FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38060

FusionGeneSummary for TIA1_ACTR2

check button Fusion gene summary
Fusion gene informationFusion gene name: TIA1_ACTR2
Fusion gene ID: 38060
HgeneTgene
Gene symbol

TIA1

ACTR2

Gene ID

7072

10097

Gene nameTIA1 cytotoxic granule associated RNA binding proteinARP2 actin related protein 2 homolog
SynonymsTIA-1|WDMARP2
Cytomap

2p13.3

2p14

Type of geneprotein-codingprotein-coding
Descriptionnucleolysin TIA-1 isoform p40nucleolysin TIA-1T-cell-restricted intracellular antigen-1p40-TIA-1 (containing p15-TIA-1)actin-related protein 2actin-like protein 2
Modification date2018051920180519
UniProtAcc

P31483

P61160

Ensembl transtripts involved in fusion geneENST00000433529, ENST00000415783, 
ENST00000282574, ENST00000445587, 
ENST00000482876, ENST00000416149, 
ENST00000260641, ENST00000476840, 
ENST00000542850, ENST00000377982, 
Fusion gene scores* DoF score8 X 5 X 7=2804 X 3 X 2=24
# samples 83
** MAII scorelog2(8/280*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/24*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TIA1 [Title/Abstract] AND ACTR2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTIA1

GO:0048024

regulation of mRNA splicing, via spliceosome

11106748

TgeneACTR2

GO:0034314

Arp2/3 complex-mediated actin nucleation

11741539


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-KK-A7AP-01ATIA1chr2

70463211

-ACTR2chr2

65478161

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000433529ENST00000260641TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000433529ENST00000476840TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000433529ENST00000542850TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000433529ENST00000377982TIA1chr2

70463211

-ACTR2chr2

65478161

+
In-frameENST00000415783ENST00000260641TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000415783ENST00000476840TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000415783ENST00000542850TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000415783ENST00000377982TIA1chr2

70463211

-ACTR2chr2

65478161

+
In-frameENST00000282574ENST00000260641TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000282574ENST00000476840TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000282574ENST00000542850TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000282574ENST00000377982TIA1chr2

70463211

-ACTR2chr2

65478161

+
In-frameENST00000445587ENST00000260641TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000445587ENST00000476840TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000445587ENST00000542850TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000445587ENST00000377982TIA1chr2

70463211

-ACTR2chr2

65478161

+
intron-3CDSENST00000482876ENST00000260641TIA1chr2

70463211

-ACTR2chr2

65478161

+
intron-intronENST00000482876ENST00000476840TIA1chr2

70463211

-ACTR2chr2

65478161

+
intron-intronENST00000482876ENST00000542850TIA1chr2

70463211

-ACTR2chr2

65478161

+
intron-intronENST00000482876ENST00000377982TIA1chr2

70463211

-ACTR2chr2

65478161

+
In-frameENST00000416149ENST00000260641TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000416149ENST00000476840TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000416149ENST00000542850TIA1chr2

70463211

-ACTR2chr2

65478161

+
5CDS-intronENST00000416149ENST00000377982TIA1chr2

70463211

-ACTR2chr2

65478161

+

Top

FusionProtFeatures for TIA1_ACTR2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TIA1

P31483

ACTR2

P61160

Involved in alternative pre-RNA splicing and regulationof mRNA translation by binding to AU-rich elements (AREs) locatedin mRNA 3' untranslated regions (3' UTRs). Possesses nucleolyticactivity against cytotoxic lymphocyte target cells. May beinvolved in apoptosis. Functions as ATP-binding component of the Arp2/3 complexwhich is involved in regulation of actin polymerization andtogether with an activating nucleation-promoting factor (NPF)mediates the formation of branched actin networks. Seems tocontact the pointed end of the daughter actin filament.{ECO:0000269|PubMed:9000076}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneACTR2chr2:70463211chr2:65478161ENST00000260641+29160_162125395Nucleotide bindingATP
TgeneACTR2chr2:70463211chr2:65478161ENST00000260641+29214_218125395Nucleotide bindingATP
TgeneACTR2chr2:70463211chr2:65478161ENST00000260641+29305_310125395Nucleotide bindingATP
TgeneACTR2chr2:70463211chr2:65478161ENST00000377982+310160_162130400Nucleotide bindingATP
TgeneACTR2chr2:70463211chr2:65478161ENST00000377982+310214_218130400Nucleotide bindingATP
TgeneACTR2chr2:70463211chr2:65478161ENST00000377982+310305_310130400Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTIA1chr2:70463211chr2:65478161ENST00000415783-212106_18441376DomainRRM 2
HgeneTIA1chr2:70463211chr2:65478161ENST00000415783-212214_28641376DomainRRM 3
HgeneTIA1chr2:70463211chr2:65478161ENST00000415783-2127_8341376DomainRRM 1
HgeneTIA1chr2:70463211chr2:65478161ENST00000433529-213106_18441387DomainRRM 2
HgeneTIA1chr2:70463211chr2:65478161ENST00000433529-213214_28641387DomainRRM 3
HgeneTIA1chr2:70463211chr2:65478161ENST00000433529-2137_8341387DomainRRM 1


Top

FusionGeneSequence for TIA1_ACTR2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TIA1_ENST00000433529_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_311aa
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVMFETYQFSGVTVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVTEGFS
LPHLTRRLDIAGRDITRTLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGTNIEQEQKLALETTVLVESTTLPDGRIIKVGGERFEAPEA
LFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMTPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMV

>In-frame_TIA1_ENST00000415783_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_311aa
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVMFETYQFSGVTVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVTEGFS
LPHLTRRLDIAGRDITRTLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGTNIEQEQKLALETTVLVESTTLPDGRIIKVGGERFEAPEA
LFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMTPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMV

>In-frame_TIA1_ENST00000282574_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_311aa
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVMFETYQFSGVTVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVTEGFS
LPHLTRRLDIAGRDITRTLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGTNIEQEQKLALETTVLVESTTLPDGRIIKVGGERFEAPEA
LFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMTPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMV

>In-frame_TIA1_ENST00000445587_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_311aa
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVMFETYQFSGVTVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVTEGFS
LPHLTRRLDIAGRDITRTLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGTNIEQEQKLALETTVLVESTTLPDGRIIKVGGERFEAPEA
LFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMTPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMV

>In-frame_TIA1_ENST00000416149_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_311aa
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVMFETYQFSGVTVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVTEGFS
LPHLTRRLDIAGRDITRTLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGTNIEQEQKLALETTVLVESTTLPDGRIIKVGGERFEAPEA
LFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMTPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TIA1_ENST00000433529_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_933nt
ATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATT
GGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTG
ACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCT
CTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTC
AACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCC
TTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCT
TTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGA
TCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTT
TACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTA
TTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGT

>In-frame_TIA1_ENST00000415783_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_933nt
ATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATT
GGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTG
ACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCT
CTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTC
AACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCC
TTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCT
TTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGA
TCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTT
TACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTA
TTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGT

>In-frame_TIA1_ENST00000282574_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_933nt
ATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATT
GGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTG
ACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCT
CTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTC
AACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCC
TTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCT
TTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGA
TCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTT
TACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTA
TTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGT

>In-frame_TIA1_ENST00000445587_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_933nt
ATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATT
GGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTG
ACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCT
CTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTC
AACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCC
TTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCT
TTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGA
TCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTT
TACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTA
TTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGT

>In-frame_TIA1_ENST00000416149_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_933nt
ATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATT
GGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTG
ACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCT
CTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTC
AACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCC
TTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCT
TTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGA
TCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTT
TACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTA
TTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TIA1_ENST00000433529_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_3663nt
AGGCTCCCGGCTCGCCGCCATCTTGTATTGGGGTTTCATTGTTCCCGCTGGGCCGGGCGGTTTAGTGTAATTGCCGCCGGAGGAGGAGGC
GGAGTAACCTCTGGTCAGCCGAGAAACCCCACTATCCTGTAGCCATAACCGCTTAAACGATTTGGGAGGTAGTGAAGGGCAGGGAGCTGG
ACCTGGAGGCGCCGCCGCGACAGCAGCAGCCATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGA
AGCTCTAATTCTGCAACTCTTTAGCCAGATTGGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTC
CGGTGTATATGTAGCCATCCAGGCAGTTCTGACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGAC
TCACATTTGCCCAGTATATGAAGGCTTTTCTCTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTAT
CAAGCTACTTCTGTTGCGAGGATACGCCTTCAACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGG
ATATAATATTGAGCAAGAGCAGAAACTGGCCTTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGT
TGGGGGAGAGAGATTTGAAGCACCAGAAGCTTTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAA
CACAATTCAGGCAGCTGACATTGATACCAGATCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCC
ATCACGGTTGGAACGAGAACTTAAACAGCTTTACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCAT
TGAAGACCCACCCCGCAGAAAGCACATGGTATTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGAC
CCGACAAGAGTACCAAGAAAAGGGTGTCCGTGTGCTAGAGAAACTTGGTGTGACTGTTCGATAAACTCCAAAGCTTGTTCCCGTCATACC
CGTAATGCTTTCTTTTTTCCTTTATTGCCAATCTTTGAACTCATTCAACTCCAGGACATGGAAGAGGCCTCTCTCTGCCCTTTGACTGGA
AAGGTCAAGTTTTATTCTGGTGTCTTGGGGAAGCTTTGTTAAATTTTTGTTAATGTGGGTAAATCTGAGTTTAATTCAACTGCTTCCCTA
CATAGACTAGAGGGCTAAGGATTCTGTCTGCTGCTTTGTTTCTTCTAAGTAGGCATTTAGATCATTCCTATAGGCTTCCTATTTTCACTT
TACTGCTCTAATGCTGCTAGTCGTAGTCTTTAGCACACTAGGTGGTATGCCTTTATTAGCATAAAACAAAAAAAACTTTAACAGGAGCTT
TTACATATTACTGGGATGGGGGGTGGTTCGGGATGGGTGGGCAGCTGCTGAACCCTTTAGGGCATTTCCTCTGTAATGTGGCGCTTTCAA
CTGTACTGCTGCAGCTTTAAGTACCTTAAAGCTTCTCCTGTGAACTTCTTAGGGAAATGTTAGGTTCAGAACTAAAGTGTTTTGGGTGGG
TTTTGTTGCGGGGGGGAGGGTAACAATGGGTGGTCTTCTGATTTTTATTTTTGAGGTTTTGTCAACTGGAGTACGTAGAGGAACTTTATT
TACAGTACTTTGATTTGGCAGGTTTTCTTCTACTTGTGCTCTGCCTGGAGCTGTTTCCATATGATATAAAAAGCAAGTGTAGTATTCCAT
TACTATGTGGCTTAGGGATTTATTTGTTTTTTAAAATCAACCATGTTAGCTGGGATTAGACTCCCTACAGTCCTTCAATGGAAAAGTAAC
ATTTAAAAATCCTTTGGGTAATTCGAATTACAGATTTAAAAGAGCTTAAGATCTGGTGTTTTGTTAATGCTTCTGTTTATTCCAGAAGCA
TTAAGGTAACCCATTGCCAAGTATCATTCTTGCAAATTATTCTTTTATATAACTGACCAGTGCTTAATAAAACAAGCAGGTACTTACAAA
TAATTACTGGCAGTAGGTTATAATTGGTGGTTTAAAAATAACATTGGAATACAGGACTTGTTGCCAATTGGGTAATTTTCATTAGTTGTT
TTGTTTGTTTTGATTTGAAACCTGGAAATACAGTAAAATTTGACTGTTTAAAATGTTGGCCAAAAAAATCAAGATTTAATTTTTTTATTT
GTACTGAAAAACTAATCATAACTGTTAATTCTCAGCCATCTTTGAAGCTTGAAAGAAGAGTCTTTGGTATTTTGTAAACGTTAGCAGACT
TTCCTGCCAGTGTCAGAAAATCCTATTTATGAATCCTGTCGGTATTCCTTGGTATCTGAAAAAAATACCAAATAGTACCATACATGAGTT
ATTTCTAAGTTTGAAAAATAAAAAGAAATTGCATCACACTAATTACAAAATACAAGTTCTGGAAAAAATATTTTTCTTCATTTTAAAACT
TTTTTTTAACTAATAATAGCTTTGAAAGAAGAGGCTTAATTTGGGGGTGGTAACTAAAATCAAAAGAAATGATTGACTTGAGGGTCTCTG
TTTGGTAAGAATACATCATTAGCTTAAATAAGCAGCAGAAGGTTAGTTTTAATTATGTAGCTTCTGTTAATATTAAGTGTTTTTTGTCTG
TTTTACCTCAATTTGAACAGATAAGTTTGCCTGCATGCTGGACATGCCTCAGAACCCTGAATAGCCCGTACTAGATCTTGGGAACATGGA
TCTTAGAGTCACTTTGGAATAAGTTCTTATATAAATACCCCCAGCCTTTTGAGAACGGGGCTTGTTAAAGGACGCGTATGTAGGGCCCGT
ACCTACTGGCAGTTGGGTTCAGGGAAATGGGATTGACTTGGCCTTCAGGCTCCTTTGGTCATAATTTTAAAATATGGGAGTAGAAAACAA
CAAAGAATGGAATGGACTCTTAAAACAATGAAAGAGCATTTATCGTTTGTCCCTTGAATGTAGAATTTGTTTTTGATTTCATAATTCTGC
TGGTAAATGTGACAGTTAAAATGGTGCATTATGTATATATATTATAATTTAGAAATACCATTTTATAATTTTACTATTCCAGGGTGACAT
AATGCATTTAAATTTGGGATTTGGGTGGAGTATTATGTTTAACTGGAGTTGTCAAGTATGAGTCCCTCAGGAAAAAAAAAAAATTCTGTT
TTAAAAAGCAATCTGATTCTTAGCTCTTGAAACTATTGCTACTTAAATTTCCAATAATTAAAAATTTAAAATTTTTAAATTAGAATTGCC
AATACTTCTACATTTGAGAAGGGTTTTTTTAGAAATACATTTAGTAAAGTCCCCAAGACATTAGTCTTACATTTAAACTTTTTTCTTTAA
AACATGGTTTTGGTGGTTAACTTTTACACAGTTCTGAGTACTGTTAATATCTGGAAAGTATCTTGAGATATCAGTGGAAAGCTAAACAGT

