FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38764

FusionGeneSummary for TMPRSS2_PDE9A

check button Fusion gene summary
Fusion gene informationFusion gene name: TMPRSS2_PDE9A
Fusion gene ID: 38764
HgeneTgene
Gene symbol

TMPRSS2

PDE9A

Gene ID

7113

5152

Gene nametransmembrane serine protease 2phosphodiesterase 9A
SynonymsPP9284|PRSS10HSPDE9A2
Cytomap

21q22.3

21q22.3

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protease serine 2epitheliasinserine protease 10transmembrane protease, serine 2high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9ACGMP-specific 3',5'-cyclic phosphodiesterase type 9phosphodiesterase PDE9A21
Modification date2018052320180519
UniProtAcc

O15393

O76083

Ensembl transtripts involved in fusion geneENST00000332149, ENST00000398585, 
ENST00000458356, ENST00000497881, 
ENST00000335512, ENST00000539837, 
ENST00000470987, ENST00000291539, 
ENST00000398236, ENST00000398229, 
ENST00000398234, ENST00000398232, 
ENST00000398227, ENST00000398225, 
ENST00000380328, ENST00000328862, 
ENST00000335440, ENST00000398224, 
ENST00000349112, 
Fusion gene scores* DoF score29 X 21 X 6=36545 X 4 X 5=100
# samples 2285
** MAII scorelog2(228/3654*10)=-0.680442809575384
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TMPRSS2 [Title/Abstract] AND PDE9A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTMPRSS2

GO:0006508

proteolysis

21068237|24227843

HgeneTMPRSS2

GO:0046598

positive regulation of viral entry into host cell

21068237|24227843

TgenePDE9A

GO:0046068

cGMP metabolic process

9624146

TgenePDE9A

GO:0046069

cGMP catabolic process

25799991


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-ZG-A9L2-01ATMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332149ENST00000335512TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
In-frameENST00000332149ENST00000539837TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000470987TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000291539TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000398236TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000398229TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000398234TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000398232TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000398227TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000398225TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000380328TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000328862TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000335440TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000398224TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000332149ENST00000349112TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
In-frameENST00000398585ENST00000335512TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
In-frameENST00000398585ENST00000539837TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000470987TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000291539TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000398236TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000398229TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000398234TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000398232TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000398227TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000398225TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000380328TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000328862TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000335440TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000398224TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000398585ENST00000349112TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
Frame-shitENST00000458356ENST00000335512TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
Frame-shitENST00000458356ENST00000539837TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000470987TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000291539TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000398236TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000398229TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000398234TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000398232TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000398227TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000398225TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000380328TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000328862TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000335440TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000398224TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
5CDS-3UTRENST00000458356ENST00000349112TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3CDSENST00000497881ENST00000335512TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3CDSENST00000497881ENST00000539837TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000470987TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000291539TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000398236TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000398229TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000398234TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000398232TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000398227TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000398225TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000380328TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000328862TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000335440TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000398224TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+
intron-3UTRENST00000497881ENST00000349112TMPRSS2chr21

42866283

-PDE9Achr21

44163886

+

Top

FusionProtFeatures for TMPRSS2_PDE9A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMPRSS2

