FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39398

FusionGeneSummary for TRAPPC2_ATP2B3

check button Fusion gene summary
Fusion gene informationFusion gene name: TRAPPC2_ATP2B3
Fusion gene ID: 39398
HgeneTgene
Gene symbol

TRAPPC2

ATP2B3

Gene ID

6399

492

Gene nametrafficking protein particle complex 2ATPase plasma membrane Ca2+ transporting 3
SynonymsMIP2A|SEDL|SEDT|TRAPPC2P1|TRS20|ZNF547L|hYP38334CFAP39|CLA2|OPCA|PMCA3|PMCA3a|SCAX1
Cytomap

Xp22.2

Xq28

Type of geneprotein-codingprotein-coding
Descriptiontrafficking protein particle complex subunit 2sedlinplasma membrane calcium-transporting ATPase 3ATPase, Ca++ transporting, plasma membrane 3cilia and flagella associated protein 39plasma membrane calcium ATPaseplasma membrane calcium pump
Modification date2018051920180523
UniProtAcc

P0DI81

Q16720

Ensembl transtripts involved in fusion geneENST00000359680, ENST00000453655, 
ENST00000380579, ENST00000358231, 
ENST00000458511, ENST00000519885, 
ENST00000349466, ENST00000370186, 
ENST00000393842, ENST00000359149, 
ENST00000263519, ENST00000370181, 
ENST00000460549, 
Fusion gene scores* DoF score3 X 2 X 3=181 X 1 X 1=1
# samples 42
** MAII scorelog2(4/18*10)=1.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/1*10)=4.32192809488736
Context

PubMed: TRAPPC2 [Title/Abstract] AND ATP2B3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTRAPPC2

GO:0006355

regulation of transcription, DNA-templated

11134351

TgeneATP2B3

GO:0051480

regulation of cytosolic calcium ion concentration

18029012

TgeneATP2B3

GO:1990034

calcium ion export across plasma membrane

18029012


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-TQ-A8XE-02ATRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
TCGARVLGGTCGA-TQ-A8XE-01ATRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000359680ENST00000349466TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
Frame-shitENST00000359680ENST00000370186TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000359680ENST00000393842TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000359680ENST00000359149TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000359680ENST00000263519TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000359680ENST00000370181TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000359680ENST00000460549TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
In-frameENST00000453655ENST00000349466TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
Frame-shitENST00000453655ENST00000370186TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000453655ENST00000393842TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000453655ENST00000359149TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000453655ENST00000263519TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000453655ENST00000370181TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000453655ENST00000460549TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
In-frameENST00000380579ENST00000349466TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
Frame-shitENST00000380579ENST00000370186TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000380579ENST00000393842TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000380579ENST00000359149TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000380579ENST00000263519TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000380579ENST00000370181TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000380579ENST00000460549TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
In-frameENST00000358231ENST00000349466TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
Frame-shitENST00000358231ENST00000370186TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000358231ENST00000393842TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000358231ENST00000359149TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000358231ENST00000263519TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000358231ENST00000370181TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000358231ENST00000460549TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
In-frameENST00000458511ENST00000349466TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
Frame-shitENST00000458511ENST00000370186TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000458511ENST00000393842TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000458511ENST00000359149TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000458511ENST00000263519TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000458511ENST00000370181TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000458511ENST00000460549TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
Frame-shitENST00000519885ENST00000349466TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
Frame-shitENST00000519885ENST00000370186TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000519885ENST00000393842TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000519885ENST00000359149TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000519885ENST00000263519TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000519885ENST00000370181TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+
5CDS-intronENST00000519885ENST00000460549TRAPPC2chrX

13737990

-ATP2B3chrX

152845436

+

Top

FusionProtFeatures for TRAPPC2_ATP2B3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TRAPPC2

P0DI81

ATP2B3

Q16720

Prevents transcriptional repression and induction ofcell death by ENO1 (By similarity). May play a role in vesiculartransport from endoplasmic reticulum to Golgi. {ECO:0000250}. This magnesium-dependent enzyme catalyzes the hydrolysisof ATP coupled with the transport of calcium out of the cell.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TRAPPC2_ATP2B3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TRAPPC2_ENST00000453655_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_138aa
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRA

>In-frame_TRAPPC2_ENST00000380579_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_138aa
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRA

>In-frame_TRAPPC2_ENST00000358231_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_138aa
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRA

>In-frame_TRAPPC2_ENST00000458511_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_172aa
MSSWKQDRSGLRSTELNVLEYQPLCAVRSHILKTMSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIH

>In-frame_TRAPPC2_ENST00000453655_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_138aa
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRA

>In-frame_TRAPPC2_ENST00000380579_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_138aa
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRA

>In-frame_TRAPPC2_ENST00000358231_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_138aa
MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRA

>In-frame_TRAPPC2_ENST00000458511_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_172aa
MSSWKQDRSGLRSTELNVLEYQPLCAVRSHILKTMSGSFYFVIVGHHDNPVFEMEFLPAGKAESKIRVVKAFRSSLTEGLEKPESKTSIH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TRAPPC2_ENST00000453655_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_414nt
ATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAATCC
AAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGGCC
ACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCC
CCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTTCA

>In-frame_TRAPPC2_ENST00000380579_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_414nt
ATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAATCC
AAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGGCC
ACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCC
CCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTTCA

>In-frame_TRAPPC2_ENST00000358231_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_414nt
ATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAATCC
AAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGGCC
ACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCC
CCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTTCA

>In-frame_TRAPPC2_ENST00000458511_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_516nt
ATGTCCTCTTGGAAGCAAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTGCTGTGAGGAGCCAT
ATATTGAAGACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGG
AAGGCAGAATCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCAC
AACTTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAG
CGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCA

>In-frame_TRAPPC2_ENST00000453655_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_414nt
ATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAATCC
AAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGGCC
ACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCC
CCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTTCA

>In-frame_TRAPPC2_ENST00000380579_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_414nt
ATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAATCC
AAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGGCC
ACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCC
CCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTTCA

>In-frame_TRAPPC2_ENST00000358231_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_414nt
ATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAATCC
AAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGGCC
ACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCC
CCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTTCA

>In-frame_TRAPPC2_ENST00000458511_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_516nt
ATGTCCTCTTGGAAGCAAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTGCTGTGAGGAGCCAT
ATATTGAAGACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGG
AAGGCAGAATCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCAC
AACTTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAG
CGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TRAPPC2_ENST00000453655_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_977nt
ACATCCCAGGGTATCGCGAGAACTGCTTCGGCGTTCTGGCTACAGGTTCGGGGCGCGGGTCTCTTCCGCGGAAACTGACATTGCGTTTCC
GTTGTCGGCCTCCCACTGCAGTATCACCTTCTCCCCCAAGTGTGACAACCAAAGATGTCTCCAGATATTGCCAGATGTCCTCTTGGAAGC
AAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTGCTGTGAGGTAAAGGAGCCATATATTGAAGA
CCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAAT
CCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGG
CCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGG
CCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTT
CAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTGTCTCAGCACATGCGCACACGCACA
CTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTGCAAAACGAGGGAACAACTAAGGTG
GCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCCACAGGCTCCTCATCCGGACTGAGG

>In-frame_TRAPPC2_ENST00000380579_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_898nt
ATTGCGTTTCCGTTGTCGGCCTCCCACTGCAGTATCACCTTCTCCCCCAAGTGTGACAACCAAAGATGTCTCCAGATATTGCCAGATGTC
CTCTTGGAAGCAAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTGCTGTGAGGTAAAGGAGCCA
TATATTGAAGACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGG
GAAGGCAGAATCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCA
CAACTTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGA
GCGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTC
AGCTACCTCTTCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTGTCTCAGCACATGC
GCACACGCACACTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTGCAAAACGAGGGAA
CAACTAAGGTGGCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCCACAGGCTCCTCAT

>In-frame_TRAPPC2_ENST00000358231_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_798nt
GGCTACAGGTTCGGGGCGCGGGTCTCTTCCGCGGAAACTGACATTGCGTTTCCGTTGTCGGCCTCCCACTGCAGGAGCCATATATTGAAG
ACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAA
TCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATG
GCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGG
GCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCT
TCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTGTCTCAGCACATGCGCACACGCAC
ACTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTGCAAAACGAGGGAACAACTAAGGT
GGCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCCACAGGCTCCTCATCCGGACTGAG

>In-frame_TRAPPC2_ENST00000458511_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_911nt
CTCTTCCGCGGAAACTGACATTGCGTTTCCGTTGTCGGCCTCCCACTGCAGTATCACCTTCTCCCCCAAGTGTGACAACCAAAGATGTCT
CCAGATATTGCCAGATGTCCTCTTGGAAGCAAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTG
CTGTGAGGAGCCATATATTGAAGACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGT
TTTTGCCAGCTGGGAAGGCAGAATCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCA
AGACCTCCATTCACAACTTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGG
ACGAGAACGAGGAGCGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGC
ATGTCACCAAGTCAGCTACCTCTTCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTG
TCTCAGCACATGCGCACACGCACACTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTG
CAAAACGAGGGAACAACTAAGGTGGCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCC
ACAGGCTCCTCATCCGGACTGAGGAAGACGAGGACAGGGAGGAGGAAAAGGAGGAAGAGGAGGACAAAAAGGGGGAGGAGAAGGTTCTTC

>In-frame_TRAPPC2_ENST00000453655_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_977nt
ACATCCCAGGGTATCGCGAGAACTGCTTCGGCGTTCTGGCTACAGGTTCGGGGCGCGGGTCTCTTCCGCGGAAACTGACATTGCGTTTCC
GTTGTCGGCCTCCCACTGCAGTATCACCTTCTCCCCCAAGTGTGACAACCAAAGATGTCTCCAGATATTGCCAGATGTCCTCTTGGAAGC
AAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTGCTGTGAGGTAAAGGAGCCATATATTGAAGA
CCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAAT
CCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATGG
CCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGG
CCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCTT
CAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTGTCTCAGCACATGCGCACACGCACA
CTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTGCAAAACGAGGGAACAACTAAGGTG
GCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCCACAGGCTCCTCATCCGGACTGAGG

