FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38808

FusionGeneSummary for TMTC3_EIF4B

check button Fusion gene summary
Fusion gene informationFusion gene name: TMTC3_EIF4B
Fusion gene ID: 38808
HgeneTgene
Gene symbol

TMTC3

EIF4B

Gene ID

160418

1975

Gene nametransmembrane and tetratricopeptide repeat containing 3eukaryotic translation initiation factor 4B
SynonymsLIS8|SMILEEIF-4B|PRO1843
Cytomap

12q21.32

12q13.13

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane and TPR repeat-containing protein 3eukaryotic translation initiation factor 4B
Modification date2018051920180523
UniProtAcc

Q6ZXV5

P23588

Ensembl transtripts involved in fusion geneENST00000266712, ENST00000262056, 
ENST00000551527, ENST00000420463, 
ENST00000416762, 
Fusion gene scores* DoF score15 X 7 X 5=5253 X 3 X 2=18
# samples 143
** MAII scorelog2(14/525*10)=-1.90689059560852
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TMTC3 [Title/Abstract] AND EIF4B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EE-A29D-06ATMTC3chr12

88570096

+EIF4Bchr12

53410257

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000266712ENST00000262056TMTC3chr12

88570096

+EIF4Bchr12

53410257

+
5CDS-3UTRENST00000266712ENST00000551527TMTC3chr12

88570096

+EIF4Bchr12

53410257

+
5CDS-3UTRENST00000266712ENST00000420463TMTC3chr12

88570096

+EIF4Bchr12

53410257

+
5CDS-3UTRENST00000266712ENST00000416762TMTC3chr12

88570096

+EIF4Bchr12

53410257

+

Top

FusionProtFeatures for TMTC3_EIF4B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMTC3

Q6ZXV5

EIF4B

P23588

Involved in the positive regulation of proteasomalprotein degradation in the endoplasmic reticulum (ER), and thecontrol of ER stress response. {ECO:0000269|PubMed:21603654}. Required for the binding of mRNA to ribosomes. Functionsin close association with EIF4-F and EIF4-A. Binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP. Promotes theATPase activity and the ATP-dependent RNA unwinding activity ofboth EIF4-A and EIF4-F.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014412_445477915RepeatNote=TPR 1
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014446_479477915RepeatNote=TPR 2
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014136_158477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014167_187477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014194_214477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014232_252477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014318_338477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014354_374477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014377_397477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+101494_114477915TransmembraneHelical
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+10149_29477915TransmembraneHelical
TgeneEIF4Bchr12:88570096chr12:53410257ENST00000262056+015164_3314612Compositional biasNote=Arg-rich
TgeneEIF4Bchr12:88570096chr12:53410257ENST00000262056+015169_3254612Compositional biasNote=Asp-rich
TgeneEIF4Bchr12:88570096chr12:53410257ENST00000262056+01596_1734612DomainRRM

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014481_513477915RepeatNote=TPR 3
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014528_562477915RepeatNote=TPR 4
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014563_596477915RepeatNote=TPR 5
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014597_631477915RepeatNote=TPR 6
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014669_702477915RepeatNote=TPR 7
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014704_736477915RepeatNote=TPR 8
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014737_771477915RepeatNote=TPR 9
HgeneTMTC3chr12:88570096chr12:53410257ENST00000266712+1014773_805477915RepeatNote=TPR 10


Top

FusionGeneSequence for TMTC3_EIF4B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMTC3_ENST00000266712_chr12_88570096_+_EIF4B_ENST00000262056_chr12_53410257_+_1085aa
MANINLKEITLIVGVVTACTWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSYRPLTVLTFRLNTLLSELKPM
STHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSTTRSKGPDNSIIWTPIALTVFL
VAVATLCKEQGITVVGICCVTEVFIAQGTTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNP
AAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGMLGVFSIRYSGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLTVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLKTFHRNWDWESETTLFMSALKVNKNNAKLWN
NVGHALENEKNFERALKYFLQATHVQPAKKKNKKGKTISLTDFLAEDGGTGGGSTTVSKPVSWADETDDLEGDVSTTWHSNDDDVTRAPP
IDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPTDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGTAEFEDLDSLLSALSLN
EESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKTRDRTDSDRTRDGTRDGTRDGPRR
DMDRTGGRDRTDDRGSRDTDRGTDSRIGSGRRAFGSGTRRDDDYRGGGDRTEDRTDRRDDRSWSSRDDYSRDDTRRDDRGPPQRPKLNLK
PRSTPKEDDSSASTSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRTGSESSQT
GTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQP
SEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKTAALSVDGEDENEGE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMTC3_ENST00000266712_chr12_88570096_+_EIF4B_ENST00000262056_chr12_53410257_+_3255nt
ATGGCTAATATTAACCTAAAAGAAATAACCTTAATAGTAGGTGTGGTTACTGCCTGCTATTGGAACAGCCTCTTTTGTGGTTTTGTTTTT
GATGATGTTTCAGCAATACTGGATAACAAAGACTTGCATCCATCTACACCTTTAAAAACTTTATTTCAAAATGACTTCTGGGGAACCCCT
ATGTCTGAGGAGAGAAGCCACAAGTCTTACCGTCCCTTAACAGTATTGACATTTCGCTTAAATTATTTGTTAAGTGAACTAAAACCAATG
TCATATCATCTCCTGAATATGATTTTTCATGCTGTGGTTAGTGTGATATTTCTCAAAGTATGCAAACTTTTTCTGGACAACAAGAGTAGT
GTGATTGCTTCTTTACTTTTTGCAGTGCACCCAATACATACAGAAGCAGTAACAGGAGTTGTTGGAAGAGCAGAACTTTTGTCATCTATC
TTTTTTCTAGCAGCTTTTTTGTCATATACCAGATCAAAAGGACCAGACAATTCCATAATATGGACTCCAATTGCCTTGACAGTGTTTTTA
GTGGCTGTTGCAACATTATGTAAAGAACAAGGAATAACAGTTGTAGGAATTTGCTGTGTGTATGAAGTGTTTATTGCCCAGGGGTATACT
TTGCCATTACTATGTACTACTGCTGGACAGTTTCTCCGTGGAAAGGGTAGCATTCCATTTTCTATGCTGCAGACACTAGTAAAACTCATT
GTCTTGATGTTCAGTACATTATTACTTGTTGTGATTAGAGTCCAGGTTATTCAATCCCAACTTCCAGTATTCACCAGGTTTGATAACCCA
GCTGCTGTAAGCCCAACTCCTACAAGGCAACTAACTTTTAACTACCTCCTTCCTGTGAATGCTTGGTTGTTATTAAATCCTTCAGAGCTC
TGCTGTGATTGGACCATGGGAACAATACCACTTATAGAGTCATTACTAGATATTCGAAATCTGGCCACATTTACTTTCTTTTGTTTTCTG
GGGATGTTGGGAGTATTCAGTATCAGATACTCTGGTGATTCCTCCAAGACTGTTTTAATGGCGCTTTGTTTAATGGCATTACCATTTATT
CCTGCATCGAACCTTTTTTTTCCAGTTGGATTTGTTGTTGCCGAGCGAGTATTATATGTTCCCAGCATGGGGTTCTGTATTTTGGTAGCC
CATGGATGGCAGAAAATATCAACAAAAAGTGTATTTAAAAAGCTATCCTGGATTTGTCTGTCTATGGTGATACTCACTCATTCCTTAAAA
ACATTCCACAGAAATTGGGATTGGGAGTCTGAATATACATTGTTTATGTCAGCCTTGAAGGTAAATAAAAATAATGCCAAACTTTGGAAT
AATGTGGGTCATGCTCTGGAAAATGAAAAGAACTTTGAGAGAGCTTTGAAATACTTCTTACAGGCTACCCATGTTCAGCCAGCAAAAAAG
AAGAATAAGAAGGGGAAGACTATCTCCCTAACAGACTTTCTGGCTGAGGATGGGGGTACTGGTGGAGGAAGCACCTATGTTTCCAAACCA
GTCAGCTGGGCTGATGAAACGGATGACCTGGAAGGAGATGTTTCGACCACTTGGCACAGTAACGATGACGATGTGTATAGGGCGCCTCCA
ATTGACCGTTCCATCCTTCCCACTGCTCCACGGGCTGCTCGGGAACCCAATATCGACCGGAGCCGTCTTCCCAAATCGCCACCCTACACT
GCTTTTCTAGGAAACCTACCCTATGATGTTACAGAAGAGTCAATTAAGGAATTCTTTCGAGGATTAAATATCAGTGCAGTGCGTTTACCA
CGTGAACCCAGCAATCCAGAGAGGTTGAAAGGTTTTGGTTATGCTGAATTTGAGGACCTGGATTCCCTGCTCAGTGCCCTGAGTCTCAAT
GAAGAGTCTCTAGGTAACAGGAGAATTCGAGTGGACGTTGCTGATCAAGCACAGGATAAAGACAGGGATGATCGTTCTTTTGGCCGTGAT
AGAAATCGGGATTCTGACAAAACAGATACAGACTGGAGGGCTCGTCCTGCTACAGACAGCTTTGATGACTACCCACCTAGAAGAGGTGAT
GATAGCTTTGGAGACAAGTATCGAGATCGTTATGATTCAGACCGGTATCGGGATGGGTATCGGGATGGGTATCGGGATGGCCCACGCCGG
GATATGGATCGATATGGTGGCCGGGATCGCTATGATGACCGAGGCAGCAGAGACTATGATAGAGGCTATGATTCCCGGATAGGCAGTGGC
AGAAGAGCATTTGGCAGTGGGTATCGCAGGGATGATGACTACAGAGGAGGCGGGGACCGCTATGAAGACCGATATGACAGACGGGATGAT
CGGTCGTGGAGCTCCAGAGATGATTACTCTCGGGATGATTATAGGCGTGATGATAGAGGTCCCCCCCAAAGACCCAAACTGAATCTAAAG
CCTCGGAGTACTCCTAAGGAAGATGATTCCTCTGCTAGTACCTCCCAGTCCACTCGAGCTGCTTCTATCTTTGGAGGGGCAAAGCCTGTT
GACACAGCTGCTAGAGAAAGAGAAGTAGAAGAACGGCTACAGAAGGAACAAGAGAAGTTGCAGCGTCAGCTGGATGAGCCAAAACTAGAA
CGACGGCCTCGGGAGAGACACCCAAGCTGGCGAAGTGAAGAAACTCAGGAACGGGAACGGTCGAGGACAGGAAGTGAGTCATCACAAACT
GGGACCTCCACCACATCTAGCAGAAATGCACGAAGGAGAGAGAGTGAGAAGTCTCTAGAAAATGAAACACTCAATAAGGAGGAAGATTGC
CACTCTCCAACTTCTAAACCTCCCAAACCTGATCAGCCCCTAAAGGTAATGCCAGCCCCTCCACCAAAGGAGAATGCTTGGGTGAAGCGA
AGTTCTAACCCTCCTGCTCGATCTCAGAGCTCAGACACAGAGCAGCAGTCCCCTACAAGTGGTGGGGGAAAAGTAGCTCCAGCTCAACCA
TCTGAGGAAGGACCAGGAAGGAAAGATGAAAATAAAGTAGATGGGATGAATGCCCCAAAAGGCCAAACTGGGAACTCTAGCCGTGGTCCA
GGCGACGGAGGGAACAGAGACCACTGGAAGGAGTCAGATAGGAAAGATGGCAAAAAGGATCAAGACTCCAGATCTGCACCTGAGCCAAAG
AAACCTGAGGAAAATCCAGCTTCCAAGTTCAGTTCTGCAAGCAAGTATGCTGCTCTCTCTGTTGATGGTGAAGATGAAAATGAGGGAGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMTC3_ENST00000266712_chr12_88570096_+_EIF4B_ENST00000262056_chr12_53410257_+_5461nt
ATGCAACGCGTAAGACTGCGACGGTACCGGGGCGGCGGGGAAGGACCGAGAGGCGGGAGGAGCAGCGGCTCAGGCGCCTGCAAACTGGTG
GCCTGAACGAGGTAGACCATGACTGTGGTTTCAGTGGCGTCACTCGCTGGGCTGCTCTTCCTGAGGTTTTCCTAAGCCATCCCCTGGCGG
AACCGCCCCCAGTTTTTGTCCAGAAGTGCTTATAGAAAAGATGGCTAATATTAACCTAAAAGAAATAACCTTAATAGTAGGTGTGGTTAC
TGCCTGCTATTGGAACAGCCTCTTTTGTGGTTTTGTTTTTGATGATGTTTCAGCAATACTGGATAACAAAGACTTGCATCCATCTACACC
TTTAAAAACTTTATTTCAAAATGACTTCTGGGGAACCCCTATGTCTGAGGAGAGAAGCCACAAGTCTTACCGTCCCTTAACAGTATTGAC
ATTTCGCTTAAATTATTTGTTAAGTGAACTAAAACCAATGTCATATCATCTCCTGAATATGATTTTTCATGCTGTGGTTAGTGTGATATT
TCTCAAAGTATGCAAACTTTTTCTGGACAACAAGAGTAGTGTGATTGCTTCTTTACTTTTTGCAGTGCACCCAATACATACAGAAGCAGT
AACAGGAGTTGTTGGAAGAGCAGAACTTTTGTCATCTATCTTTTTTCTAGCAGCTTTTTTGTCATATACCAGATCAAAAGGACCAGACAA
TTCCATAATATGGACTCCAATTGCCTTGACAGTGTTTTTAGTGGCTGTTGCAACATTATGTAAAGAACAAGGAATAACAGTTGTAGGAAT
TTGCTGTGTGTATGAAGTGTTTATTGCCCAGGGGTATACTTTGCCATTACTATGTACTACTGCTGGACAGTTTCTCCGTGGAAAGGGTAG
CATTCCATTTTCTATGCTGCAGACACTAGTAAAACTCATTGTCTTGATGTTCAGTACATTATTACTTGTTGTGATTAGAGTCCAGGTTAT
TCAATCCCAACTTCCAGTATTCACCAGGTTTGATAACCCAGCTGCTGTAAGCCCAACTCCTACAAGGCAACTAACTTTTAACTACCTCCT
TCCTGTGAATGCTTGGTTGTTATTAAATCCTTCAGAGCTCTGCTGTGATTGGACCATGGGAACAATACCACTTATAGAGTCATTACTAGA
TATTCGAAATCTGGCCACATTTACTTTCTTTTGTTTTCTGGGGATGTTGGGAGTATTCAGTATCAGATACTCTGGTGATTCCTCCAAGAC
TGTTTTAATGGCGCTTTGTTTAATGGCATTACCATTTATTCCTGCATCGAACCTTTTTTTTCCAGTTGGATTTGTTGTTGCCGAGCGAGT
ATTATATGTTCCCAGCATGGGGTTCTGTATTTTGGTAGCCCATGGATGGCAGAAAATATCAACAAAAAGTGTATTTAAAAAGCTATCCTG
GATTTGTCTGTCTATGGTGATACTCACTCATTCCTTAAAAACATTCCACAGAAATTGGGATTGGGAGTCTGAATATACATTGTTTATGTC
AGCCTTGAAGGTAAATAAAAATAATGCCAAACTTTGGAATAATGTGGGTCATGCTCTGGAAAATGAAAAGAACTTTGAGAGAGCTTTGAA
ATACTTCTTACAGGCTACCCATGTTCAGCCAGCAAAAAAGAAGAATAAGAAGGGGAAGACTATCTCCCTAACAGACTTTCTGGCTGAGGA
TGGGGGTACTGGTGGAGGAAGCACCTATGTTTCCAAACCAGTCAGCTGGGCTGATGAAACGGATGACCTGGAAGGAGATGTTTCGACCAC
TTGGCACAGTAACGATGACGATGTGTATAGGGCGCCTCCAATTGACCGTTCCATCCTTCCCACTGCTCCACGGGCTGCTCGGGAACCCAA
TATCGACCGGAGCCGTCTTCCCAAATCGCCACCCTACACTGCTTTTCTAGGAAACCTACCCTATGATGTTACAGAAGAGTCAATTAAGGA
ATTCTTTCGAGGATTAAATATCAGTGCAGTGCGTTTACCACGTGAACCCAGCAATCCAGAGAGGTTGAAAGGTTTTGGTTATGCTGAATT
TGAGGACCTGGATTCCCTGCTCAGTGCCCTGAGTCTCAATGAAGAGTCTCTAGGTAACAGGAGAATTCGAGTGGACGTTGCTGATCAAGC
ACAGGATAAAGACAGGGATGATCGTTCTTTTGGCCGTGATAGAAATCGGGATTCTGACAAAACAGATACAGACTGGAGGGCTCGTCCTGC
TACAGACAGCTTTGATGACTACCCACCTAGAAGAGGTGATGATAGCTTTGGAGACAAGTATCGAGATCGTTATGATTCAGACCGGTATCG
GGATGGGTATCGGGATGGGTATCGGGATGGCCCACGCCGGGATATGGATCGATATGGTGGCCGGGATCGCTATGATGACCGAGGCAGCAG
AGACTATGATAGAGGCTATGATTCCCGGATAGGCAGTGGCAGAAGAGCATTTGGCAGTGGGTATCGCAGGGATGATGACTACAGAGGAGG
CGGGGACCGCTATGAAGACCGATATGACAGACGGGATGATCGGTCGTGGAGCTCCAGAGATGATTACTCTCGGGATGATTATAGGCGTGA
TGATAGAGGTCCCCCCCAAAGACCCAAACTGAATCTAAAGCCTCGGAGTACTCCTAAGGAAGATGATTCCTCTGCTAGTACCTCCCAGTC
CACTCGAGCTGCTTCTATCTTTGGAGGGGCAAAGCCTGTTGACACAGCTGCTAGAGAAAGAGAAGTAGAAGAACGGCTACAGAAGGAACA
AGAGAAGTTGCAGCGTCAGCTGGATGAGCCAAAACTAGAACGACGGCCTCGGGAGAGACACCCAAGCTGGCGAAGTGAAGAAACTCAGGA
ACGGGAACGGTCGAGGACAGGAAGTGAGTCATCACAAACTGGGACCTCCACCACATCTAGCAGAAATGCACGAAGGAGAGAGAGTGAGAA
GTCTCTAGAAAATGAAACACTCAATAAGGAGGAAGATTGCCACTCTCCAACTTCTAAACCTCCCAAACCTGATCAGCCCCTAAAGGTAAT
GCCAGCCCCTCCACCAAAGGAGAATGCTTGGGTGAAGCGAAGTTCTAACCCTCCTGCTCGATCTCAGAGCTCAGACACAGAGCAGCAGTC
CCCTACAAGTGGTGGGGGAAAAGTAGCTCCAGCTCAACCATCTGAGGAAGGACCAGGAAGGAAAGATGAAAATAAAGTAGATGGGATGAA
TGCCCCAAAAGGCCAAACTGGGAACTCTAGCCGTGGTCCAGGCGACGGAGGGAACAGAGACCACTGGAAGGAGTCAGATAGGAAAGATGG
CAAAAAGGATCAAGACTCCAGATCTGCACCTGAGCCAAAGAAACCTGAGGAAAATCCAGCTTCCAAGTTCAGTTCTGCAAGCAAGTATGC
TGCTCTCTCTGTTGATGGTGAAGATGAAAATGAGGGAGAAGATTATGCCGAATAGACCTCTACATCCTGTGCTTTTCTCCTAGTTTCTCT
CCACCCTGGAACATTCGAGAGCAAATCAAAACCTCTATCCAGACAAGACAAAATAAAACTCACCATCTCCTGAAGACCTTTCTTACCTTT
TTTTAAAAACAAAAAATGAAATTATTTTGCATGCTGCTGCAGCCTTTAAAGTATTGAAGTAACTGGAGAATTGCCAATACAGCCAGAGAG
AAAGGGACTACAGCTTTTTAGAGGAAAAGTTGTGGTGCGTTATGTCACCATGCAGTTGCCAGTGTGATTAGTGCCTAGGGGTCTCCATTT
AGCAGAAATGGTAATGACAGTGATATAATGCCTGGAACCTGGTTGGGCAGTAGGGGAGGGAGGTAGAAGGAAAAGTGTGAGATTTCTACC
TTTTAGTTTTTATCCTATTGTGGCATATATGAATTCTCAAACATTATCTGAATAAATTTTCCACTCTTGGAAAGGTAGATTTAGCCTCAA
GTTGTTCTAGTCTCCAGGAGGCTGCCAGCCCCTCCTCTTATTTAATTCTGAGTTTTGGGGGCCAGCCTAGAGGGAATTCCTTTTTTTTTT
TTAACCCCCCAGGGGGGTAGTTGGGAGTGAGACTATAGGCCATAAAGAATGGGACTGCATTGGACCAAAATAAATGGGAAAATCGTGGTT
TGAAAAGAAGCTTTTGGGAAGTGATGAGTCATTTTGCACCAGGTAATAGGGGAAAATTGTGTGACCTCCAGCAAACACATGAATGGTTAT
TTCCTGGAGCCGGAAGCACTTGGGGGTCGTGGTAATTCCCAGTGTTTTCTGTGTCCTAGTTTTACCCTTTCTAAACACTGTCCTTTTTGA
AAGTTTTGAATATATCCACATTCTATTGAAACCTTGAAACTAAAAATTTAGACTCTTATCATCATCTTAAGTTCTTCATGCTACTCTTAA
CCTCCCAAAAAGCAGTATCTAAGTCACATACATGATGTCTTGGGCATTTTCTCAGCCATGGAGAACTCTGAAAGGAAGAATCGCTGCTTT
TCTCAAGCAAATCGGTTTCTTGATGTCTTTTGGTTCTCCTTGCCTGCTCCTGATGCTTGGACCCCTTTTATTGATCAGAGTGCTCTAGAA
TAATGGATGGTCTTGGATGATGGATAAATAGGGACAGGGACAGTTAAATTGGGAGCCTTTCTTACAACCTTGATGGGATTTTTCCCCCCA
AGTTTCCTTCTCCACTGAAATGCCACACTAATGCTTGTTGGATTCATGAGGTGGCCAGACCAATGTGTTGTTTTGTTGTTGTTTTTTTAA
GCTTCCCTTGAGAGAATAAATGGTAATGGAGAGAACTATTTAACAAGGTCCTGGTTTCTCTTGCAACACAGTAGCTAAACTTGCCTGCTT
TTATATGCATTTTTGTAGGGATCAGCTTGGTAGACAGTATTAGCGGAGAAACACCTTGATCTTGGTTTGCAAGCCCTTCTCCCATCAGTC
CTAGATTAGGCCCTGTTCAGCCATGCAGGGGTGTTGGTTTATGCGTGCTGCAGCAGTGGGCATAATGAATATAATTTACCCAGTGGACAA
AGGTGTGTACCAAGTGAATTTAAATAATTGGTGTGGATTGGCCAGTAGCTAAGAAGTGGGCTTTTAAAGAGTATTGAAGATTGAAAGGGT
TTTTCTTTCTTTTTTAAAAAAGAAAAACAAACTATTGATTGTAGATAATGAAAAGCTAGGGTTTGCCCTCTTCATGTCTACTCTCCTTCC
AAATAGTTATATCCAAAACTGTTTTTCCCTCTCCCCTACCTTGTCCCCCCTATTAAAATAGAAACAGGGATTGATTAATGTCCCGCTCCT
GAATACATGTAAAATTTGTACAAAAATATCTTCTATGAAAATGATTTGTAATCTGTAGACTTATTACCTGGGAGATGTCTTGATGTAAAA


