCG
AGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGCTCCC
GCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTAAAAA
GAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAGAAGA
TTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCCATCT
ACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAGCAGC
AGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTG
GCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCA
GTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGT
CAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCT
GAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATC
CCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACT
CTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTA
TGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTT
CTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCA
AAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGA
GCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATT
TCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTT
TGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCC
ATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATA
ACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATGCAGCAATGTTGACTTTGTTTCATACTGCCAATAAACTCTT

>In-frame_TRIM27_ENST00000377194_chr6_28879473_-_PTPRR_ENST00000440835_chr12_71050597_-_2445nt
TTTACGCTGCCGCCGGCATCCGCTCGGACGCGGCCACGTTGTCTTGCGCGCTTTGCCCGCCTGGCCCTGGGACTCTGACCCTCGGCTACC
CTTTCCTGCCCCACTAGCGTGGCCGCGAGCCTCGGTGAGCCGGCCGTATTCCCGCTCTCGCTTAGGGGGCACAGGCGCAGGCATCGGCCC
GGCCACTCCAAGCCTTCGGTGCGCGGGCGCGTCTGGGATACGGGCCCGGGAGGCGCCGCCCTCCGTCCGCCCGGTGCCTCTCAGGAACAG
CGAACCGGAGAGAGCGCCGGAGAGTTGGGCTCAGTGCAGAGCTCGGCGCCGGGGCCCATGCCCGTGCGCCCCCGCAGGCCGGCGCCATGG
CCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGACTGCG
GCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTCCCGC
AGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGCGGCG
AGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGCTCCC
GCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTAAAAA
GAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAGAAGA
TTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCCATCT
ACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAGCAGC
AGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTG
GCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCA
GTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGT
CAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCT
GAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATC
CCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACT
CTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTA
TGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTT
CTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCA
AAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGA
GCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATT
TCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTT
TGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCC
ATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATA
ACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATGCAGCAATGTTGACTTTGTTTCATACTGCCAATAAACTCTT

>In-frame_TRIM27_ENST00000377199_chr6_28879473_-_PTPRR_ENST00000283228_chr12_71050597_-_2437nt
GTTTACGCTGCCGCCGGCATCCGCTCGGACGCGGCCACGTTGTCTTGCGCGCTTTGCCCGCCTGGCCCTGGGACTCTGACCCTCGGCTAC
CCTTTCCTGCCCCACTAGCGTGGCCGCGAGCCTCGGTGAGCCGGCCGTATTCCCGCTCTCGCTTAGGGGGCACAGGCGCAGGCATCGGCC
CGGCCACTCCAAGCCTTCGGTGCGCGGGCGCGTCTGGGATACGGGCCCGGGAGGCGCCGCCCTCCGTCCGCCCGGTGCCTCTCAGGAACA
GCGAACCGGAGAGAGCGCCGGAGAGTTGGGCTCAGTGCAGAGCTCGGCGCCGGGGCCCATGCCCGTGCGCCCCCGCAGGCCGGCGCCATG
GCCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGACTGC
GGCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTCCCG
CAGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGCGGC
GAGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGCTCC
CGCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTAAAA
AGAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAGAAG
ATTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCCATC
TACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAGCAG
CAGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATT
GGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACC
AGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTG
TCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTC
TGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCAT
CCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGAC
TCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATT
ATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTT
TCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATC
AAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAG
AGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTAT
TTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTT
TTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCC
CATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAAT
AACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATGCAGCAATGTTGACTTTGTTTCATACTGCCAATAAACTCT

>In-frame_TRIM27_ENST00000377199_chr6_28879473_-_PTPRR_ENST00000440835_chr12_71050597_-_2446nt
GTTTACGCTGCCGCCGGCATCCGCTCGGACGCGGCCACGTTGTCTTGCGCGCTTTGCCCGCCTGGCCCTGGGACTCTGACCCTCGGCTAC
CCTTTCCTGCCCCACTAGCGTGGCCGCGAGCCTCGGTGAGCCGGCCGTATTCCCGCTCTCGCTTAGGGGGCACAGGCGCAGGCATCGGCC
CGGCCACTCCAAGCCTTCGGTGCGCGGGCGCGTCTGGGATACGGGCCCGGGAGGCGCCGCCCTCCGTCCGCCCGGTGCCTCTCAGGAACA
GCGAACCGGAGAGAGCGCCGGAGAGTTGGGCTCAGTGCAGAGCTCGGCGCCGGGGCCCATGCCCGTGCGCCCCCGCAGGCCGGCGCCATG
GCCTCCGGGAGTGTGGCCGAGTGCCTGCAGCAGGAGACCACCTGCCCCGTGTGCCTGCAGTACTTCGCAGAGCCCATGATGCTCGACTGC
GGCCATAACATCTGTTGCGCGTGCCTCGCCCGCTGCTGGGGCACGGCAGAGACTAACGTGTCGTGCCCGCAGTGCCGGGAGACCTTCCCG
CAGAGGCACATGCGGCCCAACCGGCACCTGGCCAACGTGACCCAACTGGTAAAGCAGCTGCGCACCGAGCGGCCGTCGGGGCCCGGCGGC
GAGATGGGCGTGTGCGAGAAGCACCGCGAGCCCCTGAAGCTGTACTGCGAGGAGGACCAGATGCCCATCTGCGTGGTGTGCGACCGCTCC
CGCGAGCACCGCGGCCACAGCGTGCTGCCGCTCGAGGAGGCGGTGGAGGGCTTCAAGGAGCAAATCCAGAACCAGCTCGACCATTTAAAA
AGAGTGAAAGATTTAAAGAAGAGACGTCGGGCCCAGGGGGAACAGGCACGAGCTGAACTCTTGAGCCTAACCCAGATGGAGAGGGAGAAG
ATTGTTTGGGAGTTTGAGCAGCTGTATCACTCCTTAAAGGAGCATGAGTATCGCCTCCTGGCCCGCCTTGAGGAGCTAGACTTGGCCATC
TACAATAGCATCAATGGTGCCATCACCCAGTTCTCTTGCAACATCTCCCACCTCAGCAGCCTGATCGCTCAGCTAGAAGAGAAGCAGCAG
CAGCCCACCAGGGAGCTCCTGCAGGACATTGGGGACACATTGAGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATT
GGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACC
AGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTG
TCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTC
TGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCAT
CCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGAC
TCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATT
ATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTT
TCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATC
AAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAG
AGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTAT
TTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTT
TTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCC
CATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAAT
AACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATGCAGCAATGTTGACTTTGTTTCATACTGCCAATAAACTCT


