FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38819

FusionGeneSummary for TMTC4_FGF14

check button Fusion gene summary
Fusion gene informationFusion gene name: TMTC4_FGF14
Fusion gene ID: 38819
HgeneTgene
Gene symbol

TMTC4

FGF14

Gene ID

84899

2259

Gene nametransmembrane and tetratricopeptide repeat containing 4fibroblast growth factor 14
Synonyms-FGF-14|FHF-4|FHF4|SCA27
Cytomap

13q32.3

13q33.1

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane and TPR repeat-containing protein 4fibroblast growth factor 14bA397O8.2fibroblast growth factor homologous factor 4
Modification date2018051920180519
UniProtAcc

Q5T4D3

Q92915

Ensembl transtripts involved in fusion geneENST00000376234, ENST00000342624, 
ENST00000328767, ENST00000462211, 
ENST00000376131, ENST00000376143, 
ENST00000468052, 
Fusion gene scores* DoF score1 X 1 X 1=14 X 3 X 4=48
# samples 14
** MAII scorelog2(1/1*10)=3.32192809488736log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TMTC4 [Title/Abstract] AND FGF14 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A2-A0D2-01ATMTC4chr13

101277789

-FGF14chr13

102527646

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000376234ENST00000376131TMTC4chr13

101277789

-FGF14chr13

102527646

-
Frame-shitENST00000376234ENST00000376143TMTC4chr13

101277789

-FGF14chr13

102527646

-
In-frameENST00000376234ENST00000468052TMTC4chr13

101277789

-FGF14chr13

102527646

-
Frame-shitENST00000342624ENST00000376131TMTC4chr13

101277789

-FGF14chr13

102527646

-
Frame-shitENST00000342624ENST00000376143TMTC4chr13

101277789

-FGF14chr13

102527646

-
Frame-shitENST00000342624ENST00000468052TMTC4chr13

101277789

-FGF14chr13

102527646

-
Frame-shitENST00000328767ENST00000376131TMTC4chr13

101277789

-FGF14chr13

102527646

-
Frame-shitENST00000328767ENST00000376143TMTC4chr13

101277789

-FGF14chr13

102527646

-
In-frameENST00000328767ENST00000468052TMTC4chr13

101277789

-FGF14chr13

102527646

-
intron-3CDSENST00000462211ENST00000376131TMTC4chr13

101277789

-FGF14chr13

102527646

-
intron-3CDSENST00000462211ENST00000376143TMTC4chr13

101277789

-FGF14chr13

102527646

-
intron-3CDSENST00000462211ENST00000468052TMTC4chr13

101277789

-FGF14chr13

102527646

-

Top

FusionProtFeatures for TMTC4_FGF14


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMTC4

Q5T4D3

FGF14

Q92915

Probably involved in nervous system development andfunction.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TMTC4_FGF14


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMTC4_ENST00000376234_chr13_101277789_-_FGF14_ENST00000468052_chr13_102527646_-_593aa
MAVLDTDLDHILPSSVLPPFWAKLVVGSVAIVCFARSTDGDFVFDDSEAIVNNKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVL
TFRINYYLSGGFHPVGFHVVNILLHSGISVLMVDVFSVLFGGLQYTSKGRRLHLAPRASLLAALLFAVHPVHTECVAGVVGRADLLCALF
FLLSFLGYCKAFRESNKEGAHSSTFWVLLSIFLGAVAMLCKEQGITVLGLNAVFDILVIGKFNVLEIVQKVLHKDKSLENLGMLRNGGLL
FRMTLLTSGGAGMLYVRWRIMGTGPPAFTEVDNPASFADSMLVRAVNYNYYTSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWRVIALAA
LWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSVGYCVLLTFGFGALSKHTKKKKLIAAVVLGIL
FINTLRCVLRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKTVHAMNNLGNILKERNELQEAEELLS

