FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3796

FusionGeneSummary for BAG4_NEDD8

check button Fusion gene summary
Fusion gene informationFusion gene name: BAG4_NEDD8
Fusion gene ID: 3796
HgeneTgene
Gene symbol

BAG4

NEDD8

Gene ID

9530

4738

Gene nameBCL2 associated athanogene 4neural precursor cell expressed, developmentally down-regulated 8
SynonymsBAG-4|SODDNEDD-8
Cytomap

8p11.23

14q12

Type of geneprotein-codingprotein-coding
DescriptionBAG family molecular chaperone regulator 4bcl-2-associated athanogene 4silencer of death domainsNEDD8neddylinubiquitin-like protein Nedd8
Modification date2018052220180527
UniProtAcc

O95429

Q15843

Ensembl transtripts involved in fusion geneENST00000521282, ENST00000432471, 
ENST00000287322, 
ENST00000250495, 
ENST00000524927, ENST00000533242, 
Fusion gene scores* DoF score8 X 3 X 4=961 X 1 X 1=1
# samples 81
** MAII scorelog2(8/96*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: BAG4 [Title/Abstract] AND NEDD8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBAG4

GO:0071356

cellular response to tumor necrosis factor

21712384

TgeneNEDD8

GO:0045116

protein neddylation

10500095


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-EW-A1PH-01ABAG4chr8

38034657

+NEDD8chr14

24687637

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
3UTR-3CDSENST00000521282ENST00000250495BAG4chr8

38034657

+NEDD8chr14

24687637

-
3UTR-3CDSENST00000521282ENST00000524927BAG4chr8

38034657

+NEDD8chr14

24687637

-
3UTR-intronENST00000521282ENST00000533242BAG4chr8

38034657

+NEDD8chr14

24687637

-
In-frameENST00000432471ENST00000250495BAG4chr8

38034657

+NEDD8chr14

24687637

-
In-frameENST00000432471ENST00000524927BAG4chr8

38034657

+NEDD8chr14

24687637

-
5CDS-intronENST00000432471ENST00000533242BAG4chr8

38034657

+NEDD8chr14

24687637

-
In-frameENST00000287322ENST00000250495BAG4chr8

38034657

+NEDD8chr14

24687637

-
In-frameENST00000287322ENST00000524927BAG4chr8

38034657

+NEDD8chr14

24687637

-
5CDS-intronENST00000287322ENST00000533242BAG4chr8

38034657

+NEDD8chr14

24687637

-

Top

FusionProtFeatures for BAG4_NEDD8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BAG4

O95429

NEDD8

Q15843

Inhibits the chaperone activity of HSP70/HSC70 bypromoting substrate release (By similarity). Prevents constitutiveTNFRSF1A signaling. Negative regulator of PRKN translocation todamaged mitochondria. {ECO:0000250, ECO:0000269|PubMed:24270810}. Ubiquitin-like protein which plays an important role incell cycle control and embryogenesis. Covalent attachment to itssubstrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 tocullins activates their associated E3 ubiquitin ligase activity,and thus promotes polyubiquitination and proteasomal degradationof cyclins and other regulatory proteins.{ECO:0000269|PubMed:10318914, ECO:0000269|PubMed:10597293,ECO:0000269|PubMed:11953428}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for BAG4_NEDD8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BAG4_ENST00000432471_chr8_38034657_+_NEDD8_ENST00000250495_chr14_24687637_-_166aa
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQ

>In-frame_BAG4_ENST00000432471_chr8_38034657_+_NEDD8_ENST00000524927_chr14_24687637_-_135aa
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQ

>In-frame_BAG4_ENST00000287322_chr8_38034657_+_NEDD8_ENST00000250495_chr14_24687637_-_166aa
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQ

>In-frame_BAG4_ENST00000287322_chr8_38034657_+_NEDD8_ENST00000524927_chr14_24687637_-_135aa
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BAG4_ENST00000432471_chr8_38034657_+_NEDD8_ENST00000250495_chr14_24687637_-_498nt
ATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGAGATGTGCCGGTA
CACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGCCCGGCGGAGACC
ACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGAGGAAGCCACCAG
ACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATC
CCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGTC

>In-frame_BAG4_ENST00000432471_chr8_38034657_+_NEDD8_ENST00000524927_chr14_24687637_-_405nt
ATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGAGATGTGCCGGTA
CACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGCCCGGCGGAGACC
ACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGAGGAAGCCACCAG
ACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATC

>In-frame_BAG4_ENST00000287322_chr8_38034657_+_NEDD8_ENST00000250495_chr14_24687637_-_498nt
ATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGAGATGTGCCGGTA
CACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGCCCGGCGGAGACC
ACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGAGGAAGCCACCAG
ACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATC
CCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGTC

>In-frame_BAG4_ENST00000287322_chr8_38034657_+_NEDD8_ENST00000524927_chr14_24687637_-_405nt
ATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGAGATGTGCCGGTA
CACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGCCCGGCGGAGACC
ACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGAGGAAGCCACCAG
ACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BAG4_ENST00000432471_chr8_38034657_+_NEDD8_ENST00000250495_chr14_24687637_-_1055nt
AGGTAAGAGGAAACTCCATTGGATAAATGGCGAGGAAACGTATACTCCCTCTTAAGGAACACGGTGTCTTCCTTCGTCTCCGGGTTCCCG
AGACCCCAGAGTCACTGACCTCCGTCCCTCAGCTTTCGGGGTTCGGCAGCAGAAGGGGCGGGCCCGGGCCTGGGATTGGCTGGCGTCGTC
CGACCCCCTTCGCTGCTCTCCATTCGCAATCGCCCGCGGGCGCCTGCGCGATGGGTCGGCCGTGGGGAGCGGGGCGGGAAGCGCTTCAGG
GCAGCGGATCCCATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGA
GATGTGCCGGTACACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGC
CCGGCGGAGACCACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGA
GGAAGCCACCAGACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAG
AAAGAGGGAATCCCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTA
GGTGGTTCAGTCCTTCACCTGGTGTTGGCTCTGAGAGGAGGAGGTGGTCTTAGGCAGTGATGGACCCTCCATTTTACCTCTTTACCCTGT
CGCTCATAATGAGGCATCATATATCCTCTCACTCTCTGGGACACCATAGCCACTGCCCCCTCCCCTGGATGCCCAGTAATGTATGTCTAC
TGGTGGGAGACTGTGAGGATCCCAGGATTCAGTATTCCTGGCCCAGAGGGCCCTTGCTGGCTACTGGGTGTTAGTTTGCAGTCCTGTGTG

>In-frame_BAG4_ENST00000432471_chr8_38034657_+_NEDD8_ENST00000524927_chr14_24687637_-_1100nt
AGGTAAGAGGAAACTCCATTGGATAAATGGCGAGGAAACGTATACTCCCTCTTAAGGAACACGGTGTCTTCCTTCGTCTCCGGGTTCCCG
AGACCCCAGAGTCACTGACCTCCGTCCCTCAGCTTTCGGGGTTCGGCAGCAGAAGGGGCGGGCCCGGGCCTGGGATTGGCTGGCGTCGTC
CGACCCCCTTCGCTGCTCTCCATTCGCAATCGCCCGCGGGCGCCTGCGCGATGGGTCGGCCGTGGGGAGCGGGGCGGGAAGCGCTTCAGG
GCAGCGGATCCCATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGA
GATGTGCCGGTACACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGC
CCGGCGGAGACCACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGA
GGAAGCCACCAGACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAG
AAAGAGGGAATCCCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGTGAGTTTGGAGTGAGAATGACAGCATGGCGATCTTA
TGTGAAGATGAGAAGAGGAGAGGGGGCACGTACTGAGGTGGATCAGGGGTGCCTCTTGTTTTTGGTGCCTAAGACTCTTTGGCAATCTGG
TGAAGCCTCTAAGCCCCTTCTCAGAATAAGATTTTTTCAGGCATAAAACAAAATATATAGAATTAAAGGAAAACTAATTATATTGAAATA
GTTATTAAAATACTAAAACAAATTTGTGATATAGTAATATATGTACTTTTTTATTAATGCATAAGATCTAATGGTAGGTCTAATATGACC
ATAATTTTGAAATATTTTCAAGATACCTATAAATGATCATGATAGAAAATAGTTAATTGCTATTGTTAACAAGTTACCTATATTGCTAAT