Top

FusionGenePPI for TRIM27_PTPRR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TRIM27FBF1, ZBTB16, BEGAIN, MAGEA11, DNMT1, FXYD6, MCOLN1, TRIM27, TRIM11, TRIM23, TRIM29, TRIM32, PRAM1, PML, EIF3E, MBD4, MBD2, MBD3, UBE2D1, UBE2D2, UBE2D3, UBE2H, UBE2K, UBE2T, UBE2A, UBE2D4, UBE2I, UBE2L6, UBE2J1, UBE2W, UBE2Z, UBE2O, UBE2U, TAL1, GTF2F1, MED21, FBXL19, HR, HDAC1, NFYC, CHD4, PIAS1, PIAS3, PIAS2, PIAS4, UBC, ATXN7, MDM2, TP53, MAGED4B, MAGEF1, MAGEL2, RB1, EID1, UBE2E1, UBE2E3, UBE2E2, UBE2N, NOD2, DAXX, CUL4B, CUL5, IKBKE, TBK1, CHUK, IKBKB, EPC1, GFI1B, UCHL3, UCHL5, USP2, USP7, OTUB2, PIK3C2B, PIK3C2A, TUBGCP4, HDAC6, RNF25, TRIM43, ARIH2, RBX1, TRIM31, UHRF2, TRIM9, TRAF5, TRIM21, BMI1, TRIM55, LATS2, ARNT2, DGCR6, EIF4E, IQCE, KIF1A, MVP, NDE1, PAX7, MYOD1, AES, BAG1, BMP7, BYSL, CKS1B, CLK2, CSRP2, DCX, DDX6, EHHADH, FHL3, FOXC2, GEM, GFAP, GRB2, ILK, KIFC3, LASP1, LMO1, MCM7, MOS, NEDD9, OAS1, CDK18, POLE2, PPID, PPL, PRKAA1, PSMA1, PSMB1, PSMB3, SDCBP, SRSF2, SIAH1, SNRPA, SNRPB2, TCEA2, TEAD4, TMSB4X, TMSB4XP6, TPM3, TUFT1, XPA, ZNF79, GPANK1, NELFE, ARHGEF5, NCK2, STK16, EIF3D, CDC23, RAB29, MTMR6, EIF4E2, BAG5, POLR1C, SPATA2, JOSD1, NR1D2, SORBS3, TXNDC9, MAD2L2, STK25, KAT5, NEBL, POLR3C, FARS2, NEK6, MID2, NUDT21, MAPKBP1, PTPN23, PRPF31, FOXB1, INPP5J, MAT2B, BABAM1, NME7, ARHGEF3, TPRKB, MEMO1, VPS28, CDKL3, SLC15A3, WT1-AS, AMOTL2, ZNF581, FBXW5, FAM64A, CCHCR1, FAM193B, KCTD9, CHCHD3, WDYHV1, RBM23, C14orf105, CCDC87, RBM41, ABCF3, TBC1D22B, ZNF446, CCDC94, RCOR3, USE1, FAM214A, LGALS14, CSRP2BP, GATAD2B, STAMBPL1, TSHZ3, RNF213, FANCM, ZNF250, DMRT3, SH2D4A, KIF9, AEN, MRPL40, SCNM1, C20orf195, ZFYVE21, LENG1, ARMC7, ZC2HC1C, CCDC102B, CCDC92, FAM214B, KIAA1683, NDEL1, PUS7L, FAM110A, FAM103A1, DTNBP1, PLEKHN1, SPATC1L, TCHP, UTP23, VPS25, GFM2, ZGPAT, BEX2, LINGO1, FAM83A, ATPAF2, RHPN1, PTPMT1, HAUS1, ZMYND19, GLYCTK, GNPDA2, ZNF572, SIRPA, CWF19L2, LINC00526, ZNF417, IQUB, RIBC1, CDC20B, PPP1R18, ZFC3H1, CPNE2, NEIL2, TTLL10, TSGA10IP, KANSL1, FAM126B, TRIM42, ARPIN, MIA3, NOTCH2NL, FLJ38668, BEND7, IDI2, SURF2, ZNF219, FAM170A, RAB11B, ZNF621, FOXD4L6, ARHGAP25, IER2, CEP162, LCA5, RPGRIP1L, ILF2, STK26, C1orf109, UBL5, NIF3L1, ABHD17A, KPNA1, RNF2, TCF20, TSNAX, USP11, CEP135, HMG20A, TINF2, RACGAP1, BCOR, SLAIN2, TCEAL4, ELMSAN1, C10orf2, GLI1, BAG6, RIPK1, LGALS3BP, GLTSCR2, IKZF5, MAP7D2, ZNF764, POTEB3, C1orf106, KRBA1, ZNF785, SMARCB1PTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TRIM27_PTPRR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TRIM27_PTPRR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePTPRRC0041696Unipolar Depression1PSYGENET
TgenePTPRRC1269683Major Depressive Disorder1PSYGENET