>In-frame_TMTC4_ENST00000328767_chr13_101277789_-_FGF14_ENST00000468052_chr13_102527646_-_482aa
MAVLDTDLDHILPSSVLPPFWAKLVVGSVAIVCFARSTDGDFVFDDSEAIVNNKVAGVVGRADLLCALFFLLSFLGYCKAFRESNKEGAH
SSTFWVLLSIFLGAVAMLCKEQGITVLGLNAVFDILVIGKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIM
GTGPPAFTEVDNPASFADSMLVRAVNYNYYTSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWRVIALAALWFCLIGLICQALCSEDGHKR
RILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSVGYCVLLTFGFGALSKHTKKKKLIAAVVLGILFINTLRCVLRSGEWRSEEQLF
RSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKTVHAMNNLGNILKERNELQEAEELLSLAVQIQPDFAAAWMNLGIVQN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMTC4_ENST00000376234_chr13_101277789_-_FGF14_ENST00000468052_chr13_102527646_-_1779nt
ATGGCCGTGTTGGACACTGATTTGGATCACATTCTTCCATCTTCTGTTCTTCCTCCATTCTGGGCTAAGTTAGTAGTGGGATCGGTTGCC
ATTGTGTGTTTTGCACGCAGCTATGATGGAGACTTTGTCTTTGATGACTCAGAAGCTATTGTTAACAATAAGGACCTCCAAGCAGAAACG
CCCCTGGGGGACCTGTGGCATCATGACTTCTGGGGCAGTAGACTGAGCAGCAACACCAGCCACAAGTCCTACCGGCCTCTCACCGTCCTG
ACTTTCAGGATTAACTACTACCTCTCGGGAGGCTTCCACCCCGTGGGCTTTCACGTGGTCAACATCCTCCTGCACAGTGGCATCTCTGTC
CTCATGGTGGACGTCTTCTCGGTTCTGTTTGGCGGCCTGCAGTACACCAGTAAAGGCCGGAGGCTGCACCTCGCCCCCAGGGCGTCCCTG
CTGGCCGCGCTGCTGTTTGCTGTCCATCCTGTGCACACCGAGTGTGTTGCTGGTGTTGTCGGCCGTGCAGACCTCCTGTGTGCCCTGTTC
TTCTTGTTATCTTTCCTTGGCTACTGTAAAGCATTTAGAGAAAGTAACAAGGAGGGAGCGCATTCTTCCACCTTCTGGGTGCTGCTGAGT
ATCTTTCTGGGAGCAGTGGCCATGCTGTGCAAAGAGCAAGGGATCACTGTGCTGGGTTTAAATGCGGTATTTGACATCTTGGTGATAGGC
AAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCATTAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTC
TTCAGAATGACCCTGCTCACCTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCGGCCTTCACCGAG
GTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCGTAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTG
TGTCCCTGGTGGCTGTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGGGTAATTGCACTTGCAGCA
CTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGTGCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTT
CTCGTTATCCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCAGAGCGTGTCCTCTACCTCCCCAGCGTTGGG
TACTGTGTGCTGCTGACTTTTGGATTCGGAGCCCTGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTA
TTCATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGTGTCCCCTC
AATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGA
TTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCT
TTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAG

>In-frame_TMTC4_ENST00000328767_chr13_101277789_-_FGF14_ENST00000468052_chr13_102527646_-_1446nt
ATGGCCGTGTTGGACACTGATTTGGATCACATTCTTCCATCTTCTGTTCTTCCTCCATTCTGGGCTAAGTTAGTAGTGGGATCGGTTGCC
ATTGTGTGTTTTGCACGCAGCTATGATGGAGACTTTGTCTTTGATGACTCAGAAGCTATTGTTAACAATAAGGTTGCTGGTGTTGTCGGC
CGTGCAGACCTCCTGTGTGCCCTGTTCTTCTTGTTATCTTTCCTTGGCTACTGTAAAGCATTTAGAGAAAGTAACAAGGAGGGAGCGCAT
TCTTCCACCTTCTGGGTGCTGCTGAGTATCTTTCTGGGAGCAGTGGCCATGCTGTGCAAAGAGCAAGGGATCACTGTGCTGGGTTTAAAT
GCGGTATTTGACATCTTGGTGATAGGCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCATTAGAGAATCTC
GGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCACCTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATG
GGCACGGGCCCGCCGGCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCGTAAACTACAATTACTAC
TATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCTGTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGC
GACTGGAGGGTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGTGCTCTGAAGACGGCCACAAGAGA
AGGATCCTTACTCTGGGCCTGGGATTTCTCGTTATCCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCAGAG
CGTGTCCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCCTGAGCAAACATACCAAGAAAAAGAAACTC
ATTGCCGCTGTCGTGCTGGGAATCTTATTCATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTC
AGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAACCAGACAGCTGCC
ATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAG
CTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAAT
AGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMTC4_ENST00000376234_chr13_101277789_-_FGF14_ENST00000468052_chr13_102527646_-_2535nt
GCGGGAGGCGCGGCGCGGGGGGGGTCGGGTGCGCGGCGGGCGGCCCCTCCCCCTGCCAGGTCCGGGCGGGTGCCTGGAGCCGCCAGAGTT
TCCGCACCCGGGAGGGAGATGCGGCCGGGGCTCAGGCTCCTTGCAGATTCCTAACCAGCATAATGCTGGAGCCGGGAGCCACCAACCTGC
AGTTTTCAGAATGGCCGTGTTGGACACTGATTTGGATCACATTCTTCCATCTTCTGTTCTTCCTCCATTCTGGGCTAAGTTAGTAGTGGG
ATCGGTTGCCATTGTGTGTTTTGCACGCAGCTATGATGGAGACTTTGTCTTTGATGACTCAGAAGCTATTGTTAACAATAAGGACCTCCA
AGCAGAAACGCCCCTGGGGGACCTGTGGCATCATGACTTCTGGGGCAGTAGACTGAGCAGCAACACCAGCCACAAGTCCTACCGGCCTCT
CACCGTCCTGACTTTCAGGATTAACTACTACCTCTCGGGAGGCTTCCACCCCGTGGGCTTTCACGTGGTCAACATCCTCCTGCACAGTGG
CATCTCTGTCCTCATGGTGGACGTCTTCTCGGTTCTGTTTGGCGGCCTGCAGTACACCAGTAAAGGCCGGAGGCTGCACCTCGCCCCCAG
GGCGTCCCTGCTGGCCGCGCTGCTGTTTGCTGTCCATCCTGTGCACACCGAGTGTGTTGCTGGTGTTGTCGGCCGTGCAGACCTCCTGTG
TGCCCTGTTCTTCTTGTTATCTTTCCTTGGCTACTGTAAAGCATTTAGAGAAAGTAACAAGGAGGGAGCGCATTCTTCCACCTTCTGGGT
GCTGCTGAGTATCTTTCTGGGAGCAGTGGCCATGCTGTGCAAAGAGCAAGGGATCACTGTGCTGGGTTTAAATGCGGTATTTGACATCTT
GGTGATAGGCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCATTAGAGAATCTCGGCATGCTCAGGAACGG
GGGCCTCCTCTTCAGAATGACCCTGCTCACCTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCGGC
CTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCGTAAACTACAATTACTACTATTCATTGAATGCCTG
GCTGCTGCTGTGTCCCTGGTGGCTGTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGGGTAATTGC
ACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGTGCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGG
CCTGGGATTTCTCGTTATCCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCAGAGCGTGTCCTCTACCTCCC
CAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCCTGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCT
GGGAATCTTATTCATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGT
GTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGA
AGCTGTAAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTGAGGA
GCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA
AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGCCCCAGCTCAA
GGGTATAGTGACCAGGTTATATTGCAGGCAAGGCTACTACTTGCAAATGCACCCCGATGGAGCTCTCGATGGAACCAAGGATGACAGCAC
TAATTCTACACTCTTCAACCTCATACCAGTGGGACTACGTGTTGTTGCCATCCAGGGAGTGAAAACAGGGTTGTATATAGCCATGAATGG
AGAAGGTTACCTCTACCCATCAGTAAGTAAGACGCCAAAGATCTCGGCCATTCGTTCAATGCATGTAAAATAACAATGGCAGCAACAACA
AAAAGAAAGTTCTATGTCTGTTGTTTCTGCCAGTTTTTGCCTTAGTATTTGATCTTTGCGAGAATGCTTAGAAGCTGTTTATTATTCACC
AGTGTTTAGTAATATGAGTTTATCTAAAGGAAGTGTAATACTATGTCTTAAATAGTGCTTTTGCCATATTTTAAAAAATAACCTAGTATA
CACGTGAATCTAATCTTTTGTATTTCTAGTTAGAAATGCACTTATCTTAGAGAGTTTCTTATAATGTTTTTAAAAGAAACAATATGAATT