>In-frame_TIA1_ENST00000415783_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_3682nt
AACTTTGCTGGCTGCTCCTAGGCTCCCGGCTCGCCGCCATCTTGTATTGGGGTTTCATTGTTCCCGCTGGGCCGGGCGGTTTAGTGTAAT
TGCCGCCGGAGGAGGAGGCGGAGTAACCTCTGGTCAGCCGAGAAACCCCACTATCCTGTAGCCATAACCGCTTAAACGATTTGGGAGGTA
GTGAAGGGCAGGGAGCTGGACCTGGAGGCGCCGCCGCGACAGCAGCAGCCATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACC
TTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATTGGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGT
TTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTGACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAG
ACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCTCTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGG
ATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTCAACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAG
AAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCCTTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAG
ATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCTTTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTG
TTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGATCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTA
CTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTTTACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTT
CTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTATTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACA
AAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGTGTGCTAGAGAAACTTGGTGTGACTGTTCGATAAACTCCAA
AGCTTGTTCCCGTCATACCCGTAATGCTTTCTTTTTTCCTTTATTGCCAATCTTTGAACTCATTCAACTCCAGGACATGGAAGAGGCCTC
TCTCTGCCCTTTGACTGGAAAGGTCAAGTTTTATTCTGGTGTCTTGGGGAAGCTTTGTTAAATTTTTGTTAATGTGGGTAAATCTGAGTT
TAATTCAACTGCTTCCCTACATAGACTAGAGGGCTAAGGATTCTGTCTGCTGCTTTGTTTCTTCTAAGTAGGCATTTAGATCATTCCTAT
AGGCTTCCTATTTTCACTTTACTGCTCTAATGCTGCTAGTCGTAGTCTTTAGCACACTAGGTGGTATGCCTTTATTAGCATAAAACAAAA
AAAACTTTAACAGGAGCTTTTACATATTACTGGGATGGGGGGTGGTTCGGGATGGGTGGGCAGCTGCTGAACCCTTTAGGGCATTTCCTC
TGTAATGTGGCGCTTTCAACTGTACTGCTGCAGCTTTAAGTACCTTAAAGCTTCTCCTGTGAACTTCTTAGGGAAATGTTAGGTTCAGAA
CTAAAGTGTTTTGGGTGGGTTTTGTTGCGGGGGGGAGGGTAACAATGGGTGGTCTTCTGATTTTTATTTTTGAGGTTTTGTCAACTGGAG
TACGTAGAGGAACTTTATTTACAGTACTTTGATTTGGCAGGTTTTCTTCTACTTGTGCTCTGCCTGGAGCTGTTTCCATATGATATAAAA
AGCAAGTGTAGTATTCCATTACTATGTGGCTTAGGGATTTATTTGTTTTTTAAAATCAACCATGTTAGCTGGGATTAGACTCCCTACAGT
CCTTCAATGGAAAAGTAACATTTAAAAATCCTTTGGGTAATTCGAATTACAGATTTAAAAGAGCTTAAGATCTGGTGTTTTGTTAATGCT
TCTGTTTATTCCAGAAGCATTAAGGTAACCCATTGCCAAGTATCATTCTTGCAAATTATTCTTTTATATAACTGACCAGTGCTTAATAAA
ACAAGCAGGTACTTACAAATAATTACTGGCAGTAGGTTATAATTGGTGGTTTAAAAATAACATTGGAATACAGGACTTGTTGCCAATTGG
GTAATTTTCATTAGTTGTTTTGTTTGTTTTGATTTGAAACCTGGAAATACAGTAAAATTTGACTGTTTAAAATGTTGGCCAAAAAAATCA
AGATTTAATTTTTTTATTTGTACTGAAAAACTAATCATAACTGTTAATTCTCAGCCATCTTTGAAGCTTGAAAGAAGAGTCTTTGGTATT
TTGTAAACGTTAGCAGACTTTCCTGCCAGTGTCAGAAAATCCTATTTATGAATCCTGTCGGTATTCCTTGGTATCTGAAAAAAATACCAA
ATAGTACCATACATGAGTTATTTCTAAGTTTGAAAAATAAAAAGAAATTGCATCACACTAATTACAAAATACAAGTTCTGGAAAAAATAT
TTTTCTTCATTTTAAAACTTTTTTTTAACTAATAATAGCTTTGAAAGAAGAGGCTTAATTTGGGGGTGGTAACTAAAATCAAAAGAAATG
ATTGACTTGAGGGTCTCTGTTTGGTAAGAATACATCATTAGCTTAAATAAGCAGCAGAAGGTTAGTTTTAATTATGTAGCTTCTGTTAAT
ATTAAGTGTTTTTTGTCTGTTTTACCTCAATTTGAACAGATAAGTTTGCCTGCATGCTGGACATGCCTCAGAACCCTGAATAGCCCGTAC
TAGATCTTGGGAACATGGATCTTAGAGTCACTTTGGAATAAGTTCTTATATAAATACCCCCAGCCTTTTGAGAACGGGGCTTGTTAAAGG
ACGCGTATGTAGGGCCCGTACCTACTGGCAGTTGGGTTCAGGGAAATGGGATTGACTTGGCCTTCAGGCTCCTTTGGTCATAATTTTAAA
ATATGGGAGTAGAAAACAACAAAGAATGGAATGGACTCTTAAAACAATGAAAGAGCATTTATCGTTTGTCCCTTGAATGTAGAATTTGTT
TTTGATTTCATAATTCTGCTGGTAAATGTGACAGTTAAAATGGTGCATTATGTATATATATTATAATTTAGAAATACCATTTTATAATTT
TACTATTCCAGGGTGACATAATGCATTTAAATTTGGGATTTGGGTGGAGTATTATGTTTAACTGGAGTTGTCAAGTATGAGTCCCTCAGG
AAAAAAAAAAAATTCTGTTTTAAAAAGCAATCTGATTCTTAGCTCTTGAAACTATTGCTACTTAAATTTCCAATAATTAAAAATTTAAAA
TTTTTAAATTAGAATTGCCAATACTTCTACATTTGAGAAGGGTTTTTTTAGAAATACATTTAGTAAAGTCCCCAAGACATTAGTCTTACA
TTTAAACTTTTTTCTTTAAAACATGGTTTTGGTGGTTAACTTTTACACAGTTCTGAGTACTGTTAATATCTGGAAAGTATCTTGAGATAT