O15393

PDE9A

O76083

Serine protease that proteolytically cleaves andactivates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized andmaintained in precursor intermediate folding states andproteolysis permits the refolding and energy release required tocreate stable virus-cell linkages and membrane coalescence.Facilitates human SARS coronavirus (SARS-CoV) infection via twoindependent mechanisms, proteolytic cleavage of ACE2, which mightpromote viral uptake, and cleavage of coronavirus spikeglycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activatesthe spike glycoproteins of human coronavirus 229E (HCoV-229E) andhuman coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0of Sendai virus (SeV), human metapneumovirus (HMPV), humanparainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential forspread and pathogenesis of influenza A virus (strains H1N1, H3N2and H7N9); involved in proteolytic cleavage and activation ofhemagglutinin (HA) protein which is essential for viralinfectivity. {ECO:0000269|PubMed:21068237,ECO:0000269|PubMed:21325420, ECO:0000269|PubMed:23536651,ECO:0000269|PubMed:23966399, ECO:0000269|PubMed:24027332,ECO:0000269|PubMed:24227843}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000398585-3141_84116530Topological domainCytoplasmic
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000398585-31485_105116530TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgenePDE9Achr21:42866283chr21:44163886ENST00000291539+620236_557189594DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000328862+519236_557163568DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000335440+317236_55787492DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000335512+519236_557129534DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000349112+216236_55761466DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000380328+519236_557136541DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000398224+317236_55762467DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000398225+519236_557148553DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000398227+115236_55729434DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000398229+216236_55755460DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000398232+418236_557122527DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000398234+418236_55788493DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000398236+418236_557103508DomainPDEase
TgenePDE9Achr21:42866283chr21:44163886ENST00000291539+620312_316189594Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000291539+620512_513189594Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000328862+519312_316163568Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000328862+519512_513163568Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000335440+317312_31687492Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000335440+317512_51387492Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000335512+519312_316129534Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000335512+519512_513129534Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000349112+216312_31661466Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000349112+216512_51361466Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000380328+519312_316136541Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000380328+519512_513136541Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398224+317312_31662467Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398224+317512_51362467Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398225+519312_316148553Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398225+519512_513148553Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398227+115312_31629434Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398227+115512_51329434Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398229+216312_31655460Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398229+216512_51355460Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398232+418312_316122527Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398232+418512_513122527Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398234+418312_31688493Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398234+418512_51388493Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398236+418312_316103508Nucleotide bindingcGMP
TgenePDE9Achr21:42866283chr21:44163886ENST00000398236+418512_513103508Nucleotide bindingcGMP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000332149-314112_14979493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000332149-314150_24279493DomainSRCR
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000332149-314256_48979493DomainPeptidase S1
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000398585-314112_149116530DomainLDL-receptor class A
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000398585-314150_242116530DomainSRCR
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000398585-314256_489116530DomainPeptidase S1
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000458356-314112_14979493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000458356-314150_24279493DomainSRCR
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000458356-314256_48979493DomainPeptidase S1
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000332149-314106_49279493Topological domainExtracellular
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000332149-3141_8479493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000398585-314106_492116530Topological domainExtracellular
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000458356-314106_49279493Topological domainExtracellular
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000458356-3141_8479493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000332149-31485_10579493TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS2chr21:42866283chr21:44163886ENST00000458356-31485_10579493TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for TMPRSS2_PDE9A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_PDE9A_ENST00000335512_chr21_44163886_+_484aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSMEGLKVVEIEK
CKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSI
NPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISP
LENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPM
EVAEPWVDCLLEETFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_PDE9A_ENST00000539837_chr21_44163886_+_484aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSMEGLKVVEIEK
CKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSI
NPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISP
LENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPM
EVAEPWVDCLLEETFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_PDE9A_ENST00000335512_chr21_44163886_+_521aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSMEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETI
EALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDIL
ILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMD
SFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEETFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIP

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_PDE9A_ENST00000539837_chr21_44163886_+_521aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSMEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETI
EALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDIL
ILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMD
SFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEETFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_PDE9A_ENST00000335512_chr21_44163886_+_1452nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAATGGAAGGACTAAAAGTGGTGGAGATTGAGAAA
TGCAAGAGTGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGAAGCAGCAGGACCAACTGCCCCTGTAAGTACAGTTTTTTGGATAAC
CACAAGAAGTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAGTACCTGCTCTCTCCAGAGACCATCGAGGCCCTGCGGAAGCCGACC
TTTGACGTCTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTGGAGCACATGTACCACGACCTCGGGCTGGTCAGGGACTTCAGCATC
AACCCTGTCACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAACTACAGAAACAACCCCTTCCACAACTTCCGGCACTGCTTCTGCGTG
GCCCAGATGATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAGAAGTTCTCACAAACGGATATCCTGATCCTAATGACAGCGGCCATC
TGCCACGATCTGGACCATCCCGGCTACAACAACACGTACCAGATCAATGCCCGCACAGAGCTGGCGGTCCGCTACAATGACATCTCACCG
CTGGAGAACCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAGCCTGAGTGCAACATCTTCTCCAACATCCCACCTGATGGGTTCAAG
CAGATCCGACAGGGAATGATCACATTAATCTTGGCCACTGACATGGCAAGACATGCAGAAATTATGGATTCTTTCAAAGAGAAAATGGAG
AATTTTGACTACAGCAACGAGGAGCACATGACCCTGCTGAAGATGATTTTGATAAAATGCTGTGATATCTCTAACGAGGTCCGTCCAATG
GAAGTCGCAGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTTATGCAGAGCGACCGTGAGAAGTCAGAAGGCCTTCCTGTGGCACCG
TTCATGGACCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGGTTCATCAAGTTTGTCCTGATCCCAATGTTTGAAACAGTGACCAAG
CTCTTCCCCATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAATCCCGAGATCGCTACGAGGAGCTGAAGCGGATAGATGACGCCATG
AAAGAGTTACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACCGAGAAGTCCAGAGAGAGAAGCAGAGATGTGAAAAACAGTGAAGGA