>In-frame_TMTC4_ENST00000328767_chr13_101277789_-_FGF14_ENST00000468052_chr13_102527646_-_2097nt
GAGATGCGGCCGGGGCTCAGGCTCCTTGCAGATTCCTAACCAGCATAATGCTGGAGCCGGGAGCCACCAACCTGCAGTTTTCAGAATGGC
CGTGTTGGACACTGATTTGGATCACATTCTTCCATCTTCTGTTCTTCCTCCATTCTGGGCTAAGTTAGTAGTGGGATCGGTTGCCATTGT
GTGTTTTGCACGCAGCTATGATGGAGACTTTGTCTTTGATGACTCAGAAGCTATTGTTAACAATAAGGTTGCTGGTGTTGTCGGCCGTGC
AGACCTCCTGTGTGCCCTGTTCTTCTTGTTATCTTTCCTTGGCTACTGTAAAGCATTTAGAGAAAGTAACAAGGAGGGAGCGCATTCTTC
CACCTTCTGGGTGCTGCTGAGTATCTTTCTGGGAGCAGTGGCCATGCTGTGCAAAGAGCAAGGGATCACTGTGCTGGGTTTAAATGCGGT
ATTTGACATCTTGGTGATAGGCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCATTAGAGAATCTCGGCAT
GCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCACCTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCAC
GGGCCCGCCGGCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCGTAAACTACAATTACTACTATTC
ATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCTGTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTG
GAGGGTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGTGCTCTGAAGACGGCCACAAGAGAAGGAT
CCTTACTCTGGGCCTGGGATTTCTCGTTATCCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCAGAGCGTGT
CCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCCTGAGCAAACATACCAAGAAAAAGAAACTCATTGC
CGCTGTCGTGCTGGGAATCTTATTCATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAG
TGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAG
ATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACA
GGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCT
GAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCT
GCCCCAGCTCAAGGGTATAGTGACCAGGTTATATTGCAGGCAAGGCTACTACTTGCAAATGCACCCCGATGGAGCTCTCGATGGAACCAA
GGATGACAGCACTAATTCTACACTCTTCAACCTCATACCAGTGGGACTACGTGTTGTTGCCATCCAGGGAGTGAAAACAGGGTTGTATAT
AGCCATGAATGGAGAAGGTTACCTCTACCCATCAGTAAGTAAGACGCCAAAGATCTCGGCCATTCGTTCAATGCATGTAAAATAACAATG
GCAGCAACAACAAAAAGAAAGTTCTATGTCTGTTGTTTCTGCCAGTTTTTGCCTTAGTATTTGATCTTTGCGAGAATGCTTAGAAGCTGT
TTATTATTCACCAGTGTTTAGTAATATGAGTTTATCTAAAGGAAGTGTAATACTATGTCTTAAATAGTGCTTTTGCCATATTTTAAAAAA
TAACCTAGTATACACGTGAATCTAATCTTTTGTATTTCTAGTTAGAAATGCACTTATCTTAGAGAGTTTCTTATAATGTTTTTAAAAGAA


Top

FusionGenePPI for TMTC4_FGF14


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMTC4ELAVL1, NXF1, NRG1, PEX19, TXNDC15, COL1A1, HERC3, C1orf186, CD79B, OS9, SCN3B, PCDH12, GORASP1, NEUROG3, NR4A1, SLC6A15, CCDC40, CDH8, SYP, CSGALNACT2, CES3, PMEL, EDEM2FGF14SCN8A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMTC4_FGF14


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMTC4_FGF14


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneFGF14C1836383SPINOCEREBELLAR ATAXIA 272CTD_human;ORPHANET;UNIPROT
TgeneFGF14C0007302Cartilage Diseases1CTD_human
TgeneFGF14C0009241Cognition Disorders1CTD_human