Top

FusionGenePPI for TMTC3_EIF4B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMTC3DAB1, NRG1, SYNE4, GABRE, DNASE2B, B3GNT2, ENPP6, ZACN, HTR3C, COTL1, TCTN3, TCTN1, LAMB3, CDH5, DEFA5, CHRND, LYZL2, SCN3B, HTR3A, NCEH1, TRHDE, TRIM25EIF4BPABPC1, EIF3B, EIF4B, EIF3A, EIF3F, USP11, USP7, ALK, KBTBD7, AGO3, AGO4, ELAVL1, ARRB1, ARRB2, TSG101, TERF1, TINF2, ACD, POT1, CUL3, EIF4A1, EIF4G1, RPL29, PHAX, EIF4G2, MYH9, CSTF2, NUP107, NUP153, SLC4A1AP, CCT6B, POLR1C, MAGOH, EIF4A3, SMURF1, YWHAE, CSNK2A1, PAN2, FBXO6, PARK2, CTNNA1, CUL4B, NARS, OSBP, SAMHD1, SEC23A, XRCC5, PRMT3, SF1, XPO7, ASB2, ZBTB1, SMAD3, FBXW11, MAEL, CCT6A, CFL1, CTPS1, DDX39A, DOHH, LASP1, GSPT1, HSPB1, IMPDH2, KHSRP, SFN, YWHAQ, YWHAZ, NTRK1, SRPK2, XPO1, HIST1H3E, AHSA1, CDC25B, ERCC6L, GAN, RHOU, RC3H1, CDH1, EGFR, CYLD, TRIM25, G3BP1, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMTC3_EIF4B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMTC3_EIF4B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneEIF4BC0041696Unipolar Depression1PSYGENET
TgeneEIF4BC1269683Major Depressive Disorder1PSYGENET