>In-frame_TIA1_ENST00000282574_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_3602nt
TTAGTGTAATTGCCGCCGGAGGAGGAGGCGGAGTAACCTCTGGTCAGCCGAGAAACCCCACTATCCTGTAGCCATAACCGCTTAAACGAT
TTGGGAGGTAGTGAAGGGCAGGGAGCTGGACCTGGAGGCGCCGCCGCGACAGCAGCAGCCATGGAGGACGAGATGCCCAAGACTCTATAC
GTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATTGGACCTTGTAAAAACTGCAAAATGATTATG
GATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTGACTTTGTACGCTCAAGGTTTATTGACTGGT
GTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCTCTCCCTCATCTTACCAGGAGACTGGATATT
GCTGGGAGGGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTCAACCACTCTGCTGATTTTGAAACGGTTCGC
ATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCCTTAGAAACCACAGTATTAGTTGAATCTTAT
ACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCTTTATTTCAGCCTCACTTGATCAATGTTGAA
GGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGATCTGAATTCTACAAACACATTGTGCTTTCT
GGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTTTACTTAGAACGAGTTTTGAAGGGTGATGTG
GAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTATTCCTGGGTGGTGCAGTTCTAGCGGATATC
ATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGTGTGCTAGAGAAACTTGGTGTGACTGTTCGA
TAAACTCCAAAGCTTGTTCCCGTCATACCCGTAATGCTTTCTTTTTTCCTTTATTGCCAATCTTTGAACTCATTCAACTCCAGGACATGG
AAGAGGCCTCTCTCTGCCCTTTGACTGGAAAGGTCAAGTTTTATTCTGGTGTCTTGGGGAAGCTTTGTTAAATTTTTGTTAATGTGGGTA
AATCTGAGTTTAATTCAACTGCTTCCCTACATAGACTAGAGGGCTAAGGATTCTGTCTGCTGCTTTGTTTCTTCTAAGTAGGCATTTAGA
TCATTCCTATAGGCTTCCTATTTTCACTTTACTGCTCTAATGCTGCTAGTCGTAGTCTTTAGCACACTAGGTGGTATGCCTTTATTAGCA
TAAAACAAAAAAAACTTTAACAGGAGCTTTTACATATTACTGGGATGGGGGGTGGTTCGGGATGGGTGGGCAGCTGCTGAACCCTTTAGG
GCATTTCCTCTGTAATGTGGCGCTTTCAACTGTACTGCTGCAGCTTTAAGTACCTTAAAGCTTCTCCTGTGAACTTCTTAGGGAAATGTT
AGGTTCAGAACTAAAGTGTTTTGGGTGGGTTTTGTTGCGGGGGGGAGGGTAACAATGGGTGGTCTTCTGATTTTTATTTTTGAGGTTTTG
TCAACTGGAGTACGTAGAGGAACTTTATTTACAGTACTTTGATTTGGCAGGTTTTCTTCTACTTGTGCTCTGCCTGGAGCTGTTTCCATA
TGATATAAAAAGCAAGTGTAGTATTCCATTACTATGTGGCTTAGGGATTTATTTGTTTTTTAAAATCAACCATGTTAGCTGGGATTAGAC
TCCCTACAGTCCTTCAATGGAAAAGTAACATTTAAAAATCCTTTGGGTAATTCGAATTACAGATTTAAAAGAGCTTAAGATCTGGTGTTT
TGTTAATGCTTCTGTTTATTCCAGAAGCATTAAGGTAACCCATTGCCAAGTATCATTCTTGCAAATTATTCTTTTATATAACTGACCAGT
GCTTAATAAAACAAGCAGGTACTTACAAATAATTACTGGCAGTAGGTTATAATTGGTGGTTTAAAAATAACATTGGAATACAGGACTTGT
TGCCAATTGGGTAATTTTCATTAGTTGTTTTGTTTGTTTTGATTTGAAACCTGGAAATACAGTAAAATTTGACTGTTTAAAATGTTGGCC
AAAAAAATCAAGATTTAATTTTTTTATTTGTACTGAAAAACTAATCATAACTGTTAATTCTCAGCCATCTTTGAAGCTTGAAAGAAGAGT
CTTTGGTATTTTGTAAACGTTAGCAGACTTTCCTGCCAGTGTCAGAAAATCCTATTTATGAATCCTGTCGGTATTCCTTGGTATCTGAAA
AAAATACCAAATAGTACCATACATGAGTTATTTCTAAGTTTGAAAAATAAAAAGAAATTGCATCACACTAATTACAAAATACAAGTTCTG
GAAAAAATATTTTTCTTCATTTTAAAACTTTTTTTTAACTAATAATAGCTTTGAAAGAAGAGGCTTAATTTGGGGGTGGTAACTAAAATC
AAAAGAAATGATTGACTTGAGGGTCTCTGTTTGGTAAGAATACATCATTAGCTTAAATAAGCAGCAGAAGGTTAGTTTTAATTATGTAGC
TTCTGTTAATATTAAGTGTTTTTTGTCTGTTTTACCTCAATTTGAACAGATAAGTTTGCCTGCATGCTGGACATGCCTCAGAACCCTGAA
TAGCCCGTACTAGATCTTGGGAACATGGATCTTAGAGTCACTTTGGAATAAGTTCTTATATAAATACCCCCAGCCTTTTGAGAACGGGGC
TTGTTAAAGGACGCGTATGTAGGGCCCGTACCTACTGGCAGTTGGGTTCAGGGAAATGGGATTGACTTGGCCTTCAGGCTCCTTTGGTCA
TAATTTTAAAATATGGGAGTAGAAAACAACAAAGAATGGAATGGACTCTTAAAACAATGAAAGAGCATTTATCGTTTGTCCCTTGAATGT
AGAATTTGTTTTTGATTTCATAATTCTGCTGGTAAATGTGACAGTTAAAATGGTGCATTATGTATATATATTATAATTTAGAAATACCAT
TTTATAATTTTACTATTCCAGGGTGACATAATGCATTTAAATTTGGGATTTGGGTGGAGTATTATGTTTAACTGGAGTTGTCAAGTATGA
GTCCCTCAGGAAAAAAAAAAAATTCTGTTTTAAAAAGCAATCTGATTCTTAGCTCTTGAAACTATTGCTACTTAAATTTCCAATAATTAA
AAATTTAAAATTTTTAAATTAGAATTGCCAATACTTCTACATTTGAGAAGGGTTTTTTTAGAAATACATTTAGTAAAGTCCCCAAGACAT
TAGTCTTACATTTAAACTTTTTTCTTTAAAACATGGTTTTGGTGGTTAACTTTTACACAGTTCTGAGTACTGTTAATATCTGGAAAGTAT
CTTGAGATATCAGTGGAAAGCTAAACAGTCTAAATTAACATGAAATACTTCATTTTGATTGAGAAAATAAAATCAGATTTTTTCAAAGTC

