FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39234

FusionGeneSummary for TPM3_GPR37L1

check button Fusion gene summary
Fusion gene informationFusion gene name: TPM3_GPR37L1
Fusion gene ID: 39234
HgeneTgene
Gene symbol

TPM3

GPR37L1

Gene ID

7170

9283

Gene nametropomyosin 3G protein-coupled receptor 37 like 1
SynonymsCAPM1|CFTD|HEL-189|HEL-S-82p|NEM1|OK/SW-cl.5|TM-5|TM3|TM30|TM30nm|TM5|TPM3nu|TPMsk3|TRK|hscp30ET(B)R-LP-2|ETBR-LP-2|ETBRLP2
Cytomap

1q21.3

1q32.1

Type of geneprotein-codingprotein-coding
Descriptiontropomyosin alpha-3 chainalpha-tropomyosin, slow skeletalcytoskeletal tropomyosin TM30epididymis luminal protein 189epididymis secretory sperm binding protein Li 82pheat-stable cytoskeletal protein 30 kDatropomyosin 3 nutropomyosin gammatropomyosiprosaposin receptor GPR37L1endothelin B receptor-like protein 2endothelin type b receptor-like protein 2
Modification date2018052320180520
UniProtAcc

P06753

O60883

Ensembl transtripts involved in fusion geneENST00000368533, ENST00000469717, 
ENST00000330188, ENST00000341485, 
ENST00000341372, ENST00000328159, 
ENST00000271850, ENST00000302206, 
ENST00000368531, ENST00000323144, 
ENST00000368530, 
ENST00000367282, 
Fusion gene scores* DoF score7 X 6 X 6=2528 X 2 X 6=96
# samples 149
** MAII scorelog2(14/252*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/96*10)=-0.0931094043914815
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TPM3 [Title/Abstract] AND GPR37L1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneGPR37L1

GO:0007193

adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway

23690594

TgeneGPR37L1

GO:0043410

positive regulation of MAPK cascade

23690594


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-25-2409-01ATPM3chr1

154142876

-GPR37L1chr1

202096869

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368533ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
5UTR-3CDSENST00000469717ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000330188ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000341485ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000341372ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000328159ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000271850ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
Frame-shitENST00000302206ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000368531ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000323144ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+
In-frameENST00000368530ENST00000367282TPM3chr1

154142876

-GPR37L1chr1

202096869

+

Top

FusionProtFeatures for TPM3_GPR37L1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TPM3

P06753

GPR37L1

O60883

Receptor for the neuroprotective and glioprotectivefactor prosaposin. Ligand binding induces endocytosis, followed byan ERK phosphorylation cascade. {ECO:0000269|PubMed:23690594}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02418_439210482Compositional biasNote=Cys-rich
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02227_251210482Topological domainCytoplasmic
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02273_310210482Topological domainExtracellular
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02332_361210482Topological domainCytoplasmic
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02383_398210482Topological domainExtracellular
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02420_481210482Topological domainCytoplasmic
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02252_272210482TransmembraneHelical%3B Name%3D4
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02311_331210482TransmembraneHelical%3B Name%3D5
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02362_382210482TransmembraneHelical%3B Name%3D6
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02399_419210482TransmembraneHelical%3B Name%3D7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTPM3chr1:154142876chr1:202096869ENST00000323144-781_285221248Coiled coilOntology_term=ECO:0000250
HgeneTPM3chr1:154142876chr1:202096869ENST00000330188-781_285221249Coiled coilOntology_term=ECO:0000250
HgeneTPM3chr1:154142876chr1:202096869ENST00000368530-8101_285258286Coiled coilOntology_term=ECO:0000250
HgeneTPM3chr1:154142876chr1:202096869ENST00000368531-781_285221248Coiled coilOntology_term=ECO:0000250
HgeneTPM3chr1:154142876chr1:202096869ENST00000368533-781_285221249Coiled coilOntology_term=ECO:0000250
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02156_167210482Topological domainCytoplasmic
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02189_205210482Topological domainExtracellular
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+0226_134210482Topological domainExtracellular
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02135_155210482TransmembraneHelical%3B Name%3D1
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02168_188210482TransmembraneHelical%3B Name%3D2
TgeneGPR37L1chr1:154142876chr1:202096869ENST00000367282+02206_226210482TransmembraneHelical%3B Name%3D3


Top

FusionGeneSequence for TPM3_GPR37L1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TPM3_ENST00000368533_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_493aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERG
MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPLCPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGL
HDAGCA_APAVAAGTGACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVVVLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQ
ARAV_EPAQQHRGGPDRGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQPVLHLLQGRHHPSAAPLHLQAAGPGLPGLLLLLLL_GV

>In-frame_TPM3_ENST00000330188_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_493aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERG
MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQ
KEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPLCPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGL
HDAGCA_APAVAAGTGACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVVVLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQ
ARAV_EPAQQHRGGPDRGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQPVLHLLQGRHHPSAAPLHLQAAGPGLPGLLLLLLL_GV

>In-frame_TPM3_ENST00000341485_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_477aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADEEKME
LQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKTEEEIKILTDKL
KEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPLCPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGLHDAGCA_APAVAAGTG
ACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVVVLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQARAV_EPAQQHRGGPD
RGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQPVLHLLQGRHHPSAAPLHLQAAGPGLPGLLLLLLL_GVRRGFGGLCCQWVGQQA

>In-frame_TPM3_ENST00000341372_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_468aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGESRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEA
KHIAEEADRKTEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKTEEEIKILTDKLKEAETRAEF
AERSVAKLEKTIDDLEGLLSGSHDFQPLCPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGLHDAGCA_APAVAAGTGACPHHGHPG
LMHHETLSQPARVPVFTGDDLPERPHVVVLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQARAV_EPAQQHRGGPDRGLRLLHPP
RERLQHRGGLPLHRADPPDPGPPGPHQPVLHLLQGRHHPSAAPLHLQAAGPGLPGLLLLLLL_GVRRGFGGLCCQWVGQQAQDRGVLFHL

>In-frame_TPM3_ENST00000328159_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_493aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERG
MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPLCPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGL
HDAGCA_APAVAAGTGACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVVVLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQ
ARAV_EPAQQHRGGPDRGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQPVLHLLQGRHHPSAAPLHLQAAGPGLPGLLLLLLL_GV

>In-frame_TPM3_ENST00000271850_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_530aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKTSEALKDAQEKLELAEKKAADAEAEVASLN
RRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERT
EERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPL
CPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGLHDAGCA_APAVAAGTGACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVV
VLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQARAV_EPAQQHRGGPDRGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQP

>In-frame_TPM3_ENST00000368531_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_493aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERG
MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPLCPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGL
HDAGCA_APAVAAGTGACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVVVLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQ
ARAV_EPAQQHRGGPDRGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQPVLHLLQGRHHPSAAPLHLQAAGPGLPGLLLLLLL_GV

>In-frame_TPM3_ENST00000323144_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_493aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERG
MKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQ
KEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPLCPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGL
HDAGCA_APAVAAGTGACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVVVLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQ
ARAV_EPAQQHRGGPDRGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQPVLHLLQGRHHPSAAPLHLQAAGPGLPGLLLLLLL_GV

>In-frame_TPM3_ENST00000368530_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_530aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKTSEALKDAQEKLELAEKKAADAEAEVASLN
RRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEGLLSGSHDFQPL
CPGH_PLPRGHQHPAQGEAHRAVPIHPGQVGCHLGGLHDAGCA_APAVAAGTGACPHHGHPGLMHHETLSQPARVPVFTGDDLPERPHVV
VLWLLLLPAHPLHSHLPAGDMAGARPSREEVRVQGQQARAV_EPAQQHRGGPDRGLRLLHPPRERLQHRGGLPLHRADPPDPGPPGPHQP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TPM3_ENST00000368533_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1480nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAA
GAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGT
ATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAA
GAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCA
GAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAA
AAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTA
GCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTT
CCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTC
CATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAA
ACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTG
CCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAA
GCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAA
CATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGG
CGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTG
CGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAG

>In-frame_TPM3_ENST00000330188_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1480nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAA
GAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGT
ATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAA
GAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCA
GAGTCTAAGTGTTCTGAGCTGGAGGAGGAGCTGAAGAATGTCACCAACAACCTCAAGTCTCTTGAGGCTCAGGCGGAGAAGTACTCTCAA
AAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTA
GCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTT
CCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTC
CATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAA
ACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTG
CCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAA
GCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAA
CATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGG
CGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTG
CGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAG

>In-frame_TPM3_ENST00000341485_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1432nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAA
GAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAAGAAAAGATGGAA
CTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATT
GAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAG
AACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTC
AAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGG
AGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTG
CCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGA
GCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTA
CCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGT
GCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGAC
CGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGA
CCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCA
GGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCT

>In-frame_TPM3_ENST00000341372_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1405nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGCCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGAT
GAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCT
AAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAA
CGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAA
GAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTT
GCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCT
GGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGT
CATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGA
CTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTT
TGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGA
GTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCC
AGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTC
CACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTG
CTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTA

>In-frame_TPM3_ENST00000328159_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1480nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAA
GAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGT
ATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAA
GAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCA
GAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAA
AAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTA
GCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTT
CCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTC
CATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAA
ACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTG
CCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAA
GCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAA
CATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGG
CGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTG
CGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAG

>In-frame_TPM3_ENST00000271850_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1591nt
ATGATGGAGGCCATCAAGAAAAAGATGCAGATGCTGAAGTTAGACAAGGAGAATGCTCTGGATCGGGCAGAGCAAGCTGAAGCTGAGCAG
AAGCAGGCAGAAGAAAGAAGTAAACAGCTGGAGGATGAGCTGGCAGCCATGCAGAAGAAGCTGAAAGGGACAGAGGATGAGCTGGACAAG
TATTCTGAAGCTTTGAAGGATGCCCAGGAGAAGCTGGAACTGGCAGAGAAGAAGGCTGCTGATGCTGAGGCTGAGGTGGCCTCCTTGAAC
CGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCT
GCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAA
GAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACA
GAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCT
GCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCT
GAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTG
TGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTT
GGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCAC
CCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTG
GTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAA
GTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCAC
CCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCA
GTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTG
CTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTC

>In-frame_TPM3_ENST00000368531_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1480nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAA
GAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGT
ATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAA
GAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCA
GAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAA
AAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTA
GCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTT
CCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTC
CATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAA
ACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTG
CCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAA
GCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAA
CATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGG
CGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTG
CGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAG

>In-frame_TPM3_ENST00000323144_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1480nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAA
GAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGT
ATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAA
GAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCA
GAGTCTAAGTGTTCTGAGCTGGAGGAGGAGCTGAAGAATGTCACCAACAACCTCAAGTCTCTTGAGGCTCAGGCGGAGAAGTACTCTCAA
AAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTA
GCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTT
CCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTC
CATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAA
ACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTG
CCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAA
GCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAA
CATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGG
CGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTG
CGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAG

>In-frame_TPM3_ENST00000368530_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_1591nt
ATGATGGAGGCCATCAAGAAAAAGATGCAGATGCTGAAGTTAGACAAGGAGAATGCTCTGGATCGGGCAGAGCAAGCTGAAGCTGAGCAG
AAGCAGGCAGAAGAAAGAAGTAAACAGCTGGAGGATGAGCTGGCAGCCATGCAGAAGAAGCTGAAAGGGACAGAGGATGAGCTGGACAAG
TATTCTGAAGCTTTGAAGGATGCCCAGGAGAAGCTGGAACTGGCAGAGAAGAAGGCTGCTGATGCTGAGGCTGAGGTGGCCTCCTTGAAC
CGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCT
GCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAA
GAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACA
GAGGAACGAGCTGAGCTGGCAGAGTCTAAGTGTTCTGAGCTGGAGGAGGAGCTGAAGAATGTCACCAACAACCTCAAGTCTCTTGAGGCT
CAGGCGGAGAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCT
GAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTG
TGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTT
GGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCAC
CCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTG
GTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAA
GTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCAC
CCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCA
GTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTG
CTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_TPM3_ENST00000368533_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6569nt
CGCCGAGCGGAGGAGGCAGGAACCGGAGCGCGAGCAGTAGCTGGGTGGGCACCATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCA
AGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGCCTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGG
AACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTG
CCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAG
AAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGT
TGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGAC
TGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTA
CTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTC
TCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCC
ATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAG
CTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTG
GTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTG
ACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTG
GTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGC
CAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGG
CCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCG
GACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAGGGAGTCACCCCCACTCCTGCCCCTGGGCACACCTTGC
TGAGGCCCCAGTAGGGGTGGGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTGTCTGCTGTTCTTTCCCCATAGGTCTTGCTTTGTTGCC
TGTCTTGCTGTCTAGGGATGGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGTCAAAGCCCCCTCCCCACACAGGGCCTTTCCTGTCCCT
TGTGGGGCCTTCCAACCCTGTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGGTCCTTAGAACTGCCCAGAAACTCTGAGTCCCAGCAGC
TGGGAGCCAGAACTTTGCCTGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTCTCTGCCTTGGAACCTGACCATACTTTAGTTGTGCCCT
TCCCAGGCATCATCCTCCTACCACCAACCTGGGGCCCCATCTTGGAATGGGGGCTCCTTGGGGCCAGCCCAGTGTGGCTCACCACACTCT
TCTTTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCTGGAGTACATTTGCCTGATGTCAGCTCCCTGCAACCTC
CGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGTGCACCAACACACCCGGCTAATTTTTGTA
TTTGTAGAAGAGGCGGGGTTTCACCATGTTGGCCAGGCTGGTGTTGAACTCCTGACCTCAAGTGATCTGCCTGCCTTGGCCTCCCAAAGT
GCTGGGATTACAGGTGTGAGCTGCCACGCCCAGCCCCAGTACACTCTTCTCTGGACCAGATCTGTCCCAGTCCTGGATGCCTCCTCCTAC
TGGTGCCTTCTTTTCTTCCAGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTTGGGATCCCTGGGTTGCCCTGTCCCAACCTCCTTGTTA
GGTGCTTTCCCATAGGAGGCCCTTCTTGAGAAACAATAAACTAGGTAGAACTACCCCTATGCCCATCCACTTTCTTGTGCCACATTCTGG
CAGGGCCCAGATGCAGCTGGGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTTCTCCTGACCTGGCCTGGCCTGTGGCTGATGTTCAGAA
CAGCCTTGTGGCCGATGTTCAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGGTTTTATGGCTTTTGAGGGACAGAGAGGATGGAGGGCT
TGGGGAGCCGGAGGACCTAAGTCCTCATCCTGGCCTAAACCCCATGCTCCTTGGGAAGTCAAAAGCCTGGAAAATATCTCCTCTGGAGCC
TTCATCTCTGCTATGCCCTCTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGTGGTCTTTCCTCTGTGAGCCCCAGGGCTTCCCAGCCTT
TGTCACTCTGAGAGCTGCTCTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCTGTAGACGGCCCAGCTGCCTGCCCTGGCCTGCCCCCAC
CCAGCCCCCACTGCACCACCCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGACCCTTCATGCAGCTTCTCCTGTGGGGTCTTGCCCTTG
AAGTGCCACTTCCCCCAGCCCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAGCCTTGTAGGTCCCTGGGAAGCTGGCACAGCATCAACC
AGAAGTGATGCCTCAGCCAGGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCTTTCCTCAGAACCACCCCCCCTGTCTGAAGCTCTGTCC
TGGGTCCCACCAGACTTCTGCCCACCAGGCCTACCTACAGCATCCACATGGGGCCTCAGGAAGGGCCCCGGGGGCCCAGGGATGGGCAGG
GGCAGGGTTTCCAAGCGCCTGGGGCTCCATTCTCCTCTGTCCACCCACCCACACCCCTTGGCCTCAGCCTGCCCTGTACCCAAGCTTCCC
TCCCCCTCTCCTGGGGATCTTAACGGCCTTGTTCTCTCTCCCTGGCACCCACCCCCAGGGCGGGTGATGCCGCCAAGAGAGAGGGAGGCC
GTTGCTAGGTGATGGCGCCGCCATGCACACACCCTTTGTGCTGGGGAGTGACACCCACCCGTTTCTCAGCAGACCTGTTGCCACGGTGAC
TGAAGCCCCCAGCTCTGTCTGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTGGAGAGGGGACCAAAGGCAGGCCTGTCGTGCTGAAGCT
CTTGGGGACCGTTTCCTCGGCATTTCCCCAACTCCTTCTCCACCCCCCTGCCAGGCCCGGAAGTACCACCAGCTTCCTAAGGGATGCAGG
AAGGGGCCGGGTGAACTGAGGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCAACATCCTGTTTAGGGGTCCTCCTCCACAAAGGGTGCC
CTCCACCTCTCCCTCCTGCTGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGATGGTGGCTCCAAGGCTCTGCCACCGCCACCTCCCAAGC
CTGCCAACGTGAATGGCTTGCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAAAGAGCCACTGTCCTCGCAGCCTGGGCCAGCTGGGGGA
ACAATGTAGGGTTTGTTGCTTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACATGGTGGGCAGTGGACTTGAGCTGGGATGGTCTGAGGG
GGCACTGACACGCTCACCCGAGGGCAGACTTCAGACCAGCCCTCAGATCCTGATGCCAGGTTACAGGGCTGAGGGGAGCCTGAAATCCAC
TGGGTCTCCCTGCTCCACTTGGGAGTCACCTTCTCATCACCTATCCTGGAACTGAATGCAATTACTTAAACTCAGTCTCAGCTTCCTCAT
CTGTAAAATGGGAATAATCTGTCCTTCACAGAGGATTATGGTCATTTAATGAGACAAGATACATAAAGCACTTTGCATGGTGCCCCGAAC
CTTTTATTCCTTCCTCTCCTTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGGCTTGGCCCAGGGATTCTTAAATGCATCCAGGTTTTGG
CATCAAAGGGCCCCAAACATGACAATTTACCTATACTCATGGTCTGTTCCCATTCAACTTTAATAGGTTATGTGTGTTTTTTTTTTCTTA
AGAGCTGGGTGGGGGGGTCTCACTATGTTGCCCAGGCTGGCTTTGAACTCCTGGGCTCAAGCAGTCCTCCTGTCTCAGCCTCCTGAGTAG
CTGGGACTACAAGTGTGTACCACCATGCCTGGCTGAACACTTTTTTTTTTTTGAGACAAGATCCCACTCAGTCACTCAAGCTGAGTGCTG
TGGTGTGATCACAGCTCATTGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTCCTGCCTCAGCTTCCTGAGTAGCTGGGACTACAGGTGC
GCACTACCACGCCTGTCTAATTTTTGATTATTTGTAGAGATAGGGTCTCACTATTTTGCCCAGGCTGGTCTCAAACTCCCAGACTCAAGT
CATTCTCCTACCTCGGGCTCCCAAAGTACTGGGATTACAGGCATGAGCACCTGGCCCCTGAACAAATTCTTTAAGTCATATTAGCACCTG
CTGCACGCCGGCACTGTGGAAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGCTCTCTTATCTCAAACCTCAATCCTCAGTGAGGATCAC
AGGATCTGAGAAAGGCACCTTGGCCTGGAAACAGCCCCAGATGAGTGAGATTGCTGGTCCTCTCCCGGGATCCCAGGCCCAGGAAAACCT
AGCCATGCTTGCAGTCAGGAGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCAACCTCCTTAGCCAGGAGGACATGTCCCATTTTGCTTA
GGAGTTGGGAGGTACCCTAGAATCACTTAGCTTCAGATGCCAAATTCCATCCACATTCTTTCCTCCAACTCTCTGGCAGTGGGGAACTGC
CTCTCCAGGCAGGGAACTGCTCTGACAGGTCTGATGACTGCCTCCAGGAGGAAGCCCTGGGCACCAATGAAGGTGAGGGGCTGGAGGGCC
CAGGACGGGGAGTCAAGGTCCCCACTCCCAGGACTAAGGGACAGTTTGGCTCCTTTTTCCTGCAGTGGGAGGGGTGAGAAGGGCTGGGGT
GTTCTGCAAGGGCCTGCTCCATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGTGGAGCGGGAGGAGGTGGGGCTTACTGTGAAACTGGGT
CAAGATGGCCTCGGATTTGAGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGCTGTGAGCAGTGCCGAGGGAGGACCAGCTCTGACGGTG
AGGTCGGGTGGGGGACTAGAATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACCAGGAAACCCATAGCATTGACACTAACTGAGAGGCAGC
AAAGGCGGTGACACTCCCCCAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCACAGTTAACTGGTTCTGGGGTAGGAACTGGGGGCCGGA
GGGACAGGGTTCTGGTTCTGGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCCTGGGAAAGAGGGGCTGAGGCCTGAACTGGGCCTAAGG
AGAGTGCAGCTCAGTTCGCACACAACAGCACCCAGCCCTGTCCCCTTGCTGCCTCTACCCAGCCCTGGGCAGTTCCCTCAACAGAGCTCT
GCAGCCCCAAGTGGCAGCTGCTGGCTCAAAGCTGGGACTACATGAAAGTCTGAAAAGAGAATGAGAAGGAGGTGGCGCAAGAGCCTGGAC
GCACGTGTGGGAGGCCGTTTTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCATGTGCTCGCGCTCCGTGGCTCTGTTGGTGCCCAGCGTG
CGGGGGTGTGCTGGTGGCCCTGTGGGCCTGTAGGGCAACCCATGCCAACTGCGGAAAAGTAACCAGCACCATACACCCCCCCCAACACAA
AACTGGTCATTTATTTTTTTTGTTGTCATTGTTATTAGGAAGCAAAAAAATGTACAGTTACAAGAATCATTTTCCAAACAGAGGTTAAAT

>In-frame_TPM3_ENST00000330188_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6602nt
GCAGGCGGAAGTAAGGGTGAGAGGAGGCTGCAACGCCGAGCGGAGGAGGCAGGAACCGGAGCGCGAGCAGTAGCTGGGTGGGCACCATGG
CTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGCCTCC
AGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAG
AGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGA
AGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGG
CAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGT
CTAAGTGTTCTGAGCTGGAGGAGGAGCTGAAGAATGTCACCAACAACCTCAAGTCTCTTGAGGCTCAGGCGGAGAAGTACTCTCAAAAAG
AAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCA
AGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCAC
GTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATG
ACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAAACCC
TCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTG
CCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCAC
GAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATC
GTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCC
ATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGC
GGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAGGGAG
TCACCCCCACTCCTGCCCCTGGGCACACCTTGCTGAGGCCCCAGTAGGGGTGGGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTGTCTG
CTGTTCTTTCCCCATAGGTCTTGCTTTGTTGCCTGTCTTGCTGTCTAGGGATGGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGTCAAA
GCCCCCTCCCCACACAGGGCCTTTCCTGTCCCTTGTGGGGCCTTCCAACCCTGTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGGTCCT
TAGAACTGCCCAGAAACTCTGAGTCCCAGCAGCTGGGAGCCAGAACTTTGCCTGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTCTCTG
CCTTGGAACCTGACCATACTTTAGTTGTGCCCTTCCCAGGCATCATCCTCCTACCACCAACCTGGGGCCCCATCTTGGAATGGGGGCTCC
TTGGGGCCAGCCCAGTGTGGCTCACCACACTCTTCTTTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCTGGAG
TACATTTGCCTGATGTCAGCTCCCTGCAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACA
GGTGTGCACCAACACACCCGGCTAATTTTTGTATTTGTAGAAGAGGCGGGGTTTCACCATGTTGGCCAGGCTGGTGTTGAACTCCTGACC
TCAAGTGATCTGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGTGTGAGCTGCCACGCCCAGCCCCAGTACACTCTTCTCTGGACC
AGATCTGTCCCAGTCCTGGATGCCTCCTCCTACTGGTGCCTTCTTTTCTTCCAGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTTGGGA
TCCCTGGGTTGCCCTGTCCCAACCTCCTTGTTAGGTGCTTTCCCATAGGAGGCCCTTCTTGAGAAACAATAAACTAGGTAGAACTACCCC
TATGCCCATCCACTTTCTTGTGCCACATTCTGGCAGGGCCCAGATGCAGCTGGGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTTCTCC
TGACCTGGCCTGGCCTGTGGCTGATGTTCAGAACAGCCTTGTGGCCGATGTTCAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGGTTTT
ATGGCTTTTGAGGGACAGAGAGGATGGAGGGCTTGGGGAGCCGGAGGACCTAAGTCCTCATCCTGGCCTAAACCCCATGCTCCTTGGGAA
GTCAAAAGCCTGGAAAATATCTCCTCTGGAGCCTTCATCTCTGCTATGCCCTCTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGTGGTC
TTTCCTCTGTGAGCCCCAGGGCTTCCCAGCCTTTGTCACTCTGAGAGCTGCTCTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCTGTAG
ACGGCCCAGCTGCCTGCCCTGGCCTGCCCCCACCCAGCCCCCACTGCACCACCCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGACCCT
TCATGCAGCTTCTCCTGTGGGGTCTTGCCCTTGAAGTGCCACTTCCCCCAGCCCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAGCCTT
GTAGGTCCCTGGGAAGCTGGCACAGCATCAACCAGAAGTGATGCCTCAGCCAGGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCTTTCC
TCAGAACCACCCCCCCTGTCTGAAGCTCTGTCCTGGGTCCCACCAGACTTCTGCCCACCAGGCCTACCTACAGCATCCACATGGGGCCTC
AGGAAGGGCCCCGGGGGCCCAGGGATGGGCAGGGGCAGGGTTTCCAAGCGCCTGGGGCTCCATTCTCCTCTGTCCACCCACCCACACCCC
TTGGCCTCAGCCTGCCCTGTACCCAAGCTTCCCTCCCCCTCTCCTGGGGATCTTAACGGCCTTGTTCTCTCTCCCTGGCACCCACCCCCA
GGGCGGGTGATGCCGCCAAGAGAGAGGGAGGCCGTTGCTAGGTGATGGCGCCGCCATGCACACACCCTTTGTGCTGGGGAGTGACACCCA
CCCGTTTCTCAGCAGACCTGTTGCCACGGTGACTGAAGCCCCCAGCTCTGTCTGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTGGAGA
GGGGACCAAAGGCAGGCCTGTCGTGCTGAAGCTCTTGGGGACCGTTTCCTCGGCATTTCCCCAACTCCTTCTCCACCCCCCTGCCAGGCC
CGGAAGTACCACCAGCTTCCTAAGGGATGCAGGAAGGGGCCGGGTGAACTGAGGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCAACAT
CCTGTTTAGGGGTCCTCCTCCACAAAGGGTGCCCTCCACCTCTCCCTCCTGCTGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGATGGTG
GCTCCAAGGCTCTGCCACCGCCACCTCCCAAGCCTGCCAACGTGAATGGCTTGCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAAAGAG
CCACTGTCCTCGCAGCCTGGGCCAGCTGGGGGAACAATGTAGGGTTTGTTGCTTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACATGGT
GGGCAGTGGACTTGAGCTGGGATGGTCTGAGGGGGCACTGACACGCTCACCCGAGGGCAGACTTCAGACCAGCCCTCAGATCCTGATGCC
AGGTTACAGGGCTGAGGGGAGCCTGAAATCCACTGGGTCTCCCTGCTCCACTTGGGAGTCACCTTCTCATCACCTATCCTGGAACTGAAT
GCAATTACTTAAACTCAGTCTCAGCTTCCTCATCTGTAAAATGGGAATAATCTGTCCTTCACAGAGGATTATGGTCATTTAATGAGACAA
GATACATAAAGCACTTTGCATGGTGCCCCGAACCTTTTATTCCTTCCTCTCCTTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGGCTTG
GCCCAGGGATTCTTAAATGCATCCAGGTTTTGGCATCAAAGGGCCCCAAACATGACAATTTACCTATACTCATGGTCTGTTCCCATTCAA
CTTTAATAGGTTATGTGTGTTTTTTTTTTCTTAAGAGCTGGGTGGGGGGGTCTCACTATGTTGCCCAGGCTGGCTTTGAACTCCTGGGCT
CAAGCAGTCCTCCTGTCTCAGCCTCCTGAGTAGCTGGGACTACAAGTGTGTACCACCATGCCTGGCTGAACACTTTTTTTTTTTTGAGAC
AAGATCCCACTCAGTCACTCAAGCTGAGTGCTGTGGTGTGATCACAGCTCATTGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTCCTGC
CTCAGCTTCCTGAGTAGCTGGGACTACAGGTGCGCACTACCACGCCTGTCTAATTTTTGATTATTTGTAGAGATAGGGTCTCACTATTTT
GCCCAGGCTGGTCTCAAACTCCCAGACTCAAGTCATTCTCCTACCTCGGGCTCCCAAAGTACTGGGATTACAGGCATGAGCACCTGGCCC
CTGAACAAATTCTTTAAGTCATATTAGCACCTGCTGCACGCCGGCACTGTGGAAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGCTCTC
TTATCTCAAACCTCAATCCTCAGTGAGGATCACAGGATCTGAGAAAGGCACCTTGGCCTGGAAACAGCCCCAGATGAGTGAGATTGCTGG
TCCTCTCCCGGGATCCCAGGCCCAGGAAAACCTAGCCATGCTTGCAGTCAGGAGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCAACCT
CCTTAGCCAGGAGGACATGTCCCATTTTGCTTAGGAGTTGGGAGGTACCCTAGAATCACTTAGCTTCAGATGCCAAATTCCATCCACATT
CTTTCCTCCAACTCTCTGGCAGTGGGGAACTGCCTCTCCAGGCAGGGAACTGCTCTGACAGGTCTGATGACTGCCTCCAGGAGGAAGCCC
TGGGCACCAATGAAGGTGAGGGGCTGGAGGGCCCAGGACGGGGAGTCAAGGTCCCCACTCCCAGGACTAAGGGACAGTTTGGCTCCTTTT
TCCTGCAGTGGGAGGGGTGAGAAGGGCTGGGGTGTTCTGCAAGGGCCTGCTCCATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGTGGAG
CGGGAGGAGGTGGGGCTTACTGTGAAACTGGGTCAAGATGGCCTCGGATTTGAGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGCTGTG
AGCAGTGCCGAGGGAGGACCAGCTCTGACGGTGAGGTCGGGTGGGGGACTAGAATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACCAGGA
AACCCATAGCATTGACACTAACTGAGAGGCAGCAAAGGCGGTGACACTCCCCCAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCACAGT
TAACTGGTTCTGGGGTAGGAACTGGGGGCCGGAGGGACAGGGTTCTGGTTCTGGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCCTGGG
AAAGAGGGGCTGAGGCCTGAACTGGGCCTAAGGAGAGTGCAGCTCAGTTCGCACACAACAGCACCCAGCCCTGTCCCCTTGCTGCCTCTA
CCCAGCCCTGGGCAGTTCCCTCAACAGAGCTCTGCAGCCCCAAGTGGCAGCTGCTGGCTCAAAGCTGGGACTACATGAAAGTCTGAAAAG
AGAATGAGAAGGAGGTGGCGCAAGAGCCTGGACGCACGTGTGGGAGGCCGTTTTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCATGTGC
TCGCGCTCCGTGGCTCTGTTGGTGCCCAGCGTGCGGGGGTGTGCTGGTGGCCCTGTGGGCCTGTAGGGCAACCCATGCCAACTGCGGAAA
AGTAACCAGCACCATACACCCCCCCCAACACAAAACTGGTCATTTATTTTTTTTGTTGTCATTGTTATTAGGAAGCAAAAAAATGTACAG
TTACAAGAATCATTTTCCAAACAGAGGTTAAATATGAGCTGAAAAGTGTAAAAAAGGAAGAGGAACATCACTTTACAAATCATTAAATTA

>In-frame_TPM3_ENST00000341485_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6557nt
GTAGCAGGCGGAAGTAAGGGTGAGAGGAGGCTGCAACGCCGAGCGGAGGAGGCAGGAACCGGAGCGCGAGCAGTAGCTGGGTGGGCACCA
TGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGCC
TCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAAG
AAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAAGAAAAGATGGAAC
TCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTG
AAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGA
ACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCA
AGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGA
GTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGC
CAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAG
CCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTAC
CAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTG
CGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACC
GTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGAC
CTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAG
GCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTC
AAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAGGGAGTCACCCCCACTCCTGCCCCTGGGCACACCTTGCTGAGGCCCCAGT
AGGGGTGGGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTGTCTGCTGTTCTTTCCCCATAGGTCTTGCTTTGTTGCCTGTCTTGCTGTC
TAGGGATGGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGTCAAAGCCCCCTCCCCACACAGGGCCTTTCCTGTCCCTTGTGGGGCCTTC
CAACCCTGTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGGTCCTTAGAACTGCCCAGAAACTCTGAGTCCCAGCAGCTGGGAGCCAGAA
CTTTGCCTGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTCTCTGCCTTGGAACCTGACCATACTTTAGTTGTGCCCTTCCCAGGCATCA
TCCTCCTACCACCAACCTGGGGCCCCATCTTGGAATGGGGGCTCCTTGGGGCCAGCCCAGTGTGGCTCACCACACTCTTCTTTTTTTTTT
TTTTTTTTTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCTGGAGTACATTTGCCTGATGTCAGCTCCCTGCAACCTCCGCCTCCTGGGT
TCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGTGCACCAACACACCCGGCTAATTTTTGTATTTGTAGAAGAG
GCGGGGTTTCACCATGTTGGCCAGGCTGGTGTTGAACTCCTGACCTCAAGTGATCTGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACA
GGTGTGAGCTGCCACGCCCAGCCCCAGTACACTCTTCTCTGGACCAGATCTGTCCCAGTCCTGGATGCCTCCTCCTACTGGTGCCTTCTT
TTCTTCCAGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTTGGGATCCCTGGGTTGCCCTGTCCCAACCTCCTTGTTAGGTGCTTTCCCA
TAGGAGGCCCTTCTTGAGAAACAATAAACTAGGTAGAACTACCCCTATGCCCATCCACTTTCTTGTGCCACATTCTGGCAGGGCCCAGAT
GCAGCTGGGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTTCTCCTGACCTGGCCTGGCCTGTGGCTGATGTTCAGAACAGCCTTGTGGC
CGATGTTCAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGGTTTTATGGCTTTTGAGGGACAGAGAGGATGGAGGGCTTGGGGAGCCGGA
GGACCTAAGTCCTCATCCTGGCCTAAACCCCATGCTCCTTGGGAAGTCAAAAGCCTGGAAAATATCTCCTCTGGAGCCTTCATCTCTGCT
ATGCCCTCTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGTGGTCTTTCCTCTGTGAGCCCCAGGGCTTCCCAGCCTTTGTCACTCTGAG
AGCTGCTCTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCTGTAGACGGCCCAGCTGCCTGCCCTGGCCTGCCCCCACCCAGCCCCCACT
GCACCACCCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGACCCTTCATGCAGCTTCTCCTGTGGGGTCTTGCCCTTGAAGTGCCACTTC
CCCCAGCCCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAGCCTTGTAGGTCCCTGGGAAGCTGGCACAGCATCAACCAGAAGTGATGCC
TCAGCCAGGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCTTTCCTCAGAACCACCCCCCCTGTCTGAAGCTCTGTCCTGGGTCCCACCA
GACTTCTGCCCACCAGGCCTACCTACAGCATCCACATGGGGCCTCAGGAAGGGCCCCGGGGGCCCAGGGATGGGCAGGGGCAGGGTTTCC
AAGCGCCTGGGGCTCCATTCTCCTCTGTCCACCCACCCACACCCCTTGGCCTCAGCCTGCCCTGTACCCAAGCTTCCCTCCCCCTCTCCT
GGGGATCTTAACGGCCTTGTTCTCTCTCCCTGGCACCCACCCCCAGGGCGGGTGATGCCGCCAAGAGAGAGGGAGGCCGTTGCTAGGTGA
TGGCGCCGCCATGCACACACCCTTTGTGCTGGGGAGTGACACCCACCCGTTTCTCAGCAGACCTGTTGCCACGGTGACTGAAGCCCCCAG
CTCTGTCTGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTGGAGAGGGGACCAAAGGCAGGCCTGTCGTGCTGAAGCTCTTGGGGACCGT
TTCCTCGGCATTTCCCCAACTCCTTCTCCACCCCCCTGCCAGGCCCGGAAGTACCACCAGCTTCCTAAGGGATGCAGGAAGGGGCCGGGT
GAACTGAGGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCAACATCCTGTTTAGGGGTCCTCCTCCACAAAGGGTGCCCTCCACCTCTCC
CTCCTGCTGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGATGGTGGCTCCAAGGCTCTGCCACCGCCACCTCCCAAGCCTGCCAACGTGA
ATGGCTTGCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAAAGAGCCACTGTCCTCGCAGCCTGGGCCAGCTGGGGGAACAATGTAGGGT
TTGTTGCTTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACATGGTGGGCAGTGGACTTGAGCTGGGATGGTCTGAGGGGGCACTGACACG
CTCACCCGAGGGCAGACTTCAGACCAGCCCTCAGATCCTGATGCCAGGTTACAGGGCTGAGGGGAGCCTGAAATCCACTGGGTCTCCCTG
CTCCACTTGGGAGTCACCTTCTCATCACCTATCCTGGAACTGAATGCAATTACTTAAACTCAGTCTCAGCTTCCTCATCTGTAAAATGGG
AATAATCTGTCCTTCACAGAGGATTATGGTCATTTAATGAGACAAGATACATAAAGCACTTTGCATGGTGCCCCGAACCTTTTATTCCTT
CCTCTCCTTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGGCTTGGCCCAGGGATTCTTAAATGCATCCAGGTTTTGGCATCAAAGGGCC
CCAAACATGACAATTTACCTATACTCATGGTCTGTTCCCATTCAACTTTAATAGGTTATGTGTGTTTTTTTTTTCTTAAGAGCTGGGTGG
GGGGGTCTCACTATGTTGCCCAGGCTGGCTTTGAACTCCTGGGCTCAAGCAGTCCTCCTGTCTCAGCCTCCTGAGTAGCTGGGACTACAA
GTGTGTACCACCATGCCTGGCTGAACACTTTTTTTTTTTTGAGACAAGATCCCACTCAGTCACTCAAGCTGAGTGCTGTGGTGTGATCAC
AGCTCATTGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTCCTGCCTCAGCTTCCTGAGTAGCTGGGACTACAGGTGCGCACTACCACGC
CTGTCTAATTTTTGATTATTTGTAGAGATAGGGTCTCACTATTTTGCCCAGGCTGGTCTCAAACTCCCAGACTCAAGTCATTCTCCTACC
TCGGGCTCCCAAAGTACTGGGATTACAGGCATGAGCACCTGGCCCCTGAACAAATTCTTTAAGTCATATTAGCACCTGCTGCACGCCGGC
ACTGTGGAAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGCTCTCTTATCTCAAACCTCAATCCTCAGTGAGGATCACAGGATCTGAGAA
AGGCACCTTGGCCTGGAAACAGCCCCAGATGAGTGAGATTGCTGGTCCTCTCCCGGGATCCCAGGCCCAGGAAAACCTAGCCATGCTTGC
AGTCAGGAGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCAACCTCCTTAGCCAGGAGGACATGTCCCATTTTGCTTAGGAGTTGGGAGG
TACCCTAGAATCACTTAGCTTCAGATGCCAAATTCCATCCACATTCTTTCCTCCAACTCTCTGGCAGTGGGGAACTGCCTCTCCAGGCAG
GGAACTGCTCTGACAGGTCTGATGACTGCCTCCAGGAGGAAGCCCTGGGCACCAATGAAGGTGAGGGGCTGGAGGGCCCAGGACGGGGAG
TCAAGGTCCCCACTCCCAGGACTAAGGGACAGTTTGGCTCCTTTTTCCTGCAGTGGGAGGGGTGAGAAGGGCTGGGGTGTTCTGCAAGGG
CCTGCTCCATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGTGGAGCGGGAGGAGGTGGGGCTTACTGTGAAACTGGGTCAAGATGGCCTC
GGATTTGAGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGCTGTGAGCAGTGCCGAGGGAGGACCAGCTCTGACGGTGAGGTCGGGTGGG
GGACTAGAATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACCAGGAAACCCATAGCATTGACACTAACTGAGAGGCAGCAAAGGCGGTGAC
ACTCCCCCAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCACAGTTAACTGGTTCTGGGGTAGGAACTGGGGGCCGGAGGGACAGGGTTC
TGGTTCTGGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCCTGGGAAAGAGGGGCTGAGGCCTGAACTGGGCCTAAGGAGAGTGCAGCTC
AGTTCGCACACAACAGCACCCAGCCCTGTCCCCTTGCTGCCTCTACCCAGCCCTGGGCAGTTCCCTCAACAGAGCTCTGCAGCCCCAAGT
GGCAGCTGCTGGCTCAAAGCTGGGACTACATGAAAGTCTGAAAAGAGAATGAGAAGGAGGTGGCGCAAGAGCCTGGACGCACGTGTGGGA
GGCCGTTTTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCATGTGCTCGCGCTCCGTGGCTCTGTTGGTGCCCAGCGTGCGGGGGTGTGCT
GGTGGCCCTGTGGGCCTGTAGGGCAACCCATGCCAACTGCGGAAAAGTAACCAGCACCATACACCCCCCCCAACACAAAACTGGTCATTT
ATTTTTTTTGTTGTCATTGTTATTAGGAAGCAAAAAAATGTACAGTTACAAGAATCATTTTCCAAACAGAGGTTAAATATGAGCTGAAAA

>In-frame_TPM3_ENST00000341372_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6503nt
AGGCTGCAACGCCGAGCGGAGGAGGCAGGAACCGGAGCGCGAGCAGTAGCTGGGTGGGCACCATGGCTGGGATCACCACCATCGAGGCGG
TGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGCCTCCAGCGAGAAGTTGAGGGAGAAAGCC
GTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTG
AAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGA
AGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCC
GAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAAT
ATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAA
AGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCACGTGGCCACC
AGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATGACGCTGGCT
GTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAAACCCTCAGCCAGC
CTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTGCCCATCCTC
TTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGT
GAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATCGTGGTGGCC
TACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCCATCACCCCA
GTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCG
GAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAGGGAGTCACCCCCA
CTCCTGCCCCTGGGCACACCTTGCTGAGGCCCCAGTAGGGGTGGGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTGTCTGCTGTTCTTT
CCCCATAGGTCTTGCTTTGTTGCCTGTCTTGCTGTCTAGGGATGGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGTCAAAGCCCCCTCC
CCACACAGGGCCTTTCCTGTCCCTTGTGGGGCCTTCCAACCCTGTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGGTCCTTAGAACTGC
CCAGAAACTCTGAGTCCCAGCAGCTGGGAGCCAGAACTTTGCCTGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTCTCTGCCTTGGAAC
CTGACCATACTTTAGTTGTGCCCTTCCCAGGCATCATCCTCCTACCACCAACCTGGGGCCCCATCTTGGAATGGGGGCTCCTTGGGGCCA
GCCCAGTGTGGCTCACCACACTCTTCTTTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCTGGAGTACATTTGC
CTGATGTCAGCTCCCTGCAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGTGCAC
CAACACACCCGGCTAATTTTTGTATTTGTAGAAGAGGCGGGGTTTCACCATGTTGGCCAGGCTGGTGTTGAACTCCTGACCTCAAGTGAT
CTGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGTGTGAGCTGCCACGCCCAGCCCCAGTACACTCTTCTCTGGACCAGATCTGTC
CCAGTCCTGGATGCCTCCTCCTACTGGTGCCTTCTTTTCTTCCAGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTTGGGATCCCTGGGT
TGCCCTGTCCCAACCTCCTTGTTAGGTGCTTTCCCATAGGAGGCCCTTCTTGAGAAACAATAAACTAGGTAGAACTACCCCTATGCCCAT
CCACTTTCTTGTGCCACATTCTGGCAGGGCCCAGATGCAGCTGGGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTTCTCCTGACCTGGC
CTGGCCTGTGGCTGATGTTCAGAACAGCCTTGTGGCCGATGTTCAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGGTTTTATGGCTTTT
GAGGGACAGAGAGGATGGAGGGCTTGGGGAGCCGGAGGACCTAAGTCCTCATCCTGGCCTAAACCCCATGCTCCTTGGGAAGTCAAAAGC
CTGGAAAATATCTCCTCTGGAGCCTTCATCTCTGCTATGCCCTCTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGTGGTCTTTCCTCTG
TGAGCCCCAGGGCTTCCCAGCCTTTGTCACTCTGAGAGCTGCTCTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCTGTAGACGGCCCAG
CTGCCTGCCCTGGCCTGCCCCCACCCAGCCCCCACTGCACCACCCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGACCCTTCATGCAGC
TTCTCCTGTGGGGTCTTGCCCTTGAAGTGCCACTTCCCCCAGCCCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAGCCTTGTAGGTCCC
TGGGAAGCTGGCACAGCATCAACCAGAAGTGATGCCTCAGCCAGGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCTTTCCTCAGAACCA
CCCCCCCTGTCTGAAGCTCTGTCCTGGGTCCCACCAGACTTCTGCCCACCAGGCCTACCTACAGCATCCACATGGGGCCTCAGGAAGGGC
CCCGGGGGCCCAGGGATGGGCAGGGGCAGGGTTTCCAAGCGCCTGGGGCTCCATTCTCCTCTGTCCACCCACCCACACCCCTTGGCCTCA
GCCTGCCCTGTACCCAAGCTTCCCTCCCCCTCTCCTGGGGATCTTAACGGCCTTGTTCTCTCTCCCTGGCACCCACCCCCAGGGCGGGTG
ATGCCGCCAAGAGAGAGGGAGGCCGTTGCTAGGTGATGGCGCCGCCATGCACACACCCTTTGTGCTGGGGAGTGACACCCACCCGTTTCT
CAGCAGACCTGTTGCCACGGTGACTGAAGCCCCCAGCTCTGTCTGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTGGAGAGGGGACCAA
AGGCAGGCCTGTCGTGCTGAAGCTCTTGGGGACCGTTTCCTCGGCATTTCCCCAACTCCTTCTCCACCCCCCTGCCAGGCCCGGAAGTAC
CACCAGCTTCCTAAGGGATGCAGGAAGGGGCCGGGTGAACTGAGGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCAACATCCTGTTTAG
GGGTCCTCCTCCACAAAGGGTGCCCTCCACCTCTCCCTCCTGCTGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGATGGTGGCTCCAAGG
CTCTGCCACCGCCACCTCCCAAGCCTGCCAACGTGAATGGCTTGCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAAAGAGCCACTGTCC
TCGCAGCCTGGGCCAGCTGGGGGAACAATGTAGGGTTTGTTGCTTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACATGGTGGGCAGTGG
ACTTGAGCTGGGATGGTCTGAGGGGGCACTGACACGCTCACCCGAGGGCAGACTTCAGACCAGCCCTCAGATCCTGATGCCAGGTTACAG
GGCTGAGGGGAGCCTGAAATCCACTGGGTCTCCCTGCTCCACTTGGGAGTCACCTTCTCATCACCTATCCTGGAACTGAATGCAATTACT
TAAACTCAGTCTCAGCTTCCTCATCTGTAAAATGGGAATAATCTGTCCTTCACAGAGGATTATGGTCATTTAATGAGACAAGATACATAA
AGCACTTTGCATGGTGCCCCGAACCTTTTATTCCTTCCTCTCCTTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGGCTTGGCCCAGGGA
TTCTTAAATGCATCCAGGTTTTGGCATCAAAGGGCCCCAAACATGACAATTTACCTATACTCATGGTCTGTTCCCATTCAACTTTAATAG
GTTATGTGTGTTTTTTTTTTCTTAAGAGCTGGGTGGGGGGGTCTCACTATGTTGCCCAGGCTGGCTTTGAACTCCTGGGCTCAAGCAGTC
CTCCTGTCTCAGCCTCCTGAGTAGCTGGGACTACAAGTGTGTACCACCATGCCTGGCTGAACACTTTTTTTTTTTTGAGACAAGATCCCA
CTCAGTCACTCAAGCTGAGTGCTGTGGTGTGATCACAGCTCATTGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTCCTGCCTCAGCTTC
CTGAGTAGCTGGGACTACAGGTGCGCACTACCACGCCTGTCTAATTTTTGATTATTTGTAGAGATAGGGTCTCACTATTTTGCCCAGGCT
GGTCTCAAACTCCCAGACTCAAGTCATTCTCCTACCTCGGGCTCCCAAAGTACTGGGATTACAGGCATGAGCACCTGGCCCCTGAACAAA
TTCTTTAAGTCATATTAGCACCTGCTGCACGCCGGCACTGTGGAAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGCTCTCTTATCTCAA
ACCTCAATCCTCAGTGAGGATCACAGGATCTGAGAAAGGCACCTTGGCCTGGAAACAGCCCCAGATGAGTGAGATTGCTGGTCCTCTCCC
GGGATCCCAGGCCCAGGAAAACCTAGCCATGCTTGCAGTCAGGAGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCAACCTCCTTAGCCA
GGAGGACATGTCCCATTTTGCTTAGGAGTTGGGAGGTACCCTAGAATCACTTAGCTTCAGATGCCAAATTCCATCCACATTCTTTCCTCC
AACTCTCTGGCAGTGGGGAACTGCCTCTCCAGGCAGGGAACTGCTCTGACAGGTCTGATGACTGCCTCCAGGAGGAAGCCCTGGGCACCA
ATGAAGGTGAGGGGCTGGAGGGCCCAGGACGGGGAGTCAAGGTCCCCACTCCCAGGACTAAGGGACAGTTTGGCTCCTTTTTCCTGCAGT
GGGAGGGGTGAGAAGGGCTGGGGTGTTCTGCAAGGGCCTGCTCCATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGTGGAGCGGGAGGAG
GTGGGGCTTACTGTGAAACTGGGTCAAGATGGCCTCGGATTTGAGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGCTGTGAGCAGTGCC
GAGGGAGGACCAGCTCTGACGGTGAGGTCGGGTGGGGGACTAGAATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACCAGGAAACCCATAG
CATTGACACTAACTGAGAGGCAGCAAAGGCGGTGACACTCCCCCAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCACAGTTAACTGGTT
CTGGGGTAGGAACTGGGGGCCGGAGGGACAGGGTTCTGGTTCTGGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCCTGGGAAAGAGGGG
CTGAGGCCTGAACTGGGCCTAAGGAGAGTGCAGCTCAGTTCGCACACAACAGCACCCAGCCCTGTCCCCTTGCTGCCTCTACCCAGCCCT
GGGCAGTTCCCTCAACAGAGCTCTGCAGCCCCAAGTGGCAGCTGCTGGCTCAAAGCTGGGACTACATGAAAGTCTGAAAAGAGAATGAGA
AGGAGGTGGCGCAAGAGCCTGGACGCACGTGTGGGAGGCCGTTTTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCATGTGCTCGCGCTCC
GTGGCTCTGTTGGTGCCCAGCGTGCGGGGGTGTGCTGGTGGCCCTGTGGGCCTGTAGGGCAACCCATGCCAACTGCGGAAAAGTAACCAG
CACCATACACCCCCCCCAACACAAAACTGGTCATTTATTTTTTTTGTTGTCATTGTTATTAGGAAGCAAAAAAATGTACAGTTACAAGAA
TCATTTTCCAAACAGAGGTTAAATATGAGCTGAAAAGTGTAAAAAAGGAAGAGGAACATCACTTTACAAATCATTAAATTAAACAAATAA

>In-frame_TPM3_ENST00000328159_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6516nt
ATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGC
CTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAA
GAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGT
ATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAA
GAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCA
GAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAA
AAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTA
GCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTT
CCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTC
CATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAA
ACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTG
CCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAA
GCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAA
CATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGG
CGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTG
CGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAG
GGAGTCACCCCCACTCCTGCCCCTGGGCACACCTTGCTGAGGCCCCAGTAGGGGTGGGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTG
TCTGCTGTTCTTTCCCCATAGGTCTTGCTTTGTTGCCTGTCTTGCTGTCTAGGGATGGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGT
CAAAGCCCCCTCCCCACACAGGGCCTTTCCTGTCCCTTGTGGGGCCTTCCAACCCTGTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGG
TCCTTAGAACTGCCCAGAAACTCTGAGTCCCAGCAGCTGGGAGCCAGAACTTTGCCTGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTC
TCTGCCTTGGAACCTGACCATACTTTAGTTGTGCCCTTCCCAGGCATCATCCTCCTACCACCAACCTGGGGCCCCATCTTGGAATGGGGG
CTCCTTGGGGCCAGCCCAGTGTGGCTCACCACACTCTTCTTTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCT
GGAGTACATTTGCCTGATGTCAGCTCCCTGCAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGAT
TACAGGTGTGCACCAACACACCCGGCTAATTTTTGTATTTGTAGAAGAGGCGGGGTTTCACCATGTTGGCCAGGCTGGTGTTGAACTCCT
GACCTCAAGTGATCTGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGTGTGAGCTGCCACGCCCAGCCCCAGTACACTCTTCTCTG
GACCAGATCTGTCCCAGTCCTGGATGCCTCCTCCTACTGGTGCCTTCTTTTCTTCCAGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTT
GGGATCCCTGGGTTGCCCTGTCCCAACCTCCTTGTTAGGTGCTTTCCCATAGGAGGCCCTTCTTGAGAAACAATAAACTAGGTAGAACTA
CCCCTATGCCCATCCACTTTCTTGTGCCACATTCTGGCAGGGCCCAGATGCAGCTGGGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTT
CTCCTGACCTGGCCTGGCCTGTGGCTGATGTTCAGAACAGCCTTGTGGCCGATGTTCAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGG
TTTTATGGCTTTTGAGGGACAGAGAGGATGGAGGGCTTGGGGAGCCGGAGGACCTAAGTCCTCATCCTGGCCTAAACCCCATGCTCCTTG
GGAAGTCAAAAGCCTGGAAAATATCTCCTCTGGAGCCTTCATCTCTGCTATGCCCTCTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGT
GGTCTTTCCTCTGTGAGCCCCAGGGCTTCCCAGCCTTTGTCACTCTGAGAGCTGCTCTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCT
GTAGACGGCCCAGCTGCCTGCCCTGGCCTGCCCCCACCCAGCCCCCACTGCACCACCCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGA
CCCTTCATGCAGCTTCTCCTGTGGGGTCTTGCCCTTGAAGTGCCACTTCCCCCAGCCCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAG
CCTTGTAGGTCCCTGGGAAGCTGGCACAGCATCAACCAGAAGTGATGCCTCAGCCAGGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCT
TTCCTCAGAACCACCCCCCCTGTCTGAAGCTCTGTCCTGGGTCCCACCAGACTTCTGCCCACCAGGCCTACCTACAGCATCCACATGGGG
CCTCAGGAAGGGCCCCGGGGGCCCAGGGATGGGCAGGGGCAGGGTTTCCAAGCGCCTGGGGCTCCATTCTCCTCTGTCCACCCACCCACA
CCCCTTGGCCTCAGCCTGCCCTGTACCCAAGCTTCCCTCCCCCTCTCCTGGGGATCTTAACGGCCTTGTTCTCTCTCCCTGGCACCCACC
CCCAGGGCGGGTGATGCCGCCAAGAGAGAGGGAGGCCGTTGCTAGGTGATGGCGCCGCCATGCACACACCCTTTGTGCTGGGGAGTGACA
CCCACCCGTTTCTCAGCAGACCTGTTGCCACGGTGACTGAAGCCCCCAGCTCTGTCTGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTG
GAGAGGGGACCAAAGGCAGGCCTGTCGTGCTGAAGCTCTTGGGGACCGTTTCCTCGGCATTTCCCCAACTCCTTCTCCACCCCCCTGCCA
GGCCCGGAAGTACCACCAGCTTCCTAAGGGATGCAGGAAGGGGCCGGGTGAACTGAGGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCA
ACATCCTGTTTAGGGGTCCTCCTCCACAAAGGGTGCCCTCCACCTCTCCCTCCTGCTGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGAT
GGTGGCTCCAAGGCTCTGCCACCGCCACCTCCCAAGCCTGCCAACGTGAATGGCTTGCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAA
AGAGCCACTGTCCTCGCAGCCTGGGCCAGCTGGGGGAACAATGTAGGGTTTGTTGCTTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACA
TGGTGGGCAGTGGACTTGAGCTGGGATGGTCTGAGGGGGCACTGACACGCTCACCCGAGGGCAGACTTCAGACCAGCCCTCAGATCCTGA
TGCCAGGTTACAGGGCTGAGGGGAGCCTGAAATCCACTGGGTCTCCCTGCTCCACTTGGGAGTCACCTTCTCATCACCTATCCTGGAACT
GAATGCAATTACTTAAACTCAGTCTCAGCTTCCTCATCTGTAAAATGGGAATAATCTGTCCTTCACAGAGGATTATGGTCATTTAATGAG
ACAAGATACATAAAGCACTTTGCATGGTGCCCCGAACCTTTTATTCCTTCCTCTCCTTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGG
CTTGGCCCAGGGATTCTTAAATGCATCCAGGTTTTGGCATCAAAGGGCCCCAAACATGACAATTTACCTATACTCATGGTCTGTTCCCAT
TCAACTTTAATAGGTTATGTGTGTTTTTTTTTTCTTAAGAGCTGGGTGGGGGGGTCTCACTATGTTGCCCAGGCTGGCTTTGAACTCCTG
GGCTCAAGCAGTCCTCCTGTCTCAGCCTCCTGAGTAGCTGGGACTACAAGTGTGTACCACCATGCCTGGCTGAACACTTTTTTTTTTTTG
AGACAAGATCCCACTCAGTCACTCAAGCTGAGTGCTGTGGTGTGATCACAGCTCATTGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTC
CTGCCTCAGCTTCCTGAGTAGCTGGGACTACAGGTGCGCACTACCACGCCTGTCTAATTTTTGATTATTTGTAGAGATAGGGTCTCACTA
TTTTGCCCAGGCTGGTCTCAAACTCCCAGACTCAAGTCATTCTCCTACCTCGGGCTCCCAAAGTACTGGGATTACAGGCATGAGCACCTG
GCCCCTGAACAAATTCTTTAAGTCATATTAGCACCTGCTGCACGCCGGCACTGTGGAAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGC
TCTCTTATCTCAAACCTCAATCCTCAGTGAGGATCACAGGATCTGAGAAAGGCACCTTGGCCTGGAAACAGCCCCAGATGAGTGAGATTG
CTGGTCCTCTCCCGGGATCCCAGGCCCAGGAAAACCTAGCCATGCTTGCAGTCAGGAGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCA
ACCTCCTTAGCCAGGAGGACATGTCCCATTTTGCTTAGGAGTTGGGAGGTACCCTAGAATCACTTAGCTTCAGATGCCAAATTCCATCCA
CATTCTTTCCTCCAACTCTCTGGCAGTGGGGAACTGCCTCTCCAGGCAGGGAACTGCTCTGACAGGTCTGATGACTGCCTCCAGGAGGAA
GCCCTGGGCACCAATGAAGGTGAGGGGCTGGAGGGCCCAGGACGGGGAGTCAAGGTCCCCACTCCCAGGACTAAGGGACAGTTTGGCTCC
TTTTTCCTGCAGTGGGAGGGGTGAGAAGGGCTGGGGTGTTCTGCAAGGGCCTGCTCCATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGT
GGAGCGGGAGGAGGTGGGGCTTACTGTGAAACTGGGTCAAGATGGCCTCGGATTTGAGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGC
TGTGAGCAGTGCCGAGGGAGGACCAGCTCTGACGGTGAGGTCGGGTGGGGGACTAGAATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACC
AGGAAACCCATAGCATTGACACTAACTGAGAGGCAGCAAAGGCGGTGACACTCCCCCAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCA
CAGTTAACTGGTTCTGGGGTAGGAACTGGGGGCCGGAGGGACAGGGTTCTGGTTCTGGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCC
TGGGAAAGAGGGGCTGAGGCCTGAACTGGGCCTAAGGAGAGTGCAGCTCAGTTCGCACACAACAGCACCCAGCCCTGTCCCCTTGCTGCC
TCTACCCAGCCCTGGGCAGTTCCCTCAACAGAGCTCTGCAGCCCCAAGTGGCAGCTGCTGGCTCAAAGCTGGGACTACATGAAAGTCTGA
AAAGAGAATGAGAAGGAGGTGGCGCAAGAGCCTGGACGCACGTGTGGGAGGCCGTTTTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCAT
GTGCTCGCGCTCCGTGGCTCTGTTGGTGCCCAGCGTGCGGGGGTGTGCTGGTGGCCCTGTGGGCCTGTAGGGCAACCCATGCCAACTGCG
GAAAAGTAACCAGCACCATACACCCCCCCCAACACAAAACTGGTCATTTATTTTTTTTGTTGTCATTGTTATTAGGAAGCAAAAAAATGT
ACAGTTACAAGAATCATTTTCCAAACAGAGGTTAAATATGAGCTGAAAAGTGTAAAAAAGGAAGAGGAACATCACTTTACAAATCATTAA

>In-frame_TPM3_ENST00000271850_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6667nt
CTCCAGTGTTCACAGGTGAGCCTACCAACAGCCACTGCTCATGATGGAGGCCATCAAGAAAAAGATGCAGATGCTGAAGTTAGACAAGGA
GAATGCTCTGGATCGGGCAGAGCAAGCTGAAGCTGAGCAGAAGCAGGCAGAAGAAAGAAGTAAACAGCTGGAGGATGAGCTGGCAGCCAT
GCAGAAGAAGCTGAAAGGGACAGAGGATGAGCTGGACAAGTATTCTGAAGCTTTGAAGGATGCCCAGGAGAAGCTGGAACTGGCAGAGAA
GAAGGCTGCTGATGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCT
GGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAA
AGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGC
TCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCA
GATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAA
GATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCT
GGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGG
TGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGC
TGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGT
ATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCC
AGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACA
GCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGC
TGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCA
TCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCA
ATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAGGGAGTCACCCCCACTCCTGCCCCTGGGCA
CACCTTGCTGAGGCCCCAGTAGGGGTGGGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTGTCTGCTGTTCTTTCCCCATAGGTCTTGCT
TTGTTGCCTGTCTTGCTGTCTAGGGATGGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGTCAAAGCCCCCTCCCCACACAGGGCCTTTC
CTGTCCCTTGTGGGGCCTTCCAACCCTGTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGGTCCTTAGAACTGCCCAGAAACTCTGAGTC
CCAGCAGCTGGGAGCCAGAACTTTGCCTGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTCTCTGCCTTGGAACCTGACCATACTTTAGT
TGTGCCCTTCCCAGGCATCATCCTCCTACCACCAACCTGGGGCCCCATCTTGGAATGGGGGCTCCTTGGGGCCAGCCCAGTGTGGCTCAC
CACACTCTTCTTTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCTGGAGTACATTTGCCTGATGTCAGCTCCCT
GCAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGTGCACCAACACACCCGGCTAA
TTTTTGTATTTGTAGAAGAGGCGGGGTTTCACCATGTTGGCCAGGCTGGTGTTGAACTCCTGACCTCAAGTGATCTGCCTGCCTTGGCCT
CCCAAAGTGCTGGGATTACAGGTGTGAGCTGCCACGCCCAGCCCCAGTACACTCTTCTCTGGACCAGATCTGTCCCAGTCCTGGATGCCT
CCTCCTACTGGTGCCTTCTTTTCTTCCAGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTTGGGATCCCTGGGTTGCCCTGTCCCAACCT
CCTTGTTAGGTGCTTTCCCATAGGAGGCCCTTCTTGAGAAACAATAAACTAGGTAGAACTACCCCTATGCCCATCCACTTTCTTGTGCCA
CATTCTGGCAGGGCCCAGATGCAGCTGGGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTTCTCCTGACCTGGCCTGGCCTGTGGCTGAT
GTTCAGAACAGCCTTGTGGCCGATGTTCAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGGTTTTATGGCTTTTGAGGGACAGAGAGGAT
GGAGGGCTTGGGGAGCCGGAGGACCTAAGTCCTCATCCTGGCCTAAACCCCATGCTCCTTGGGAAGTCAAAAGCCTGGAAAATATCTCCT
CTGGAGCCTTCATCTCTGCTATGCCCTCTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGTGGTCTTTCCTCTGTGAGCCCCAGGGCTTC
CCAGCCTTTGTCACTCTGAGAGCTGCTCTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCTGTAGACGGCCCAGCTGCCTGCCCTGGCCT
GCCCCCACCCAGCCCCCACTGCACCACCCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGACCCTTCATGCAGCTTCTCCTGTGGGGTCT
TGCCCTTGAAGTGCCACTTCCCCCAGCCCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAGCCTTGTAGGTCCCTGGGAAGCTGGCACAG
CATCAACCAGAAGTGATGCCTCAGCCAGGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCTTTCCTCAGAACCACCCCCCCTGTCTGAAG
CTCTGTCCTGGGTCCCACCAGACTTCTGCCCACCAGGCCTACCTACAGCATCCACATGGGGCCTCAGGAAGGGCCCCGGGGGCCCAGGGA
TGGGCAGGGGCAGGGTTTCCAAGCGCCTGGGGCTCCATTCTCCTCTGTCCACCCACCCACACCCCTTGGCCTCAGCCTGCCCTGTACCCA
AGCTTCCCTCCCCCTCTCCTGGGGATCTTAACGGCCTTGTTCTCTCTCCCTGGCACCCACCCCCAGGGCGGGTGATGCCGCCAAGAGAGA
GGGAGGCCGTTGCTAGGTGATGGCGCCGCCATGCACACACCCTTTGTGCTGGGGAGTGACACCCACCCGTTTCTCAGCAGACCTGTTGCC
ACGGTGACTGAAGCCCCCAGCTCTGTCTGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTGGAGAGGGGACCAAAGGCAGGCCTGTCGTG
CTGAAGCTCTTGGGGACCGTTTCCTCGGCATTTCCCCAACTCCTTCTCCACCCCCCTGCCAGGCCCGGAAGTACCACCAGCTTCCTAAGG
GATGCAGGAAGGGGCCGGGTGAACTGAGGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCAACATCCTGTTTAGGGGTCCTCCTCCACAA
AGGGTGCCCTCCACCTCTCCCTCCTGCTGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGATGGTGGCTCCAAGGCTCTGCCACCGCCACC
TCCCAAGCCTGCCAACGTGAATGGCTTGCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAAAGAGCCACTGTCCTCGCAGCCTGGGCCAG
CTGGGGGAACAATGTAGGGTTTGTTGCTTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACATGGTGGGCAGTGGACTTGAGCTGGGATGG
TCTGAGGGGGCACTGACACGCTCACCCGAGGGCAGACTTCAGACCAGCCCTCAGATCCTGATGCCAGGTTACAGGGCTGAGGGGAGCCTG
AAATCCACTGGGTCTCCCTGCTCCACTTGGGAGTCACCTTCTCATCACCTATCCTGGAACTGAATGCAATTACTTAAACTCAGTCTCAGC
TTCCTCATCTGTAAAATGGGAATAATCTGTCCTTCACAGAGGATTATGGTCATTTAATGAGACAAGATACATAAAGCACTTTGCATGGTG
CCCCGAACCTTTTATTCCTTCCTCTCCTTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGGCTTGGCCCAGGGATTCTTAAATGCATCCA
GGTTTTGGCATCAAAGGGCCCCAAACATGACAATTTACCTATACTCATGGTCTGTTCCCATTCAACTTTAATAGGTTATGTGTGTTTTTT
TTTTCTTAAGAGCTGGGTGGGGGGGTCTCACTATGTTGCCCAGGCTGGCTTTGAACTCCTGGGCTCAAGCAGTCCTCCTGTCTCAGCCTC
CTGAGTAGCTGGGACTACAAGTGTGTACCACCATGCCTGGCTGAACACTTTTTTTTTTTTGAGACAAGATCCCACTCAGTCACTCAAGCT
GAGTGCTGTGGTGTGATCACAGCTCATTGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTCCTGCCTCAGCTTCCTGAGTAGCTGGGACT
ACAGGTGCGCACTACCACGCCTGTCTAATTTTTGATTATTTGTAGAGATAGGGTCTCACTATTTTGCCCAGGCTGGTCTCAAACTCCCAG
ACTCAAGTCATTCTCCTACCTCGGGCTCCCAAAGTACTGGGATTACAGGCATGAGCACCTGGCCCCTGAACAAATTCTTTAAGTCATATT
AGCACCTGCTGCACGCCGGCACTGTGGAAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGCTCTCTTATCTCAAACCTCAATCCTCAGTG
AGGATCACAGGATCTGAGAAAGGCACCTTGGCCTGGAAACAGCCCCAGATGAGTGAGATTGCTGGTCCTCTCCCGGGATCCCAGGCCCAG
GAAAACCTAGCCATGCTTGCAGTCAGGAGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCAACCTCCTTAGCCAGGAGGACATGTCCCAT
TTTGCTTAGGAGTTGGGAGGTACCCTAGAATCACTTAGCTTCAGATGCCAAATTCCATCCACATTCTTTCCTCCAACTCTCTGGCAGTGG
GGAACTGCCTCTCCAGGCAGGGAACTGCTCTGACAGGTCTGATGACTGCCTCCAGGAGGAAGCCCTGGGCACCAATGAAGGTGAGGGGCT
GGAGGGCCCAGGACGGGGAGTCAAGGTCCCCACTCCCAGGACTAAGGGACAGTTTGGCTCCTTTTTCCTGCAGTGGGAGGGGTGAGAAGG
GCTGGGGTGTTCTGCAAGGGCCTGCTCCATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGTGGAGCGGGAGGAGGTGGGGCTTACTGTGA
AACTGGGTCAAGATGGCCTCGGATTTGAGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGCTGTGAGCAGTGCCGAGGGAGGACCAGCTC
TGACGGTGAGGTCGGGTGGGGGACTAGAATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACCAGGAAACCCATAGCATTGACACTAACTGA
GAGGCAGCAAAGGCGGTGACACTCCCCCAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCACAGTTAACTGGTTCTGGGGTAGGAACTGG
GGGCCGGAGGGACAGGGTTCTGGTTCTGGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCCTGGGAAAGAGGGGCTGAGGCCTGAACTGG
GCCTAAGGAGAGTGCAGCTCAGTTCGCACACAACAGCACCCAGCCCTGTCCCCTTGCTGCCTCTACCCAGCCCTGGGCAGTTCCCTCAAC
AGAGCTCTGCAGCCCCAAGTGGCAGCTGCTGGCTCAAAGCTGGGACTACATGAAAGTCTGAAAAGAGAATGAGAAGGAGGTGGCGCAAGA
GCCTGGACGCACGTGTGGGAGGCCGTTTTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCATGTGCTCGCGCTCCGTGGCTCTGTTGGTGC
CCAGCGTGCGGGGGTGTGCTGGTGGCCCTGTGGGCCTGTAGGGCAACCCATGCCAACTGCGGAAAAGTAACCAGCACCATACACCCCCCC
CAACACAAAACTGGTCATTTATTTTTTTTGTTGTCATTGTTATTAGGAAGCAAAAAAATGTACAGTTACAAGAATCATTTTCCAAACAGA
GGTTAAATATGAGCTGAAAAGTGTAAAAAAGGAAGAGGAACATCACTTTACAAATCATTAAATTAAACAAATAAACAAACAGAACCCAAA

>In-frame_TPM3_ENST00000368531_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6527nt
GGGTGGGCACCATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAGGTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGC
GAGCTGAGCGCCTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCC
AGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGA
GTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTAAGC
ACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAACGAG
CTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAGAAA
AGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTG
AGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGC
ATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCATCCTGGCCAAGTTGGCTGTCATC
TGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCCCCACCATGGGCACCCTGGACTCA
TGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACGCCCGCATGTGGTGGTACTTTGGC
TGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGC
AGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCTACGCCTTCTGCACCCTCCCAGAG
AACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGGGCCTCATCAACCAGTTCTCCACC
TTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGC
TGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCGAGGTGTCCTCTTCCATCTACTTC
CACAAGCCCAGGGAGTCACCCCCACTCCTGCCCCTGGGCACACCTTGCTGAGGCCCCAGTAGGGGTGGGGAGGGAGGGAGAGGCCGCCAC
CCCCGCCGGTGTCTGCTGTTCTTTCCCCATAGGTCTTGCTTTGTTGCCTGTCTTGCTGTCTAGGGATGGACTTGGTTCCTCTTGTCAAGG
TTTGGGAATGTCAAAGCCCCCTCCCCACACAGGGCCTTTCCTGTCCCTTGTGGGGCCTTCCAACCCTGTCCTTTCCACTGGTGGGCGGTG
ATGCTTCTAGGTCCTTAGAACTGCCCAGAAACTCTGAGTCCCAGCAGCTGGGAGCCAGAACTTTGCCTGCCCTCCCTTGGTTCCAGTCTC
TCTTCTCTCTCTCTGCCTTGGAACCTGACCATACTTTAGTTGTGCCCTTCCCAGGCATCATCCTCCTACCACCAACCTGGGGCCCCATCT
TGGAATGGGGGCTCCTTGGGGCCAGCCCAGTGTGGCTCACCACACTCTTCTTTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTTGCTCTG
TTGCCCAGGCTGGAGTACATTTGCCTGATGTCAGCTCCCTGCAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGA
GTAGCTGGGATTACAGGTGTGCACCAACACACCCGGCTAATTTTTGTATTTGTAGAAGAGGCGGGGTTTCACCATGTTGGCCAGGCTGGT
GTTGAACTCCTGACCTCAAGTGATCTGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGTGTGAGCTGCCACGCCCAGCCCCAGTAC
ACTCTTCTCTGGACCAGATCTGTCCCAGTCCTGGATGCCTCCTCCTACTGGTGCCTTCTTTTCTTCCAGAGGATTTCTCTCTCCTTCCTC
CTCCTTTCTTTGGGATCCCTGGGTTGCCCTGTCCCAACCTCCTTGTTAGGTGCTTTCCCATAGGAGGCCCTTCTTGAGAAACAATAAACT
AGGTAGAACTACCCCTATGCCCATCCACTTTCTTGTGCCACATTCTGGCAGGGCCCAGATGCAGCTGGGCCTTCCTGGCCTGGCAGTGCC
TAGGAGAATTTCTCCTGACCTGGCCTGGCCTGTGGCTGATGTTCAGAACAGCCTTGTGGCCGATGTTCAGAACAGCCTTGTGGCCCTGGC
GACTCCAAGGGTTTTATGGCTTTTGAGGGACAGAGAGGATGGAGGGCTTGGGGAGCCGGAGGACCTAAGTCCTCATCCTGGCCTAAACCC
CATGCTCCTTGGGAAGTCAAAAGCCTGGAAAATATCTCCTCTGGAGCCTTCATCTCTGCTATGCCCTCTCTCCACAAAGCCCCCCTTGGA
GGGAGTCCAGTGGTCTTTCCTCTGTGAGCCCCAGGGCTTCCCAGCCTTTGTCACTCTGAGAGCTGCTCTTGTTCAGTTTCTTAGAATGGA
CTGTTTTGCCTGTAGACGGCCCAGCTGCCTGCCCTGGCCTGCCCCCACCCAGCCCCCACTGCACCACCCTTCCCGCCAGAGCTCCCACTG
CCCCCGGCAGACCCTTCATGCAGCTTCTCCTGTGGGGTCTTGCCCTTGAAGTGCCACTTCCCCCAGCCCCACCTCTGGTCCCTTCCAGAG
GGCACCCTTAGCCTTGTAGGTCCCTGGGAAGCTGGCACAGCATCAACCAGAAGTGATGCCTCAGCCAGGCCACCAGTCGCTCCCCGCCTG
GGAGCTCAGCTTTCCTCAGAACCACCCCCCCTGTCTGAAGCTCTGTCCTGGGTCCCACCAGACTTCTGCCCACCAGGCCTACCTACAGCA
TCCACATGGGGCCTCAGGAAGGGCCCCGGGGGCCCAGGGATGGGCAGGGGCAGGGTTTCCAAGCGCCTGGGGCTCCATTCTCCTCTGTCC
ACCCACCCACACCCCTTGGCCTCAGCCTGCCCTGTACCCAAGCTTCCCTCCCCCTCTCCTGGGGATCTTAACGGCCTTGTTCTCTCTCCC
TGGCACCCACCCCCAGGGCGGGTGATGCCGCCAAGAGAGAGGGAGGCCGTTGCTAGGTGATGGCGCCGCCATGCACACACCCTTTGTGCT
GGGGAGTGACACCCACCCGTTTCTCAGCAGACCTGTTGCCACGGTGACTGAAGCCCCCAGCTCTGTCTGTAGAAACTTCAGATGGGTGGG
GGAGCAGGTTGGAGAGGGGACCAAAGGCAGGCCTGTCGTGCTGAAGCTCTTGGGGACCGTTTCCTCGGCATTTCCCCAACTCCTTCTCCA
CCCCCCTGCCAGGCCCGGAAGTACCACCAGCTTCCTAAGGGATGCAGGAAGGGGCCGGGTGAACTGAGGTGAAGTCCAGGGCAGGGGAGT
CAGACCCCTCAACATCCTGTTTAGGGGTCCTCCTCCACAAAGGGTGCCCTCCACCTCTCCCTCCTGCTGGTTGGCCGGCTCAGAGATGAA
GGGGGAGAGATGGTGGCTCCAAGGCTCTGCCACCGCCACCTCCCAAGCCTGCCAACGTGAATGGCTTGCAGAATCAGTCAGCAGGCCAGC
GGCCTTGGGAAAGAGCCACTGTCCTCGCAGCCTGGGCCAGCTGGGGGAACAATGTAGGGTTTGTTGCTTAGGGGTCCCAGGCTTGCGGGG
GGGTTGGCACATGGTGGGCAGTGGACTTGAGCTGGGATGGTCTGAGGGGGCACTGACACGCTCACCCGAGGGCAGACTTCAGACCAGCCC
TCAGATCCTGATGCCAGGTTACAGGGCTGAGGGGAGCCTGAAATCCACTGGGTCTCCCTGCTCCACTTGGGAGTCACCTTCTCATCACCT
ATCCTGGAACTGAATGCAATTACTTAAACTCAGTCTCAGCTTCCTCATCTGTAAAATGGGAATAATCTGTCCTTCACAGAGGATTATGGT
CATTTAATGAGACAAGATACATAAAGCACTTTGCATGGTGCCCCGAACCTTTTATTCCTTCCTCTCCTTTGGGAATTCAATTCTCTAGTG
TTAGGAGCAGGCTTGGCCCAGGGATTCTTAAATGCATCCAGGTTTTGGCATCAAAGGGCCCCAAACATGACAATTTACCTATACTCATGG
TCTGTTCCCATTCAACTTTAATAGGTTATGTGTGTTTTTTTTTTCTTAAGAGCTGGGTGGGGGGGTCTCACTATGTTGCCCAGGCTGGCT
TTGAACTCCTGGGCTCAAGCAGTCCTCCTGTCTCAGCCTCCTGAGTAGCTGGGACTACAAGTGTGTACCACCATGCCTGGCTGAACACTT
TTTTTTTTTTGAGACAAGATCCCACTCAGTCACTCAAGCTGAGTGCTGTGGTGTGATCACAGCTCATTGCAGCCTCCACTTCCTGGGCTC
AAGCGATTCTCCTGCCTCAGCTTCCTGAGTAGCTGGGACTACAGGTGCGCACTACCACGCCTGTCTAATTTTTGATTATTTGTAGAGATA
GGGTCTCACTATTTTGCCCAGGCTGGTCTCAAACTCCCAGACTCAAGTCATTCTCCTACCTCGGGCTCCCAAAGTACTGGGATTACAGGC
ATGAGCACCTGGCCCCTGAACAAATTCTTTAAGTCATATTAGCACCTGCTGCACGCCGGCACTGTGGAAGGAGGATGCTTGCTTGCTTCC
TGGTAACCAGCTCTCTTATCTCAAACCTCAATCCTCAGTGAGGATCACAGGATCTGAGAAAGGCACCTTGGCCTGGAAACAGCCCCAGAT
GAGTGAGATTGCTGGTCCTCTCCCGGGATCCCAGGCCCAGGAAAACCTAGCCATGCTTGCAGTCAGGAGAGGGCAGGGGATAGAGCCCTG
GCTCCCATTCAACCTCCTTAGCCAGGAGGACATGTCCCATTTTGCTTAGGAGTTGGGAGGTACCCTAGAATCACTTAGCTTCAGATGCCA
AATTCCATCCACATTCTTTCCTCCAACTCTCTGGCAGTGGGGAACTGCCTCTCCAGGCAGGGAACTGCTCTGACAGGTCTGATGACTGCC
TCCAGGAGGAAGCCCTGGGCACCAATGAAGGTGAGGGGCTGGAGGGCCCAGGACGGGGAGTCAAGGTCCCCACTCCCAGGACTAAGGGAC
AGTTTGGCTCCTTTTTCCTGCAGTGGGAGGGGTGAGAAGGGCTGGGGTGTTCTGCAAGGGCCTGCTCCATTTTCCAGGGTGAAGGAGAGG
CCGAGGGAGGTGGAGCGGGAGGAGGTGGGGCTTACTGTGAAACTGGGTCAAGATGGCCTCGGATTTGAGCAGGCAGGGTCACCAGGCTCT
GAGGCAGCAGCTGTGAGCAGTGCCGAGGGAGGACCAGCTCTGACGGTGAGGTCGGGTGGGGGACTAGAATCCAGCAGAGGAGCGAGGGCA
GGGCTCCTACCAGGAAACCCATAGCATTGACACTAACTGAGAGGCAGCAAAGGCGGTGACACTCCCCCAGGCTCTGTGGGCCCAGCCCTA
CCCCTGAAGCACAGTTAACTGGTTCTGGGGTAGGAACTGGGGGCCGGAGGGACAGGGTTCTGGTTCTGGCTCAACCTTGGCTGCTGGTGA
GATCCAGGGCCTGGGAAAGAGGGGCTGAGGCCTGAACTGGGCCTAAGGAGAGTGCAGCTCAGTTCGCACACAACAGCACCCAGCCCTGTC
CCCTTGCTGCCTCTACCCAGCCCTGGGCAGTTCCCTCAACAGAGCTCTGCAGCCCCAAGTGGCAGCTGCTGGCTCAAAGCTGGGACTACA
TGAAAGTCTGAAAAGAGAATGAGAAGGAGGTGGCGCAAGAGCCTGGACGCACGTGTGGGAGGCCGTTTTGTGCAGCGCCATTGTGCTCCC
CGGGCGGGCATGTGCTCGCGCTCCGTGGCTCTGTTGGTGCCCAGCGTGCGGGGGTGTGCTGGTGGCCCTGTGGGCCTGTAGGGCAACCCA
TGCCAACTGCGGAAAAGTAACCAGCACCATACACCCCCCCCAACACAAAACTGGTCATTTATTTTTTTTGTTGTCATTGTTATTAGGAAG
CAAAAAAATGTACAGTTACAAGAATCATTTTCCAAACAGAGGTTAAATATGAGCTGAAAAGTGTAAAAAAGGAAGAGGAACATCACTTTA

>In-frame_TPM3_ENST00000323144_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6561nt
GGAGGAGGCAGGAACCGGAGCGCGAGCAGTAGCTGGGTGGGCACCATGGCTGGGATCACCACCATCGAGGCGGTGAAGCGCAAGATCCAG
GTTCTGCAGCAGCAGGCAGATGATGCAGAGGAGCGAGCTGAGCGCCTCCAGCGAGAAGTTGAGGGAGAAAGGCGGGCCCGGGAACAGGCT
GAGGCTGAGGTGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAA
AAGCTGGAAGAAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATG
GAACTCCAGGAAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATC
ATTGAAGGAGACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCTAAGTGTTCTGAGCTGGAGGAGGAGCTGAAGAATGTCACC
AACAACCTCAAGTCTCTTGAGGCTCAGGCGGAGAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAA
CTCAAGGAGGCAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCT
GGGAGTCACGACTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCG
GTGCCAATCCATCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACA
GGAGCCTGCCCCCACCATGGGCACCCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGAC
CTACCAGAACGCCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCG
GGTGCGAGGCCCTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCT
GACCGTGGTCTACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCT
GGACCTCCTGGGCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGG
CCAGGCCTTCCTGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAA
GCTCAAGACCGAGGTGTCCTCTTCCATCTACTTCCACAAGCCCAGGGAGTCACCCCCACTCCTGCCCCTGGGCACACCTTGCTGAGGCCC
CAGTAGGGGTGGGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTGTCTGCTGTTCTTTCCCCATAGGTCTTGCTTTGTTGCCTGTCTTGC
TGTCTAGGGATGGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGTCAAAGCCCCCTCCCCACACAGGGCCTTTCCTGTCCCTTGTGGGGC
CTTCCAACCCTGTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGGTCCTTAGAACTGCCCAGAAACTCTGAGTCCCAGCAGCTGGGAGCC
AGAACTTTGCCTGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTCTCTGCCTTGGAACCTGACCATACTTTAGTTGTGCCCTTCCCAGGC
ATCATCCTCCTACCACCAACCTGGGGCCCCATCTTGGAATGGGGGCTCCTTGGGGCCAGCCCAGTGTGGCTCACCACACTCTTCTTTTTT
TTTTTTTTTTTTTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCTGGAGTACATTTGCCTGATGTCAGCTCCCTGCAACCTCCGCCTCCT
GGGTTCAAGCGATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGTGCACCAACACACCCGGCTAATTTTTGTATTTGTAGA
AGAGGCGGGGTTTCACCATGTTGGCCAGGCTGGTGTTGAACTCCTGACCTCAAGTGATCTGCCTGCCTTGGCCTCCCAAAGTGCTGGGAT
TACAGGTGTGAGCTGCCACGCCCAGCCCCAGTACACTCTTCTCTGGACCAGATCTGTCCCAGTCCTGGATGCCTCCTCCTACTGGTGCCT
TCTTTTCTTCCAGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTTGGGATCCCTGGGTTGCCCTGTCCCAACCTCCTTGTTAGGTGCTTT
CCCATAGGAGGCCCTTCTTGAGAAACAATAAACTAGGTAGAACTACCCCTATGCCCATCCACTTTCTTGTGCCACATTCTGGCAGGGCCC
AGATGCAGCTGGGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTTCTCCTGACCTGGCCTGGCCTGTGGCTGATGTTCAGAACAGCCTTG
TGGCCGATGTTCAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGGTTTTATGGCTTTTGAGGGACAGAGAGGATGGAGGGCTTGGGGAGC
CGGAGGACCTAAGTCCTCATCCTGGCCTAAACCCCATGCTCCTTGGGAAGTCAAAAGCCTGGAAAATATCTCCTCTGGAGCCTTCATCTC
TGCTATGCCCTCTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGTGGTCTTTCCTCTGTGAGCCCCAGGGCTTCCCAGCCTTTGTCACTC
TGAGAGCTGCTCTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCTGTAGACGGCCCAGCTGCCTGCCCTGGCCTGCCCCCACCCAGCCCC
CACTGCACCACCCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGACCCTTCATGCAGCTTCTCCTGTGGGGTCTTGCCCTTGAAGTGCCA
CTTCCCCCAGCCCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAGCCTTGTAGGTCCCTGGGAAGCTGGCACAGCATCAACCAGAAGTGA
TGCCTCAGCCAGGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCTTTCCTCAGAACCACCCCCCCTGTCTGAAGCTCTGTCCTGGGTCCC
ACCAGACTTCTGCCCACCAGGCCTACCTACAGCATCCACATGGGGCCTCAGGAAGGGCCCCGGGGGCCCAGGGATGGGCAGGGGCAGGGT
TTCCAAGCGCCTGGGGCTCCATTCTCCTCTGTCCACCCACCCACACCCCTTGGCCTCAGCCTGCCCTGTACCCAAGCTTCCCTCCCCCTC
TCCTGGGGATCTTAACGGCCTTGTTCTCTCTCCCTGGCACCCACCCCCAGGGCGGGTGATGCCGCCAAGAGAGAGGGAGGCCGTTGCTAG
GTGATGGCGCCGCCATGCACACACCCTTTGTGCTGGGGAGTGACACCCACCCGTTTCTCAGCAGACCTGTTGCCACGGTGACTGAAGCCC
CCAGCTCTGTCTGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTGGAGAGGGGACCAAAGGCAGGCCTGTCGTGCTGAAGCTCTTGGGGA
CCGTTTCCTCGGCATTTCCCCAACTCCTTCTCCACCCCCCTGCCAGGCCCGGAAGTACCACCAGCTTCCTAAGGGATGCAGGAAGGGGCC
GGGTGAACTGAGGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCAACATCCTGTTTAGGGGTCCTCCTCCACAAAGGGTGCCCTCCACCT
CTCCCTCCTGCTGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGATGGTGGCTCCAAGGCTCTGCCACCGCCACCTCCCAAGCCTGCCAAC
GTGAATGGCTTGCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAAAGAGCCACTGTCCTCGCAGCCTGGGCCAGCTGGGGGAACAATGTA
GGGTTTGTTGCTTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACATGGTGGGCAGTGGACTTGAGCTGGGATGGTCTGAGGGGGCACTGA
CACGCTCACCCGAGGGCAGACTTCAGACCAGCCCTCAGATCCTGATGCCAGGTTACAGGGCTGAGGGGAGCCTGAAATCCACTGGGTCTC
CCTGCTCCACTTGGGAGTCACCTTCTCATCACCTATCCTGGAACTGAATGCAATTACTTAAACTCAGTCTCAGCTTCCTCATCTGTAAAA
TGGGAATAATCTGTCCTTCACAGAGGATTATGGTCATTTAATGAGACAAGATACATAAAGCACTTTGCATGGTGCCCCGAACCTTTTATT
CCTTCCTCTCCTTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGGCTTGGCCCAGGGATTCTTAAATGCATCCAGGTTTTGGCATCAAAG
GGCCCCAAACATGACAATTTACCTATACTCATGGTCTGTTCCCATTCAACTTTAATAGGTTATGTGTGTTTTTTTTTTCTTAAGAGCTGG
GTGGGGGGGTCTCACTATGTTGCCCAGGCTGGCTTTGAACTCCTGGGCTCAAGCAGTCCTCCTGTCTCAGCCTCCTGAGTAGCTGGGACT
ACAAGTGTGTACCACCATGCCTGGCTGAACACTTTTTTTTTTTTGAGACAAGATCCCACTCAGTCACTCAAGCTGAGTGCTGTGGTGTGA
TCACAGCTCATTGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTCCTGCCTCAGCTTCCTGAGTAGCTGGGACTACAGGTGCGCACTACC
ACGCCTGTCTAATTTTTGATTATTTGTAGAGATAGGGTCTCACTATTTTGCCCAGGCTGGTCTCAAACTCCCAGACTCAAGTCATTCTCC
TACCTCGGGCTCCCAAAGTACTGGGATTACAGGCATGAGCACCTGGCCCCTGAACAAATTCTTTAAGTCATATTAGCACCTGCTGCACGC
CGGCACTGTGGAAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGCTCTCTTATCTCAAACCTCAATCCTCAGTGAGGATCACAGGATCTG
AGAAAGGCACCTTGGCCTGGAAACAGCCCCAGATGAGTGAGATTGCTGGTCCTCTCCCGGGATCCCAGGCCCAGGAAAACCTAGCCATGC
TTGCAGTCAGGAGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCAACCTCCTTAGCCAGGAGGACATGTCCCATTTTGCTTAGGAGTTGG
GAGGTACCCTAGAATCACTTAGCTTCAGATGCCAAATTCCATCCACATTCTTTCCTCCAACTCTCTGGCAGTGGGGAACTGCCTCTCCAG
GCAGGGAACTGCTCTGACAGGTCTGATGACTGCCTCCAGGAGGAAGCCCTGGGCACCAATGAAGGTGAGGGGCTGGAGGGCCCAGGACGG
GGAGTCAAGGTCCCCACTCCCAGGACTAAGGGACAGTTTGGCTCCTTTTTCCTGCAGTGGGAGGGGTGAGAAGGGCTGGGGTGTTCTGCA
AGGGCCTGCTCCATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGTGGAGCGGGAGGAGGTGGGGCTTACTGTGAAACTGGGTCAAGATGG
CCTCGGATTTGAGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGCTGTGAGCAGTGCCGAGGGAGGACCAGCTCTGACGGTGAGGTCGGG
TGGGGGACTAGAATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACCAGGAAACCCATAGCATTGACACTAACTGAGAGGCAGCAAAGGCGG
TGACACTCCCCCAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCACAGTTAACTGGTTCTGGGGTAGGAACTGGGGGCCGGAGGGACAGG
GTTCTGGTTCTGGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCCTGGGAAAGAGGGGCTGAGGCCTGAACTGGGCCTAAGGAGAGTGCA
GCTCAGTTCGCACACAACAGCACCCAGCCCTGTCCCCTTGCTGCCTCTACCCAGCCCTGGGCAGTTCCCTCAACAGAGCTCTGCAGCCCC
AAGTGGCAGCTGCTGGCTCAAAGCTGGGACTACATGAAAGTCTGAAAAGAGAATGAGAAGGAGGTGGCGCAAGAGCCTGGACGCACGTGT
GGGAGGCCGTTTTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCATGTGCTCGCGCTCCGTGGCTCTGTTGGTGCCCAGCGTGCGGGGGTG
TGCTGGTGGCCCTGTGGGCCTGTAGGGCAACCCATGCCAACTGCGGAAAAGTAACCAGCACCATACACCCCCCCCAACACAAAACTGGTC
ATTTATTTTTTTTGTTGTCATTGTTATTAGGAAGCAAAAAAATGTACAGTTACAAGAATCATTTTCCAAACAGAGGTTAAATATGAGCTG

>In-frame_TPM3_ENST00000368530_chr1_154142876_-_GPR37L1_ENST00000367282_chr1_202096869_+_6820nt
GTTCCCCCAGGAGAACAATGATGGGGTGGAGGGAGCTGGAAAGACCATATTAGGAACAAAAGGTGGAGCTATGAGCACAGATAAAGACTC
AAGTCTGGGGACCTCCTGGTCACTCAGGCAGCAGCCCCTTCTTTCTTGCCCCAGTCTCCAGTTCTCCAGTGTTCACAGGTGAGCCTACCA
ACAGCCACTGCTCATGATGGAGGCCATCAAGAAAAAGATGCAGATGCTGAAGTTAGACAAGGAGAATGCTCTGGATCGGGCAGAGCAAGC
TGAAGCTGAGCAGAAGCAGGCAGAAGAAAGAAGTAAACAGCTGGAGGATGAGCTGGCAGCCATGCAGAAGAAGCTGAAAGGGACAGAGGA
TGAGCTGGACAAGTATTCTGAAGCTTTGAAGGATGCCCAGGAGAAGCTGGAACTGGCAGAGAAGAAGGCTGCTGATGCTGAGGCTGAGGT
GGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGA
AGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGA
AATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGA
CTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCTAAGTGTTCTGAGCTGGAGGAGGAGCTGAAGAATGTCACCAACAACCTCAA
GTCTCTTGAGGCTCAGGCGGAGAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGC
AGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGGTCTCCTCTCTGGGAGTCACGA
CTTTCAGCCTCTGTGCCCTGGGCATTGACCGCTTCCACGTGGCCACCAGCACCCTGCCCAAGGTGAGGCCCATCGAGCGGTGCCAATCCA
TCCTGGCCAAGTTGGCTGTCATCTGGGTGGGCTCCATGACGCTGGCTGTGCCTGAGCTCCTGCTGTGGCAGCTGGCACAGGAGCCTGCCC
CCACCATGGGCACCCTGGACTCATGCATCATGAAACCCTCAGCCAGCCTGCCCGAGTCCCTGTATTCACTGGTGATGACCTACCAGAACG
CCCGCATGTGGTGGTACTTTGGCTGCTACTTCTGCCTGCCCATCCTCTTCACAGTCACCTGCCAGCTGGTGACATGGCGGGTGCGAGGCC
CTCCAGGGAGGAAGTCAGAGTGCAGGGCCAGCAAGCACGAGCAGTGTGAGAGCCAGCTCAACAGCACCGTGGTGGGCCTGACCGTGGTCT
ACGCCTTCTGCACCCTCCCAGAGAACGTCTGCAACATCGTGGTGGCCTACCTCTCCACCGAGCTGACCCGCCAGACCCTGGACCTCCTGG
GCCTCATCAACCAGTTCTCCACCTTCTTCAAGGGCGCCATCACCCCAGTGCTGCTCCTTTGCATCTGCAGGCCGCTGGGCCAGGCCTTCC
TGGACTGCTGCTGCTGCTGCTGCTGTGAGGAGTGCGGCGGGGCTTCGGAGGCCTCTGCTGCCAATGGGTCGGACAACAAGCTCAAGACCG
AGGTGTCCTCTTCCATCTACTTCCACAAGCCCAGGGAGTCACCCCCACTCCTGCCCCTGGGCACACCTTGCTGAGGCCCCAGTAGGGGTG
GGGAGGGAGGGAGAGGCCGCCACCCCCGCCGGTGTCTGCTGTTCTTTCCCCATAGGTCTTGCTTTGTTGCCTGTCTTGCTGTCTAGGGAT
GGACTTGGTTCCTCTTGTCAAGGTTTGGGAATGTCAAAGCCCCCTCCCCACACAGGGCCTTTCCTGTCCCTTGTGGGGCCTTCCAACCCT
GTCCTTTCCACTGGTGGGCGGTGATGCTTCTAGGTCCTTAGAACTGCCCAGAAACTCTGAGTCCCAGCAGCTGGGAGCCAGAACTTTGCC
TGCCCTCCCTTGGTTCCAGTCTCTCTTCTCTCTCTCTGCCTTGGAACCTGACCATACTTTAGTTGTGCCCTTCCCAGGCATCATCCTCCT
ACCACCAACCTGGGGCCCCATCTTGGAATGGGGGCTCCTTGGGGCCAGCCCAGTGTGGCTCACCACACTCTTCTTTTTTTTTTTTTTTTT
TTTTGAGATGGAGTCTTGCTCTGTTGCCCAGGCTGGAGTACATTTGCCTGATGTCAGCTCCCTGCAACCTCCGCCTCCTGGGTTCAAGCG
ATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGTGTGCACCAACACACCCGGCTAATTTTTGTATTTGTAGAAGAGGCGGGGT
TTCACCATGTTGGCCAGGCTGGTGTTGAACTCCTGACCTCAAGTGATCTGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGTGTGA
GCTGCCACGCCCAGCCCCAGTACACTCTTCTCTGGACCAGATCTGTCCCAGTCCTGGATGCCTCCTCCTACTGGTGCCTTCTTTTCTTCC
AGAGGATTTCTCTCTCCTTCCTCCTCCTTTCTTTGGGATCCCTGGGTTGCCCTGTCCCAACCTCCTTGTTAGGTGCTTTCCCATAGGAGG
CCCTTCTTGAGAAACAATAAACTAGGTAGAACTACCCCTATGCCCATCCACTTTCTTGTGCCACATTCTGGCAGGGCCCAGATGCAGCTG
GGCCTTCCTGGCCTGGCAGTGCCTAGGAGAATTTCTCCTGACCTGGCCTGGCCTGTGGCTGATGTTCAGAACAGCCTTGTGGCCGATGTT
CAGAACAGCCTTGTGGCCCTGGCGACTCCAAGGGTTTTATGGCTTTTGAGGGACAGAGAGGATGGAGGGCTTGGGGAGCCGGAGGACCTA
AGTCCTCATCCTGGCCTAAACCCCATGCTCCTTGGGAAGTCAAAAGCCTGGAAAATATCTCCTCTGGAGCCTTCATCTCTGCTATGCCCT
CTCTCCACAAAGCCCCCCTTGGAGGGAGTCCAGTGGTCTTTCCTCTGTGAGCCCCAGGGCTTCCCAGCCTTTGTCACTCTGAGAGCTGCT
CTTGTTCAGTTTCTTAGAATGGACTGTTTTGCCTGTAGACGGCCCAGCTGCCTGCCCTGGCCTGCCCCCACCCAGCCCCCACTGCACCAC
CCTTCCCGCCAGAGCTCCCACTGCCCCCGGCAGACCCTTCATGCAGCTTCTCCTGTGGGGTCTTGCCCTTGAAGTGCCACTTCCCCCAGC
CCCACCTCTGGTCCCTTCCAGAGGGCACCCTTAGCCTTGTAGGTCCCTGGGAAGCTGGCACAGCATCAACCAGAAGTGATGCCTCAGCCA
GGCCACCAGTCGCTCCCCGCCTGGGAGCTCAGCTTTCCTCAGAACCACCCCCCCTGTCTGAAGCTCTGTCCTGGGTCCCACCAGACTTCT
GCCCACCAGGCCTACCTACAGCATCCACATGGGGCCTCAGGAAGGGCCCCGGGGGCCCAGGGATGGGCAGGGGCAGGGTTTCCAAGCGCC
TGGGGCTCCATTCTCCTCTGTCCACCCACCCACACCCCTTGGCCTCAGCCTGCCCTGTACCCAAGCTTCCCTCCCCCTCTCCTGGGGATC
TTAACGGCCTTGTTCTCTCTCCCTGGCACCCACCCCCAGGGCGGGTGATGCCGCCAAGAGAGAGGGAGGCCGTTGCTAGGTGATGGCGCC
GCCATGCACACACCCTTTGTGCTGGGGAGTGACACCCACCCGTTTCTCAGCAGACCTGTTGCCACGGTGACTGAAGCCCCCAGCTCTGTC
TGTAGAAACTTCAGATGGGTGGGGGAGCAGGTTGGAGAGGGGACCAAAGGCAGGCCTGTCGTGCTGAAGCTCTTGGGGACCGTTTCCTCG
GCATTTCCCCAACTCCTTCTCCACCCCCCTGCCAGGCCCGGAAGTACCACCAGCTTCCTAAGGGATGCAGGAAGGGGCCGGGTGAACTGA
GGTGAAGTCCAGGGCAGGGGAGTCAGACCCCTCAACATCCTGTTTAGGGGTCCTCCTCCACAAAGGGTGCCCTCCACCTCTCCCTCCTGC
TGGTTGGCCGGCTCAGAGATGAAGGGGGAGAGATGGTGGCTCCAAGGCTCTGCCACCGCCACCTCCCAAGCCTGCCAACGTGAATGGCTT
GCAGAATCAGTCAGCAGGCCAGCGGCCTTGGGAAAGAGCCACTGTCCTCGCAGCCTGGGCCAGCTGGGGGAACAATGTAGGGTTTGTTGC
TTAGGGGTCCCAGGCTTGCGGGGGGGTTGGCACATGGTGGGCAGTGGACTTGAGCTGGGATGGTCTGAGGGGGCACTGACACGCTCACCC
GAGGGCAGACTTCAGACCAGCCCTCAGATCCTGATGCCAGGTTACAGGGCTGAGGGGAGCCTGAAATCCACTGGGTCTCCCTGCTCCACT
TGGGAGTCACCTTCTCATCACCTATCCTGGAACTGAATGCAATTACTTAAACTCAGTCTCAGCTTCCTCATCTGTAAAATGGGAATAATC
TGTCCTTCACAGAGGATTATGGTCATTTAATGAGACAAGATACATAAAGCACTTTGCATGGTGCCCCGAACCTTTTATTCCTTCCTCTCC
TTTGGGAATTCAATTCTCTAGTGTTAGGAGCAGGCTTGGCCCAGGGATTCTTAAATGCATCCAGGTTTTGGCATCAAAGGGCCCCAAACA
TGACAATTTACCTATACTCATGGTCTGTTCCCATTCAACTTTAATAGGTTATGTGTGTTTTTTTTTTCTTAAGAGCTGGGTGGGGGGGTC
TCACTATGTTGCCCAGGCTGGCTTTGAACTCCTGGGCTCAAGCAGTCCTCCTGTCTCAGCCTCCTGAGTAGCTGGGACTACAAGTGTGTA
CCACCATGCCTGGCTGAACACTTTTTTTTTTTTGAGACAAGATCCCACTCAGTCACTCAAGCTGAGTGCTGTGGTGTGATCACAGCTCAT
TGCAGCCTCCACTTCCTGGGCTCAAGCGATTCTCCTGCCTCAGCTTCCTGAGTAGCTGGGACTACAGGTGCGCACTACCACGCCTGTCTA
ATTTTTGATTATTTGTAGAGATAGGGTCTCACTATTTTGCCCAGGCTGGTCTCAAACTCCCAGACTCAAGTCATTCTCCTACCTCGGGCT
CCCAAAGTACTGGGATTACAGGCATGAGCACCTGGCCCCTGAACAAATTCTTTAAGTCATATTAGCACCTGCTGCACGCCGGCACTGTGG
AAGGAGGATGCTTGCTTGCTTCCTGGTAACCAGCTCTCTTATCTCAAACCTCAATCCTCAGTGAGGATCACAGGATCTGAGAAAGGCACC
TTGGCCTGGAAACAGCCCCAGATGAGTGAGATTGCTGGTCCTCTCCCGGGATCCCAGGCCCAGGAAAACCTAGCCATGCTTGCAGTCAGG
AGAGGGCAGGGGATAGAGCCCTGGCTCCCATTCAACCTCCTTAGCCAGGAGGACATGTCCCATTTTGCTTAGGAGTTGGGAGGTACCCTA
GAATCACTTAGCTTCAGATGCCAAATTCCATCCACATTCTTTCCTCCAACTCTCTGGCAGTGGGGAACTGCCTCTCCAGGCAGGGAACTG
CTCTGACAGGTCTGATGACTGCCTCCAGGAGGAAGCCCTGGGCACCAATGAAGGTGAGGGGCTGGAGGGCCCAGGACGGGGAGTCAAGGT
CCCCACTCCCAGGACTAAGGGACAGTTTGGCTCCTTTTTCCTGCAGTGGGAGGGGTGAGAAGGGCTGGGGTGTTCTGCAAGGGCCTGCTC
CATTTTCCAGGGTGAAGGAGAGGCCGAGGGAGGTGGAGCGGGAGGAGGTGGGGCTTACTGTGAAACTGGGTCAAGATGGCCTCGGATTTG
AGCAGGCAGGGTCACCAGGCTCTGAGGCAGCAGCTGTGAGCAGTGCCGAGGGAGGACCAGCTCTGACGGTGAGGTCGGGTGGGGGACTAG
AATCCAGCAGAGGAGCGAGGGCAGGGCTCCTACCAGGAAACCCATAGCATTGACACTAACTGAGAGGCAGCAAAGGCGGTGACACTCCCC
CAGGCTCTGTGGGCCCAGCCCTACCCCTGAAGCACAGTTAACTGGTTCTGGGGTAGGAACTGGGGGCCGGAGGGACAGGGTTCTGGTTCT
GGCTCAACCTTGGCTGCTGGTGAGATCCAGGGCCTGGGAAAGAGGGGCTGAGGCCTGAACTGGGCCTAAGGAGAGTGCAGCTCAGTTCGC
ACACAACAGCACCCAGCCCTGTCCCCTTGCTGCCTCTACCCAGCCCTGGGCAGTTCCCTCAACAGAGCTCTGCAGCCCCAAGTGGCAGCT
GCTGGCTCAAAGCTGGGACTACATGAAAGTCTGAAAAGAGAATGAGAAGGAGGTGGCGCAAGAGCCTGGACGCACGTGTGGGAGGCCGTT
TTGTGCAGCGCCATTGTGCTCCCCGGGCGGGCATGTGCTCGCGCTCCGTGGCTCTGTTGGTGCCCAGCGTGCGGGGGTGTGCTGGTGGCC
CTGTGGGCCTGTAGGGCAACCCATGCCAACTGCGGAAAAGTAACCAGCACCATACACCCCCCCCAACACAAAACTGGTCATTTATTTTTT
TTGTTGTCATTGTTATTAGGAAGCAAAAAAATGTACAGTTACAAGAATCATTTTCCAAACAGAGGTTAAATATGAGCTGAAAAGTGTAAA


Top

FusionGenePPI for TPM3_GPR37L1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TPM3KXD1, TFPT, MCC, EIF4A2, TPM3, TP73, NEK2, RAD21, ELAVL1, SP1, CUL3, CDK2, LRRK2, TPM4, SEC23IP, KYNU, TPM2, TPM1, PRDX1, THOC1, CDC123, SF3A2, SEPT9, HSPB1, BRCA1, MDC1, PAXIP1, HSP90AA1, HSP90AB1, FN1, PAN2, HDAC8, FBXO5, TRAP1, PARK2, FASN, FKBP4, FKBP5, MAGED2, CAP1, MCM3, MGEA5, TP53, HSF2, IFIT3, KCNE1, KIFC3, MAGEA11, PBX3, TRIM27, VPS52, TNNT1, TRIP6, MAD1L1, TLK1, OIP5, BLOC1S6, CCHCR1, THAP1, CCDC146, CCDC102B, CCDC114, SYCE1, IKBIP, C1orf216, LCA5L, FAM9C, HDDC3, WASH3P, LURAP1, SHMT2, MOV10, NXF1, CUL7, OBSL1, RNF2, EGFR, DAPK1, ACTN2, AHCYL1, ATP1A1, CKB, CKMT1B, CKMT1A, COX5A, CYC1, OSTF1, ACTN1, ACTN4, ATP5F1, COX4I1, MTCH1, MYH7B, NDUFB10, PSMA2, PSMA6, STMN1, TBCD, UQCRC2, NTRK1, DVL2, HOOK2, ADD1, CAPZA2, MYH9, PPP1CB, PPP1CC, IQGAP1, PDLIM7, ANLN, MYO5C, MYO19, MYO18A, MCM2, RNF20, IMP3, CALCOCO1, JUN, METTL2B, CCDC101, SPAG9, PARK7, PDHA1, VDAC1GPR37L1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TPM3_GPR37L1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TPM3_GPR37L1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTPM3C1836448Nemaline myopathy 19CTD_human;ORPHANET;UNIPROT
HgeneTPM3C0546264Congenital Fiber Type Disproportion5ORPHANET;UNIPROT
HgeneTPM3C0024667Animal Mammary Neoplasms2CTD_human
HgeneTPM3C0024668Mammary Neoplasms, Experimental2CTD_human
HgeneTPM3C0001418Adenocarcinoma1CTD_human
HgeneTPM3C0009375Colonic Neoplasms1CTD_human
HgeneTPM3C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneTPM3C0038356Stomach Neoplasms1CTD_human
HgeneTPM3C0040136Thyroid Neoplasm1CTD_human