>In-frame_TRAPPC2_ENST00000380579_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_898nt
ATTGCGTTTCCGTTGTCGGCCTCCCACTGCAGTATCACCTTCTCCCCCAAGTGTGACAACCAAAGATGTCTCCAGATATTGCCAGATGTC
CTCTTGGAAGCAAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTGCTGTGAGGTAAAGGAGCCA
TATATTGAAGACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGG
GAAGGCAGAATCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCA
CAACTTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGA
GCGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTC
AGCTACCTCTTCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTGTCTCAGCACATGC
GCACACGCACACTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTGCAAAACGAGGGAA
CAACTAAGGTGGCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCCACAGGCTCCTCAT

>In-frame_TRAPPC2_ENST00000358231_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_798nt
GGCTACAGGTTCGGGGCGCGGGTCTCTTCCGCGGAAACTGACATTGCGTTTCCGTTGTCGGCCTCCCACTGCAGGAGCCATATATTGAAG
ACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGTTTTTGCCAGCTGGGAAGGCAGAA
TCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAACTTCATG
GCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGGACGAGAACGAGGAGCGCCTCCGG
GCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCTACCTCT
TCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTGTCTCAGCACATGCGCACACGCAC
ACTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTGCAAAACGAGGGAACAACTAAGGT
GGCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCCACAGGCTCCTCATCCGGACTGAG

>In-frame_TRAPPC2_ENST00000458511_chrX_13737990_-_ATP2B3_ENST00000349466_chrX_152845436_+_911nt
CTCTTCCGCGGAAACTGACATTGCGTTTCCGTTGTCGGCCTCCCACTGCAGTATCACCTTCTCCCCCAAGTGTGACAACCAAAGATGTCT
CCAGATATTGCCAGATGTCCTCTTGGAAGCAAGATCGCTCCGGGTTGAGATCCACAGAGCTAAACGTTTTAGAGTACCAACCATTGTGTG
CTGTGAGGAGCCATATATTGAAGACCATGTCTGGGAGCTTCTACTTTGTAATTGTTGGCCACCATGATAATCCAGTTTTTGAAATGGAGT
TTTTGCCAGCTGGGAAGGCAGAATCCAAAATCCGGGTGGTGAAAGCGTTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCA
AGACCTCCATTCACAACTTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGACGACACGGACGTGG
ACGAGAACGAGGAGCGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAACCAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGC
ATGTCACCAAGTCAGCTACCTCTTCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTCTAACAAGAACTTG
TCTCAGCACATGCGCACACGCACACTCGGACTCACACGAAGTCACACGCACACATGCACGCACACACACATATGGGGACCTGCACACCTG
CAAAACGAGGGAACAACTAAGGTGGCTGAAGACCTTTCTGGCAGGGCATTTGCAAGGACCCAAATCCATTCAACAAGGGTGCAGCCTGCC
ACAGGCTCCTCATCCGGACTGAGGAAGACGAGGACAGGGAGGAGGAAAAGGAGGAAGAGGAGGACAAAAAGGGGGAGGAGAAGGTTCTTC


Top

FusionGenePPI for TRAPPC2_ATP2B3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TRAPPC2CLIC1, CLIC2, ENO1, JOSD2, ELAVL1, TRAPPC8, TRAPPC10, TRAPPC9, TRAPPC12, TRAPPC11, TRAPPC3, TRAPPC3L, TRAPPC4, TRAPPC5, TRAPPC6A, TRAPPC6B, PITX1, NR5A1, TRAPPC2, MBL2, BCL2L14, DNASE2B, CABS1, PRMT2, CRYAB, TRAPPC1, TRAPPC2L, TRAPPC13, C7orf43, KANK4, STMN4, TBC1D14, TMPRSS11B, ZBED1, RNF19B, TRMT61B, GLB1, PCDH20ATP2B3TERF2, PARK2, LGR4, PNPLA4, CD27, CTDSP2, CD1B, TSPAN5, DGUOK, LGALS8, PRKAG1, CSGALNACT1, HSD17B6, AGTR1, PTGFR, TXNDC15, SLAMF1, P2RY8, HM13, UBE2N, CANX, CLGN, COX2, FOXR1, FAF2, ATP2B2, RANBP6, LILRB4, FPR2, GALNT6, IPPK, CYP2B6, C3AR1, S1PR1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TRAPPC2_ATP2B3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TRAPPC2_ATP2B3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTRAPPC2C3541456Spondyloepiphyseal Dysplasia Tarda, X-Linked2ORPHANET;UNIPROT
TgeneATP2B3C0001430Adenoma1CTD_human
TgeneATP2B3C0020428Hyperaldosteronism1CTD_human
TgeneATP2B3C0020538Hypertensive disease1CTD_human
TgeneATP2B3C0796205SPINOCEREBELLAR ATAXIA, X-LINKED 11UNIPROT