>In-frame_TIA1_ENST00000445587_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_3632nt
GGTTTCATTGTTCCCGCTGGGCCGGGCGGTTTAGTGTAATTGCCGCCGGAGGAGGAGGCGGAGTAACCTCTGGTCAGCCGAGAAACCCCA
CTATCCTGTAGCCATAACCGCTTAAACGATTTGGGAGGTAGTGAAGGGCAGGGAGCTGGACCTGGAGGCGCCGCCGCGACAGCAGCAGCC
ATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTAATTCTGCAACTCTTTAGCCAGATT
GGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTG
ACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTATATGAAGGCTTTTCT
CTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTC
AACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCC
TTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCT
TTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCAGA
TCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAACTTAAACAGCTT
TACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTA
TTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTACCAAGAAAAGGGTGTCCGT
GTGCTAGAGAAACTTGGTGTGACTGTTCGATAAACTCCAAAGCTTGTTCCCGTCATACCCGTAATGCTTTCTTTTTTCCTTTATTGCCAA
TCTTTGAACTCATTCAACTCCAGGACATGGAAGAGGCCTCTCTCTGCCCTTTGACTGGAAAGGTCAAGTTTTATTCTGGTGTCTTGGGGA
AGCTTTGTTAAATTTTTGTTAATGTGGGTAAATCTGAGTTTAATTCAACTGCTTCCCTACATAGACTAGAGGGCTAAGGATTCTGTCTGC
TGCTTTGTTTCTTCTAAGTAGGCATTTAGATCATTCCTATAGGCTTCCTATTTTCACTTTACTGCTCTAATGCTGCTAGTCGTAGTCTTT
AGCACACTAGGTGGTATGCCTTTATTAGCATAAAACAAAAAAAACTTTAACAGGAGCTTTTACATATTACTGGGATGGGGGGTGGTTCGG
GATGGGTGGGCAGCTGCTGAACCCTTTAGGGCATTTCCTCTGTAATGTGGCGCTTTCAACTGTACTGCTGCAGCTTTAAGTACCTTAAAG
CTTCTCCTGTGAACTTCTTAGGGAAATGTTAGGTTCAGAACTAAAGTGTTTTGGGTGGGTTTTGTTGCGGGGGGGAGGGTAACAATGGGT
GGTCTTCTGATTTTTATTTTTGAGGTTTTGTCAACTGGAGTACGTAGAGGAACTTTATTTACAGTACTTTGATTTGGCAGGTTTTCTTCT
ACTTGTGCTCTGCCTGGAGCTGTTTCCATATGATATAAAAAGCAAGTGTAGTATTCCATTACTATGTGGCTTAGGGATTTATTTGTTTTT
TAAAATCAACCATGTTAGCTGGGATTAGACTCCCTACAGTCCTTCAATGGAAAAGTAACATTTAAAAATCCTTTGGGTAATTCGAATTAC
AGATTTAAAAGAGCTTAAGATCTGGTGTTTTGTTAATGCTTCTGTTTATTCCAGAAGCATTAAGGTAACCCATTGCCAAGTATCATTCTT
GCAAATTATTCTTTTATATAACTGACCAGTGCTTAATAAAACAAGCAGGTACTTACAAATAATTACTGGCAGTAGGTTATAATTGGTGGT
TTAAAAATAACATTGGAATACAGGACTTGTTGCCAATTGGGTAATTTTCATTAGTTGTTTTGTTTGTTTTGATTTGAAACCTGGAAATAC
AGTAAAATTTGACTGTTTAAAATGTTGGCCAAAAAAATCAAGATTTAATTTTTTTATTTGTACTGAAAAACTAATCATAACTGTTAATTC
TCAGCCATCTTTGAAGCTTGAAAGAAGAGTCTTTGGTATTTTGTAAACGTTAGCAGACTTTCCTGCCAGTGTCAGAAAATCCTATTTATG
AATCCTGTCGGTATTCCTTGGTATCTGAAAAAAATACCAAATAGTACCATACATGAGTTATTTCTAAGTTTGAAAAATAAAAAGAAATTG
CATCACACTAATTACAAAATACAAGTTCTGGAAAAAATATTTTTCTTCATTTTAAAACTTTTTTTTAACTAATAATAGCTTTGAAAGAAG
AGGCTTAATTTGGGGGTGGTAACTAAAATCAAAAGAAATGATTGACTTGAGGGTCTCTGTTTGGTAAGAATACATCATTAGCTTAAATAA
GCAGCAGAAGGTTAGTTTTAATTATGTAGCTTCTGTTAATATTAAGTGTTTTTTGTCTGTTTTACCTCAATTTGAACAGATAAGTTTGCC
TGCATGCTGGACATGCCTCAGAACCCTGAATAGCCCGTACTAGATCTTGGGAACATGGATCTTAGAGTCACTTTGGAATAAGTTCTTATA
TAAATACCCCCAGCCTTTTGAGAACGGGGCTTGTTAAAGGACGCGTATGTAGGGCCCGTACCTACTGGCAGTTGGGTTCAGGGAAATGGG
ATTGACTTGGCCTTCAGGCTCCTTTGGTCATAATTTTAAAATATGGGAGTAGAAAACAACAAAGAATGGAATGGACTCTTAAAACAATGA
AAGAGCATTTATCGTTTGTCCCTTGAATGTAGAATTTGTTTTTGATTTCATAATTCTGCTGGTAAATGTGACAGTTAAAATGGTGCATTA
TGTATATATATTATAATTTAGAAATACCATTTTATAATTTTACTATTCCAGGGTGACATAATGCATTTAAATTTGGGATTTGGGTGGAGT
ATTATGTTTAACTGGAGTTGTCAAGTATGAGTCCCTCAGGAAAAAAAAAAAATTCTGTTTTAAAAAGCAATCTGATTCTTAGCTCTTGAA
ACTATTGCTACTTAAATTTCCAATAATTAAAAATTTAAAATTTTTAAATTAGAATTGCCAATACTTCTACATTTGAGAAGGGTTTTTTTA
GAAATACATTTAGTAAAGTCCCCAAGACATTAGTCTTACATTTAAACTTTTTTCTTTAAAACATGGTTTTGGTGGTTAACTTTTACACAG
TTCTGAGTACTGTTAATATCTGGAAAGTATCTTGAGATATCAGTGGAAAGCTAAACAGTCTAAATTAACATGAAATACTTCATTTTGATT

>In-frame_TIA1_ENST00000416149_chr2_70463211_-_ACTR2_ENST00000260641_chr2_65478161_+_3476nt
GGCGCCGCCGCGACAGCAGCAGCCATGGAGGACGAGATGCCCAAGACTCTATACGTCGGTAACCTTTCCAGAGATGTGACAGAAGCTCTA
ATTCTGCAACTCTTTAGCCAGATTGGACCTTGTAAAAACTGCAAAATGATTATGGATGTAATGTTTGAAACTTACCAGTTTTCCGGTGTA
TATGTAGCCATCCAGGCAGTTCTGACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATT
TGCCCAGTATATGAAGGCTTTTCTCTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAACTAGATATCTTATCAAGCTA
CTTCTGTTGCGAGGATACGCCTTCAACCACTCTGCTGATTTTGAAACGGTTCGCATGATTAAAGAAAAACTGTGTTACGTGGGATATAAT
ATTGAGCAAGAGCAGAAACTGGCCTTAGAAACCACAGTATTAGTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGA
GAGAGATTTGAAGCACCAGAAGCTTTATTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATT
CAGGCAGCTGACATTGATACCAGATCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGG
TTGGAACGAGAACTTAAACAGCTTTACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGAC
CCACCCCGCAGAAAGCACATGGTATTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAA
GAGTACCAAGAAAAGGGTGTCCGTGTGCTAGAGAAACTTGGTGTGACTGTTCGATAAACTCCAAAGCTTGTTCCCGTCATACCCGTAATG
CTTTCTTTTTTCCTTTATTGCCAATCTTTGAACTCATTCAACTCCAGGACATGGAAGAGGCCTCTCTCTGCCCTTTGACTGGAAAGGTCA
AGTTTTATTCTGGTGTCTTGGGGAAGCTTTGTTAAATTTTTGTTAATGTGGGTAAATCTGAGTTTAATTCAACTGCTTCCCTACATAGAC
TAGAGGGCTAAGGATTCTGTCTGCTGCTTTGTTTCTTCTAAGTAGGCATTTAGATCATTCCTATAGGCTTCCTATTTTCACTTTACTGCT
CTAATGCTGCTAGTCGTAGTCTTTAGCACACTAGGTGGTATGCCTTTATTAGCATAAAACAAAAAAAACTTTAACAGGAGCTTTTACATA
TTACTGGGATGGGGGGTGGTTCGGGATGGGTGGGCAGCTGCTGAACCCTTTAGGGCATTTCCTCTGTAATGTGGCGCTTTCAACTGTACT
GCTGCAGCTTTAAGTACCTTAAAGCTTCTCCTGTGAACTTCTTAGGGAAATGTTAGGTTCAGAACTAAAGTGTTTTGGGTGGGTTTTGTT
GCGGGGGGGAGGGTAACAATGGGTGGTCTTCTGATTTTTATTTTTGAGGTTTTGTCAACTGGAGTACGTAGAGGAACTTTATTTACAGTA
CTTTGATTTGGCAGGTTTTCTTCTACTTGTGCTCTGCCTGGAGCTGTTTCCATATGATATAAAAAGCAAGTGTAGTATTCCATTACTATG
TGGCTTAGGGATTTATTTGTTTTTTAAAATCAACCATGTTAGCTGGGATTAGACTCCCTACAGTCCTTCAATGGAAAAGTAACATTTAAA
AATCCTTTGGGTAATTCGAATTACAGATTTAAAAGAGCTTAAGATCTGGTGTTTTGTTAATGCTTCTGTTTATTCCAGAAGCATTAAGGT
AACCCATTGCCAAGTATCATTCTTGCAAATTATTCTTTTATATAACTGACCAGTGCTTAATAAAACAAGCAGGTACTTACAAATAATTAC
TGGCAGTAGGTTATAATTGGTGGTTTAAAAATAACATTGGAATACAGGACTTGTTGCCAATTGGGTAATTTTCATTAGTTGTTTTGTTTG
TTTTGATTTGAAACCTGGAAATACAGTAAAATTTGACTGTTTAAAATGTTGGCCAAAAAAATCAAGATTTAATTTTTTTATTTGTACTGA
AAAACTAATCATAACTGTTAATTCTCAGCCATCTTTGAAGCTTGAAAGAAGAGTCTTTGGTATTTTGTAAACGTTAGCAGACTTTCCTGC
CAGTGTCAGAAAATCCTATTTATGAATCCTGTCGGTATTCCTTGGTATCTGAAAAAAATACCAAATAGTACCATACATGAGTTATTTCTA
AGTTTGAAAAATAAAAAGAAATTGCATCACACTAATTACAAAATACAAGTTCTGGAAAAAATATTTTTCTTCATTTTAAAACTTTTTTTT
AACTAATAATAGCTTTGAAAGAAGAGGCTTAATTTGGGGGTGGTAACTAAAATCAAAAGAAATGATTGACTTGAGGGTCTCTGTTTGGTA
AGAATACATCATTAGCTTAAATAAGCAGCAGAAGGTTAGTTTTAATTATGTAGCTTCTGTTAATATTAAGTGTTTTTTGTCTGTTTTACC
TCAATTTGAACAGATAAGTTTGCCTGCATGCTGGACATGCCTCAGAACCCTGAATAGCCCGTACTAGATCTTGGGAACATGGATCTTAGA
GTCACTTTGGAATAAGTTCTTATATAAATACCCCCAGCCTTTTGAGAACGGGGCTTGTTAAAGGACGCGTATGTAGGGCCCGTACCTACT
GGCAGTTGGGTTCAGGGAAATGGGATTGACTTGGCCTTCAGGCTCCTTTGGTCATAATTTTAAAATATGGGAGTAGAAAACAACAAAGAA
TGGAATGGACTCTTAAAACAATGAAAGAGCATTTATCGTTTGTCCCTTGAATGTAGAATTTGTTTTTGATTTCATAATTCTGCTGGTAAA
TGTGACAGTTAAAATGGTGCATTATGTATATATATTATAATTTAGAAATACCATTTTATAATTTTACTATTCCAGGGTGACATAATGCAT
TTAAATTTGGGATTTGGGTGGAGTATTATGTTTAACTGGAGTTGTCAAGTATGAGTCCCTCAGGAAAAAAAAAAAATTCTGTTTTAAAAA
GCAATCTGATTCTTAGCTCTTGAAACTATTGCTACTTAAATTTCCAATAATTAAAAATTTAAAATTTTTAAATTAGAATTGCCAATACTT
CTACATTTGAGAAGGGTTTTTTTAGAAATACATTTAGTAAAGTCCCCAAGACATTAGTCTTACATTTAAACTTTTTTCTTTAAAACATGG
TTTTGGTGGTTAACTTTTACACAGTTCTGAGTACTGTTAATATCTGGAAAGTATCTTGAGATATCAGTGGAAAGCTAAACAGTCTAAATT


Top

FusionGenePPI for TIA1_ACTR2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TIA1FASTK, RICTOR, CUL3, CUL4A, CUL5, CUL2, CUL1, COPS5, DCUN1D1, CAND1, SRSF3, WDR6, FMNL1, FN1, VCAM1, ITGA4, SOX2, BMI1, LUC7L2, MPI, PCBP1, PCBP2, PITPNB, SNRPD1, DAZAP1, DDX58, HTRA2, PIR, NTRK1, AK1, ELL2, POLK, CXXC4, NETO2, ESR1, DPPA4, BCOR, NANOG, POU5F1, G3BP1ACTR2ACTR3B, BAK1, ACTR3, BMP2, CTTN, ESR1, ACTB, UBC, ELAVL1, SIRT7, CUL3, LRRK2, ARPC1B, ARPC4, ARPC5, ARPC2, ARPC3, ARPC1A, ARPC5L, CORO1C, UBE2N, FN1, VCAM1, WASL, ELF5, ANP32B, BAG1, CALR, DHPS, EEF2K, EFTUD1, P3H1, OSGEP, TTLL12, ALAD, CALU, CRTAP, FUBP1, GRPEL1, HIST1H2AB, HSPBP1, KIAA1279, METTL1, NIF3L1, NSUN2, OGT, PANK4, PPME1, PRKACB, RANGAP1, RPA1, RPRD1A, RPRD1B, SH3GL1, SH3GLB1, SRP9, SURF2, TOM1L1, TP53RK, TPD52L2, TPRKB, UFM1, WDR4, ZPR1, CUL7, OBSL1, EGFR, UNK, CAPZA1, CCT5, CORO1A, EFHD2, PSMD7, STXBP1, ARPC4-TTLL3, CAPZA2, CORO1B, FAM98B, NTRK1, KRAS, PCM1, CEP170, CEP128, NIN, SCLT1, EVC2, STIL, XPO1, CCT6A, CFL1, CLTA, CLTB, DAB2, DBN1, DSG2, GSN, ITPR3, MYO6, PPP1R12A, SVIL, TCP1, CCT3, LUZP1, GPRC5A, FLNA, MYH9, PPP1CB, IQGAP1, ATP6AP2, SYNPO, ANLN, MYO5C, MYO19, MYO18A, BASP1, CCT7, CCT4, CCT2, CCT8, COBL, LIMA1, RBM27, METTL3, INF2, PDCL3, CYBRD1, CHURC1, SPECC1, MISP, FBXW7, SNW1, CDC5L, HSD17B10


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TIA1_ACTR2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TIA1_ACTR2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTIA1C0221054Welander Distal Myopathy1UNIPROT
TgeneACTR2C0036341Schizophrenia1PSYGENET