>In-frame_BAG4_ENST00000287322_chr8_38034657_+_NEDD8_ENST00000250495_chr14_24687637_-_1044nt
AACTCCATTGGATAAATGGCGAGGAAACGTATACTCCCTCTTAAGGAACACGGTGTCTTCCTTCGTCTCCGGGTTCCCGAGACCCCAGAG
TCACTGACCTCCGTCCCTCAGCTTTCGGGGTTCGGCAGCAGAAGGGGCGGGCCCGGGCCTGGGATTGGCTGGCGTCGTCCGACCCCCTTC
GCTGCTCTCCATTCGCAATCGCCCGCGGGCGCCTGCGCGATGGGTCGGCCGTGGGGAGCGGGGCGGGAAGCGCTTCAGGGCAGCGGATCC
CATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGAGATGTGCCGGT
ACACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGCCCGGCGGAGAC
CACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGAGGAAGCCACCA
GACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAAT
CCCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGT
CCTTCACCTGGTGTTGGCTCTGAGAGGAGGAGGTGGTCTTAGGCAGTGATGGACCCTCCATTTTACCTCTTTACCCTGTCGCTCATAATG
AGGCATCATATATCCTCTCACTCTCTGGGACACCATAGCCACTGCCCCCTCCCCTGGATGCCCAGTAATGTATGTCTACTGGTGGGAGAC
TGTGAGGATCCCAGGATTCAGTATTCCTGGCCCAGAGGGCCCTTGCTGGCTACTGGGTGTTAGTTTGCAGTCCTGTGTGCTTCCCTCTCT

>In-frame_BAG4_ENST00000287322_chr8_38034657_+_NEDD8_ENST00000524927_chr14_24687637_-_1089nt
AACTCCATTGGATAAATGGCGAGGAAACGTATACTCCCTCTTAAGGAACACGGTGTCTTCCTTCGTCTCCGGGTTCCCGAGACCCCAGAG
TCACTGACCTCCGTCCCTCAGCTTTCGGGGTTCGGCAGCAGAAGGGGCGGGCCCGGGCCTGGGATTGGCTGGCGTCGTCCGACCCCCTTC
GCTGCTCTCCATTCGCAATCGCCCGCGGGCGCCTGCGCGATGGGTCGGCCGTGGGGAGCGGGGCGGGAAGCGCTTCAGGGCAGCGGATCC
CATGTCGGCCCTGAGGCGCTCGGGCTACGGCCCCAGTGACGGTCCGTCCTACGGCCGCTACTACGGGCCTGGGGGTGGAGATGTGCCGGT
ACACCCACCTCCACCCTTATATCCTCTTCGCCCTGAACCTCCCCAGCCTCCCATTTCCTGGCGGGTGCGCGGGGGCGGCCCGGCGGAGAC
CACCTGGCTGGGAGAAGGCGGAGGAGGCGATGGCTACTATCCCTCGGGAGGCGCCTGGCCAGAGCCTGGTCGAGCCGGAGGAAGCCACCA
GACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAAT
CCCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGTGAGTTTGGAGTGAGAATGACAGCATGGCGATCTTATGTGAAGATGA
GAAGAGGAGAGGGGGCACGTACTGAGGTGGATCAGGGGTGCCTCTTGTTTTTGGTGCCTAAGACTCTTTGGCAATCTGGTGAAGCCTCTA
AGCCCCTTCTCAGAATAAGATTTTTTCAGGCATAAAACAAAATATATAGAATTAAAGGAAAACTAATTATATTGAAATAGTTATTAAAAT
ACTAAAACAAATTTGTGATATAGTAATATATGTACTTTTTTATTAATGCATAAGATCTAATGGTAGGTCTAATATGACCATAATTTTGAA
ATATTTTCAAGATACCTATAAATGATCATGATAGAAAATAGTTAATTGCTATTGTTAACAAGTTACCTATATTGCTAATACTACTGTGGT