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_PDE9A_ENST00000539837_chr21_44163886_+_1452nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAATGGAAGGACTAAAAGTGGTGGAGATTGAGAAA
TGCAAGAGTGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGAAGCAGCAGGACCAACTGCCCCTGTAAGTACAGTTTTTTGGATAAC
CACAAGAAGTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAGTACCTGCTCTCTCCAGAGACCATCGAGGCCCTGCGGAAGCCGACC
TTTGACGTCTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTGGAGCACATGTACCACGACCTCGGGCTGGTCAGGGACTTCAGCATC
AACCCTGTCACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAACTACAGAAACAACCCCTTCCACAACTTCCGGCACTGCTTCTGCGTG
GCCCAGATGATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAGAAGTTCTCACAAACGGATATCCTGATCCTAATGACAGCGGCCATC
TGCCACGATCTGGACCATCCCGGCTACAACAACACGTACCAGATCAATGCCCGCACAGAGCTGGCGGTCCGCTACAATGACATCTCACCG
CTGGAGAACCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAGCCTGAGTGCAACATCTTCTCCAACATCCCACCTGATGGGTTCAAG
CAGATCCGACAGGGAATGATCACATTAATCTTGGCCACTGACATGGCAAGACATGCAGAAATTATGGATTCTTTCAAAGAGAAAATGGAG
AATTTTGACTACAGCAACGAGGAGCACATGACCCTGCTGAAGATGATTTTGATAAAATGCTGTGATATCTCTAACGAGGTCCGTCCAATG
GAAGTCGCAGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTTATGCAGAGCGACCGTGAGAAGTCAGAAGGCCTTCCTGTGGCACCG
TTCATGGACCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGGTTCATCAAGTTTGTCCTGATCCCAATGTTTGAAACAGTGACCAAG
CTCTTCCCCATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAATCCCGAGATCGCTACGAGGAGCTGAAGCGGATAGATGACGCCATG
AAAGAGTTACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACCGAGAAGTCCAGAGAGAGAAGCAGAGATGTGAAAAACAGTGAAGGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_PDE9A_ENST00000335512_chr21_44163886_+_1563nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAATGGAAGGACTA
AAAGTGGTGGAGATTGAGAAATGCAAGAGTGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGAAGCAGCAGGACCAACTGCCCCTGT
AAGTACAGTTTTTTGGATAACCACAAGAAGTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAGTACCTGCTCTCTCCAGAGACCATC
GAGGCCCTGCGGAAGCCGACCTTTGACGTCTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTGGAGCACATGTACCACGACCTCGGG
CTGGTCAGGGACTTCAGCATCAACCCTGTCACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAACTACAGAAACAACCCCTTCCACAAC
TTCCGGCACTGCTTCTGCGTGGCCCAGATGATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAGAAGTTCTCACAAACGGATATCCTG
ATCCTAATGACAGCGGCCATCTGCCACGATCTGGACCATCCCGGCTACAACAACACGTACCAGATCAATGCCCGCACAGAGCTGGCGGTC
CGCTACAATGACATCTCACCGCTGGAGAACCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAGCCTGAGTGCAACATCTTCTCCAAC
ATCCCACCTGATGGGTTCAAGCAGATCCGACAGGGAATGATCACATTAATCTTGGCCACTGACATGGCAAGACATGCAGAAATTATGGAT
TCTTTCAAAGAGAAAATGGAGAATTTTGACTACAGCAACGAGGAGCACATGACCCTGCTGAAGATGATTTTGATAAAATGCTGTGATATC
TCTAACGAGGTCCGTCCAATGGAAGTCGCAGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTTATGCAGAGCGACCGTGAGAAGTCA
GAAGGCCTTCCTGTGGCACCGTTCATGGACCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGGTTCATCAAGTTTGTCCTGATCCCA
ATGTTTGAAACAGTGACCAAGCTCTTCCCCATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAATCCCGAGATCGCTACGAGGAGCTG
AAGCGGATAGATGACGCCATGAAAGAGTTACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACCGAGAAGTCCAGAGAGAGAAGCAGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_PDE9A_ENST00000539837_chr21_44163886_+_1563nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAATGGAAGGACTA
AAAGTGGTGGAGATTGAGAAATGCAAGAGTGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGAAGCAGCAGGACCAACTGCCCCTGT
AAGTACAGTTTTTTGGATAACCACAAGAAGTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAGTACCTGCTCTCTCCAGAGACCATC
GAGGCCCTGCGGAAGCCGACCTTTGACGTCTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTGGAGCACATGTACCACGACCTCGGG
CTGGTCAGGGACTTCAGCATCAACCCTGTCACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAACTACAGAAACAACCCCTTCCACAAC
TTCCGGCACTGCTTCTGCGTGGCCCAGATGATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAGAAGTTCTCACAAACGGATATCCTG
ATCCTAATGACAGCGGCCATCTGCCACGATCTGGACCATCCCGGCTACAACAACACGTACCAGATCAATGCCCGCACAGAGCTGGCGGTC
CGCTACAATGACATCTCACCGCTGGAGAACCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAGCCTGAGTGCAACATCTTCTCCAAC
ATCCCACCTGATGGGTTCAAGCAGATCCGACAGGGAATGATCACATTAATCTTGGCCACTGACATGGCAAGACATGCAGAAATTATGGAT
TCTTTCAAAGAGAAAATGGAGAATTTTGACTACAGCAACGAGGAGCACATGACCCTGCTGAAGATGATTTTGATAAAATGCTGTGATATC
TCTAACGAGGTCCGTCCAATGGAAGTCGCAGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTTATGCAGAGCGACCGTGAGAAGTCA
GAAGGCCTTCCTGTGGCACCGTTCATGGACCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGGTTCATCAAGTTTGTCCTGATCCCA
ATGTTTGAAACAGTGACCAAGCTCTTCCCCATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAATCCCGAGATCGCTACGAGGAGCTG
AAGCGGATAGATGACGCCATGAAAGAGTTACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACCGAGAAGTCCAGAGAGAGAAGCAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_PDE9A_ENST00000335512_chr21_44163886_+_1803nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAATGGAAGGACTAAAAGTGGTGGAGATTGAGAAATGCAAGAGTGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGA
AGCAGCAGGACCAACTGCCCCTGTAAGTACAGTTTTTTGGATAACCACAAGAAGTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAG
TACCTGCTCTCTCCAGAGACCATCGAGGCCCTGCGGAAGCCGACCTTTGACGTCTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTG
GAGCACATGTACCACGACCTCGGGCTGGTCAGGGACTTCAGCATCAACCCTGTCACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAAC
TACAGAAACAACCCCTTCCACAACTTCCGGCACTGCTTCTGCGTGGCCCAGATGATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAG
AAGTTCTCACAAACGGATATCCTGATCCTAATGACAGCGGCCATCTGCCACGATCTGGACCATCCCGGCTACAACAACACGTACCAGATC
AATGCCCGCACAGAGCTGGCGGTCCGCTACAATGACATCTCACCGCTGGAGAACCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAG
CCTGAGTGCAACATCTTCTCCAACATCCCACCTGATGGGTTCAAGCAGATCCGACAGGGAATGATCACATTAATCTTGGCCACTGACATG
GCAAGACATGCAGAAATTATGGATTCTTTCAAAGAGAAAATGGAGAATTTTGACTACAGCAACGAGGAGCACATGACCCTGCTGAAGATG
ATTTTGATAAAATGCTGTGATATCTCTAACGAGGTCCGTCCAATGGAAGTCGCAGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTT
ATGCAGAGCGACCGTGAGAAGTCAGAAGGCCTTCCTGTGGCACCGTTCATGGACCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGG
TTCATCAAGTTTGTCCTGATCCCAATGTTTGAAACAGTGACCAAGCTCTTCCCCATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAA
TCCCGAGATCGCTACGAGGAGCTGAAGCGGATAGATGACGCCATGAAAGAGTTACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACC
GAGAAGTCCAGAGAGAGAAGCAGAGATGTGAAAAACAGTGAAGGAGACTGTGCCTGAGGAAAGCGGGGGGCGTGGCTGCAGTTCTGGACG
GGCTGGCCGAGCTGCGCGGGATCCTTGTGCAGGGAAGAGCTGCCCTGGGCACCTGGCACCACAAGACCATGTTTTCTAAGAACCATTTTG
TTCACTGATACAAAAAAAAAAAAAGGAATTCATGATGCTGTACAGAATTTTATTTTTAAACTGTCTTTTAAATAATATATTCTTATACGG

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_PDE9A_ENST00000539837_chr21_44163886_+_1800nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAATGGAAGGACTAAAAGTGGTGGAGATTGAGAAATGCAAGAGTGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGA
AGCAGCAGGACCAACTGCCCCTGTAAGTACAGTTTTTTGGATAACCACAAGAAGTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAG
TACCTGCTCTCTCCAGAGACCATCGAGGCCCTGCGGAAGCCGACCTTTGACGTCTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTG
GAGCACATGTACCACGACCTCGGGCTGGTCAGGGACTTCAGCATCAACCCTGTCACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAAC
TACAGAAACAACCCCTTCCACAACTTCCGGCACTGCTTCTGCGTGGCCCAGATGATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAG
AAGTTCTCACAAACGGATATCCTGATCCTAATGACAGCGGCCATCTGCCACGATCTGGACCATCCCGGCTACAACAACACGTACCAGATC
AATGCCCGCACAGAGCTGGCGGTCCGCTACAATGACATCTCACCGCTGGAGAACCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAG
CCTGAGTGCAACATCTTCTCCAACATCCCACCTGATGGGTTCAAGCAGATCCGACAGGGAATGATCACATTAATCTTGGCCACTGACATG
GCAAGACATGCAGAAATTATGGATTCTTTCAAAGAGAAAATGGAGAATTTTGACTACAGCAACGAGGAGCACATGACCCTGCTGAAGATG
ATTTTGATAAAATGCTGTGATATCTCTAACGAGGTCCGTCCAATGGAAGTCGCAGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTT
ATGCAGAGCGACCGTGAGAAGTCAGAAGGCCTTCCTGTGGCACCGTTCATGGACCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGG
TTCATCAAGTTTGTCCTGATCCCAATGTTTGAAACAGTGACCAAGCTCTTCCCCATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAA
TCCCGAGATCGCTACGAGGAGCTGAAGCGGATAGATGACGCCATGAAAGAGTTACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACC
GAGAAGTCCAGAGAGAGAAGCAGAGATGTGAAAAACAGTGAAGGAGACTGTGCCTGAGGAAAGCGGGGGGCGTGGCTGCAGTTCTGGACG
GGCTGGCCGAGCTGCGCGGGATCCTTGTGCAGGGAAGAGCTGCCCTGGGCACCTGGCACCACAAGACCATGTTTTCTAAGAACCATTTTG
TTCACTGATACAAAAAAAAAAAAAGGAATTCATGATGCTGTACAGAATTTTATTTTTAAACTGTCTTTTAAATAATATATTCTTATACGG

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_PDE9A_ENST00000335512_chr21_44163886_+_1840nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAATGGAAGGACTAAAAGTGGTGGAGATTGAGAAATGCAAGAG
TGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGAAGCAGCAGGACCAACTGCCCCTGTAAGTACAGTTTTTTGGATAACCACAAGAA
GTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAGTACCTGCTCTCTCCAGAGACCATCGAGGCCCTGCGGAAGCCGACCTTTGACGT
CTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTGGAGCACATGTACCACGACCTCGGGCTGGTCAGGGACTTCAGCATCAACCCTGT
CACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAACTACAGAAACAACCCCTTCCACAACTTCCGGCACTGCTTCTGCGTGGCCCAGAT
GATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAGAAGTTCTCACAAACGGATATCCTGATCCTAATGACAGCGGCCATCTGCCACGA
TCTGGACCATCCCGGCTACAACAACACGTACCAGATCAATGCCCGCACAGAGCTGGCGGTCCGCTACAATGACATCTCACCGCTGGAGAA
CCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAGCCTGAGTGCAACATCTTCTCCAACATCCCACCTGATGGGTTCAAGCAGATCCG
ACAGGGAATGATCACATTAATCTTGGCCACTGACATGGCAAGACATGCAGAAATTATGGATTCTTTCAAAGAGAAAATGGAGAATTTTGA
CTACAGCAACGAGGAGCACATGACCCTGCTGAAGATGATTTTGATAAAATGCTGTGATATCTCTAACGAGGTCCGTCCAATGGAAGTCGC
AGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTTATGCAGAGCGACCGTGAGAAGTCAGAAGGCCTTCCTGTGGCACCGTTCATGGA
CCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGGTTCATCAAGTTTGTCCTGATCCCAATGTTTGAAACAGTGACCAAGCTCTTCCC
CATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAATCCCGAGATCGCTACGAGGAGCTGAAGCGGATAGATGACGCCATGAAAGAGTT
ACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACCGAGAAGTCCAGAGAGAGAAGCAGAGATGTGAAAAACAGTGAAGGAGACTGTGC
CTGAGGAAAGCGGGGGGCGTGGCTGCAGTTCTGGACGGGCTGGCCGAGCTGCGCGGGATCCTTGTGCAGGGAAGAGCTGCCCTGGGCACC
TGGCACCACAAGACCATGTTTTCTAAGAACCATTTTGTTCACTGATACAAAAAAAAAAAAAGGAATTCATGATGCTGTACAGAATTTTAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_PDE9A_ENST00000539837_chr21_44163886_+_1837nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAATGGAAGGACTAAAAGTGGTGGAGATTGAGAAATGCAAGAG
TGACATTAAGAAGATGAGGGAGGAGCTGGCGGCCAGAAGCAGCAGGACCAACTGCCCCTGTAAGTACAGTTTTTTGGATAACCACAAGAA
GTTGACTCCTCGACGCGATGTTCCCACTTACCCCAAGTACCTGCTCTCTCCAGAGACCATCGAGGCCCTGCGGAAGCCGACCTTTGACGT
CTGGCTTTGGGAGCCCAATGAGATGCTGAGCTGCCTGGAGCACATGTACCACGACCTCGGGCTGGTCAGGGACTTCAGCATCAACCCTGT
CACCCTCAGGAGGTGGCTGTTCTGCGTCCACGACAACTACAGAAACAACCCCTTCCACAACTTCCGGCACTGCTTCTGCGTGGCCCAGAT
GATGTACAGCATGGTCTGGCTCTGCAGTCTCCAGGAGAAGTTCTCACAAACGGATATCCTGATCCTAATGACAGCGGCCATCTGCCACGA
TCTGGACCATCCCGGCTACAACAACACGTACCAGATCAATGCCCGCACAGAGCTGGCGGTCCGCTACAATGACATCTCACCGCTGGAGAA
CCACCACTGCGCCGTGGCCTTCCAGATCCTCGCCGAGCCTGAGTGCAACATCTTCTCCAACATCCCACCTGATGGGTTCAAGCAGATCCG
ACAGGGAATGATCACATTAATCTTGGCCACTGACATGGCAAGACATGCAGAAATTATGGATTCTTTCAAAGAGAAAATGGAGAATTTTGA
CTACAGCAACGAGGAGCACATGACCCTGCTGAAGATGATTTTGATAAAATGCTGTGATATCTCTAACGAGGTCCGTCCAATGGAAGTCGC
AGAGCCTTGGGTGGACTGTTTATTAGAGGAATATTTTATGCAGAGCGACCGTGAGAAGTCAGAAGGCCTTCCTGTGGCACCGTTCATGGA
CCGAGACAAAGTGACCAAGGCCACAGCCCAGATTGGGTTCATCAAGTTTGTCCTGATCCCAATGTTTGAAACAGTGACCAAGCTCTTCCC
CATGGTTGAGGAGATCATGCTGCAGCCACTTTGGGAATCCCGAGATCGCTACGAGGAGCTGAAGCGGATAGATGACGCCATGAAAGAGTT
ACAGAAGAAGACTGACAGCTTGACGTCTGGGGCCACCGAGAAGTCCAGAGAGAGAAGCAGAGATGTGAAAAACAGTGAAGGAGACTGTGC
CTGAGGAAAGCGGGGGGCGTGGCTGCAGTTCTGGACGGGCTGGCCGAGCTGCGCGGGATCCTTGTGCAGGGAAGAGCTGCCCTGGGCACC
TGGCACCACAAGACCATGTTTTCTAAGAACCATTTTGTTCACTGATACAAAAAAAAAAAAAGGAATTCATGATGCTGTACAGAATTTTAT


Top

FusionGenePPI for TMPRSS2_PDE9A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMPRSS2CLK1PDE9ATRIM32, PHYHIPL, PDE9A, CLK1, CRY2, LMO2, SULT1E1, LAGE3, BAG3, GORASP2, TRPV6, KRTAP9-2, UTP23, NAA38, KRTAP4-2, KRTAP10-8, KRTAP10-3, NOTCH2NL, C9orf106, UNC119, TFAP4, C12orf75, PRKG2, RSPRY1, NPHP3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMPRSS2_PDE9A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMPRSS2_PDE9A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTMPRSS2C0033578Prostatic Neoplasms2CTD_human
TgenePDE9AC0005586Bipolar Disorder1PSYGENET