Top

FusionGenePPI for BAG4_NEDD8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BAG4APOBEC1, HSP90AA1, HSPA4, TNFRSF1A, TNFRSF25, HSPA8, ELAVL1, CUL3, CUL4A, CUL5, CUL2, CUL1, COPS5, DCUN1D1, CAND1, NEDD8, MCL1, DCP1A, DCP1B, HSPA2, STUB1, MLF2, DNAJB6, DNAJB1, EDC3, HSPA1B, HSPA1L, DNAJC9, DNAJB12, DDX6, CD93, DNAJC7, MOV10, NXF1, FBXW11, BEX1, IL24, LYPD3, BCAS3, NAT2, ATAD2, BAP1, KLK5, RNF20, SCGB3A1, THRSP, CASZ1, CCL5, DIRAS3, EPSTI1, FAM84B, GLCE, IL13RA2, KLK9, PDLIM2, ERRFI1, KLK7, MTA3, PRDM14, RASL10B, ITIH5, MRC2, RHOBTB2, MCM2, WWP2, C3orf38, HSF1, DNAJC13, BCORL1, KLHL18, HSF2, ZNF318, GMNN, ENDOG, WNK1, FLYWCH2, ZNF703, BRCA2, QRICH1, EDC4, YAP1, SF3A3, DNAJB5, NMT1NEDD8FBXO4, MAGED1, VHL, CDK2, TFE3, UCHL1, AHR, RBX1, CUL4A, UCHL3, NUB1, PSMD4, UBA2, COPS5, COPS6, USP13, USP25, DDB1, UBA3, NAE1, UBE2M, SENP8, DNMT3B, UBC, BTRC, UBXN7, SKP1, CUL1, CUL2, CUL3, TCEB2, TCEB1, MEI1, COPS2, COPS3, COPS4, COPS7A, ZYX, CUL4B, PSMA1, PSMA2, PSMA3, PSMA4, PSMA5, PSMA6, PSMA7, CTRC, UBE2D2, CUL5, DCUN1D1, ACTB, ACTBL2, AHCY, ARIH1, BAG4, BTBD9, C1QBP, DFFB, CIRBP, CLTC, CLTCL1, COPS7B, COPS8, YBX3, CTPS1, DAZAP1, DCTPP1, DDX1, DDX17, DDX3X, DDX5, DHX9, DNAJC10, DSP, EEF1A1, EEF1A2, EEF1G, EWSR1, FBXO3, FBXW11, FEM1B, FUS, GAPDH, GPS1, HIST1H1C, HNRNPA0, HNRNPA1, HNRNPA2B1, HNRNPA3, HNRNPAB, HNRNPC, HNRNPD, HNRNPF, HNRNPH1, HNRNPH3, HNRNPK, HNRNPR, HNRNPU, HNRNPUL1, HNRNPDL, HSP90AA1, HSP90AA2P, HSPA1A, HSPA1B, HSPA1L, HSPA4, HSPA5, HSPA6, HSPA7, HSPA8, HSPA9, HSPD1, IGF2BP1, ILF2, ILF3, KBTBD6, KBTBD7, KCTD10, KCTD3, KHSRP, KLHDC10, KLHL12, KLHL15, KLHL22, KLHL9, KPNA2, KRT1, KRT10, KRT13, KRT14, KRT16, KRT2, KRT24, KRT5, KRT75, KRT76, KRT9, LGALS3BP, IGHV3OR15-7, MATR3, MYEOV2, NCL, NEDD8, NUDT16L1, NUP155, PABPC1, PPIA, PRDX1, PWP1, QPCT, RNF187, RPL10P16, RPL11, RPL15, RPL19, RPL23A, RPL31, RPL35, RPL36AP37, HNRNPH2, RPL4, RPL5, RPL6, RPL7AP9, RPL8, RPLP0, RPLP1, RPLP2, RPS10, RPS15A, RPS16, RPS20, RPS23, RPS3, RPS3A, RPS4X, RPS8, RPSAP12, RPSAP55, SDHA, SEC23A, SERBP1, SRSF2, SRSF7, SHKBP1, SNRPC, SNRPD1, SPTAN1, SPTBN1, SSB, STRBP, SYNCRIP, TAF15, TBC1D15, TCEB1P3, TFG, TIAL1, TNRC6B, TTN, TUBA1C, TUBA4A, TUBB, TUBB4B, USP11, VPRBP, DCAF11, YBX1, YWHAE, YWHAQ, YWHAZ, ZYG11B, HIST1H2AB, HIST1H2AE, HIST1H2AG, HIST1H2AL, HIST1H2AJ, HIST1H2AK, HIST1H2AI, HIST1H2AM, FBXO6, ATXN3, OR4S2, TST, CLNS1A, NDUFS6, IGBP1, HRAS, CPLX1, MSRB2, BRAP, ARIH2, ASL, GDI1, POP1, ASB8, SHFM1, HGS, OTUB1, KLHDC3, ATP6V1F, HIBCH, MEMO1, MPI, C9orf64, DNAJC8, HMGCS1, PPA2, TKT, UBE2D3, UFC1, YAP1, NIT1, PRDX5, RAB8B, GHR, SMURF2, SMURF1, TCEB3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BAG4_NEDD8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BAG4_NEDD8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource