FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37832

FusionGeneSummary for TFE3_MED15

check button Fusion gene summary
Fusion gene informationFusion gene name: TFE3_MED15
Fusion gene ID: 37832
HgeneTgene
Gene symbol

TFE3

MED15

Gene ID

7030

51586

Gene nametranscription factor binding to IGHM enhancer 3mediator complex subunit 15
SynonymsRCCP2|RCCX1|TFEA|bHLHe33ARC105|CAG7A|CTG7A|PCQAP|TIG-1|TIG1|TNRC7
Cytomap

Xp11.23

22q11.21

Type of geneprotein-codingprotein-coding
Descriptiontranscription factor E3class E basic helix-loop-helix protein 33transcription factor E family, member Atranscription factor for IgH enhancertranscription factor for immunoglobulin heavy-chain enhancer 3mediator of RNA polymerase II transcription subunit 15CTG repeat protein 7aPC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated proteinPC2 glutamine/Q-rich-associated proteinPC2-glutamine-rich-associated proteinTPA inducible ge
Modification date2018052720180523
UniProtAcc

P19532

Q96RN5

Ensembl transtripts involved in fusion geneENST00000315869, ENST00000487451, 
ENST00000425759, ENST00000292733, 
ENST00000542773, ENST00000263205, 
ENST00000406969, ENST00000382974, 
ENST00000541476, ENST00000478831, 
Fusion gene scores* DoF score5 X 5 X 3=7513 X 9 X 7=819
# samples 615
** MAII scorelog2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/819*10)=-2.44890095114513
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TFE3 [Title/Abstract] AND MED15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRCTCGA-6D-AA2E-01ATFE3chrX

48895535

-MED15chr22

20936898

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000315869ENST00000425759TFE3chrX

48895535

-MED15chr22

20936898

+
In-frameENST00000315869ENST00000292733TFE3chrX

48895535

-MED15chr22

20936898

+
5CDS-intronENST00000315869ENST00000542773TFE3chrX

48895535

-MED15chr22

20936898

+
5CDS-intronENST00000315869ENST00000263205TFE3chrX

48895535

-MED15chr22

20936898

+
5CDS-intronENST00000315869ENST00000406969TFE3chrX

48895535

-MED15chr22

20936898

+
5CDS-intronENST00000315869ENST00000382974TFE3chrX

48895535

-MED15chr22

20936898

+
5CDS-intronENST00000315869ENST00000541476TFE3chrX

48895535

-MED15chr22

20936898

+
5CDS-intronENST00000315869ENST00000478831TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-3CDSENST00000487451ENST00000425759TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-3CDSENST00000487451ENST00000292733TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-intronENST00000487451ENST00000542773TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-intronENST00000487451ENST00000263205TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-intronENST00000487451ENST00000406969TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-intronENST00000487451ENST00000382974TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-intronENST00000487451ENST00000541476TFE3chrX

48895535

-MED15chr22

20936898

+
5UTR-intronENST00000487451ENST00000478831TFE3chrX

48895535

-MED15chr22

20936898

+

Top

FusionProtFeatures for TFE3_MED15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TFE3

P19532

MED15

Q96RN5

Transcription factor that specifically recognizes andbinds E-box sequences (5'-CANNTG-3'). Efficient DNA-bindingrequires dimerization with itself or with another MiT/TFE familymember such as TFEB or MITF. In association with TFEB, activatesthe expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells andthymus-dependent humoral immunity. Specifically recognizes theMUE3 box, a subset of E-boxes, present in the immunoglobulinenhancer. It also binds very well to a USF/MLTF site.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTFE3chrX:48895535chr22:20936898ENST00000315869-510260_271295576RegionStrong transcription activation domain
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818449_456424789Compositional biasNote=Poly-Pro
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818602_611424789Compositional biasNote=Poly-Pro
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717449_456384749Compositional biasNote=Poly-Pro
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717602_611384749Compositional biasNote=Poly-Pro
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616360_367313678Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616449_456313678Compositional biasNote=Poly-Pro
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616602_611313678Compositional biasNote=Poly-Pro
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818547_564424789MotifNuclear localization signal
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717547_564384749MotifNuclear localization signal
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616547_564313678MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTFE3chrX:48895535chr22:20936898ENST00000315869-510346_399295576DomainbHLH
HgeneTFE3chrX:48895535chr22:20936898ENST00000315869-510409_430295576RegionNote=Leucine-zipper
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818161_174424789Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818178_193424789Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818205_218424789Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818226_239424789Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818243_262424789Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818266_515424789Compositional biasNote=Pro-rich
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+818360_367424789Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717161_174384749Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717178_193384749Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717205_218384749Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717226_239384749Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717243_262384749Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717266_515384749Compositional biasNote=Pro-rich
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+717360_367384749Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616161_174313678Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616178_193313678Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616205_218313678Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616226_239313678Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616243_262313678Compositional biasNote=Poly-Gln
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+616266_515313678Compositional biasNote=Pro-rich


Top

FusionGeneSequence for TFE3_MED15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TFE3_ENST00000315869_chrX_48895535_-_MED15_ENST00000425759_chr22_20936898_+_660aa
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQPLPLRSSLPISLQATPATPA
TLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQ
THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIIS
LESSYNDEMLSYLPGGTTGLQLPSTVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPS
QSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKR
CPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDD
ERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSR

>In-frame_TFE3_ENST00000315869_chrX_48895535_-_MED15_ENST00000292733_chr22_20936898_+_660aa
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQPLPLRSSLPISLQATPATPA
TLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQ
THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIIS
LESSYNDEMLSYLPGGTTGLQLPSTVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPS
QSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKR
CPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDD
ERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TFE3_ENST00000315869_chrX_48895535_-_MED15_ENST00000425759_chr22_20936898_+_1980nt
ATGTCTCATGCGGCCGAACCAGCTCGGGATGGCGTAGAGGCCAGCGCGGAGGGCCCTCGAGCCGTGTTCGTGCTGTTGGAGGAGCGCAGG
CCGGCCGACTCGGCTCAGCTGCTCAGCCTGAACTCTTTGCTTCCGGAATCCGGGATTGTTGCTGACATAGAATTAGAAAACGTCCTTGAT
CCTGACAGCTTCTACGAGCTCAAAAGCCAACCCTTACCCCTTCGCTCAAGCCTCCCAATATCACTGCAGGCCACACCAGCCACCCCAGCT
ACACTCTCTGCATCGTCTTCTGCAGGGGGCTCCAGGACCCCTGCCATGTCGTCATCTTCTTCATCGAGGGTCTTGCTGCGGCAGCAGCTA
ATGCGGGCCCAGGCGCAGGAGCAGGAGAGGCGTGAGCGTCGGGAACAGGCCGCCGCGGCTCCCTTCCCCAGTCCTGCACCTGCCTCTCCT
GCCATCTCTGTGGTTGGCGTCTCTGCTGGGGGCCACACATTGAGCCGTCCACCCCCTGCTCAGGTGCCCAGGGAGGTGCTCAAGGTGCAG
ACCCATCTGGAGAACCCAACGCGCTACCACCTGCAGCAGGCGCGCCGGCAGCAGGTGAAACAGTACCTGTCCACCACACTCGGGCCCAAG
CTGGCTTCCCAGGCCCTCACCCCACCGCCGGGGCCCGCAAGTGCCCAGCCACTGCCTGCCCCTGAGGCTGCCCACACTACCGGCCCCACA
GGCAGTGCGCCCAACAGCCCCATGGCGCTGCTCACCATCGGGTCCAGCTCAGAGAAGGAGATTGATGATGTCATTGATGAGATCATCAGC
CTGGAGTCCAGTTACAATGATGAAATGCTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGGTCAGCCAGAGCAGC
CTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGC
CAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCC
CAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATG
AGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATG
ATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGG
TGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTG
CCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTAC
CGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGAT
GAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGC
AACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTAT
CCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGG
CTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAG

>In-frame_TFE3_ENST00000315869_chrX_48895535_-_MED15_ENST00000292733_chr22_20936898_+_1980nt
ATGTCTCATGCGGCCGAACCAGCTCGGGATGGCGTAGAGGCCAGCGCGGAGGGCCCTCGAGCCGTGTTCGTGCTGTTGGAGGAGCGCAGG
CCGGCCGACTCGGCTCAGCTGCTCAGCCTGAACTCTTTGCTTCCGGAATCCGGGATTGTTGCTGACATAGAATTAGAAAACGTCCTTGAT
CCTGACAGCTTCTACGAGCTCAAAAGCCAACCCTTACCCCTTCGCTCAAGCCTCCCAATATCACTGCAGGCCACACCAGCCACCCCAGCT
ACACTCTCTGCATCGTCTTCTGCAGGGGGCTCCAGGACCCCTGCCATGTCGTCATCTTCTTCATCGAGGGTCTTGCTGCGGCAGCAGCTA
ATGCGGGCCCAGGCGCAGGAGCAGGAGAGGCGTGAGCGTCGGGAACAGGCCGCCGCGGCTCCCTTCCCCAGTCCTGCACCTGCCTCTCCT
GCCATCTCTGTGGTTGGCGTCTCTGCTGGGGGCCACACATTGAGCCGTCCACCCCCTGCTCAGGTGCCCAGGGAGGTGCTCAAGGTGCAG
ACCCATCTGGAGAACCCAACGCGCTACCACCTGCAGCAGGCGCGCCGGCAGCAGGTGAAACAGTACCTGTCCACCACACTCGGGCCCAAG
CTGGCTTCCCAGGCCCTCACCCCACCGCCGGGGCCCGCAAGTGCCCAGCCACTGCCTGCCCCTGAGGCTGCCCACACTACCGGCCCCACA
GGCAGTGCGCCCAACAGCCCCATGGCGCTGCTCACCATCGGGTCCAGCTCAGAGAAGGAGATTGATGATGTCATTGATGAGATCATCAGC
CTGGAGTCCAGTTACAATGATGAAATGCTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGGTCAGCCAGAGCAGC
CTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGC
CAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCC
CAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATG
AGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATG
ATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGG
TGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTG
CCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTAC
CGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGAT
GAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGC
AACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTAT
CCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGG
CTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TFE3_ENST00000315869_chrX_48895535_-_MED15_ENST00000425759_chr22_20936898_+_3167nt
GGGAGGAGGGGGAAGAAGACGAGGGGGAGGAGGGCGGTCGTCCGGGGTTAGGTTGAGGGGGGGCGTCGGTCCGTTCTGGGCGGGGGATGA
CTCACAGCCCATCCCATCTCCCAGACGCCGCCCGCCCGCGCAGTGCTAGCTCCATGGCTTAGCGGAGGAGGCGGCAGTGGCGAGCTGGGG
GGAGGGGGGACTCTTATTTTGTTAGGGGGACCGGGCCGAGGCCCGACCGGCCTGGCAGGGCTCGCCCGGGGCCGGGCGTCATGTCTCATG
CGGCCGAACCAGCTCGGGATGGCGTAGAGGCCAGCGCGGAGGGCCCTCGAGCCGTGTTCGTGCTGTTGGAGGAGCGCAGGCCGGCCGACT
CGGCTCAGCTGCTCAGCCTGAACTCTTTGCTTCCGGAATCCGGGATTGTTGCTGACATAGAATTAGAAAACGTCCTTGATCCTGACAGCT
TCTACGAGCTCAAAAGCCAACCCTTACCCCTTCGCTCAAGCCTCCCAATATCACTGCAGGCCACACCAGCCACCCCAGCTACACTCTCTG
CATCGTCTTCTGCAGGGGGCTCCAGGACCCCTGCCATGTCGTCATCTTCTTCATCGAGGGTCTTGCTGCGGCAGCAGCTAATGCGGGCCC
AGGCGCAGGAGCAGGAGAGGCGTGAGCGTCGGGAACAGGCCGCCGCGGCTCCCTTCCCCAGTCCTGCACCTGCCTCTCCTGCCATCTCTG
TGGTTGGCGTCTCTGCTGGGGGCCACACATTGAGCCGTCCACCCCCTGCTCAGGTGCCCAGGGAGGTGCTCAAGGTGCAGACCCATCTGG
AGAACCCAACGCGCTACCACCTGCAGCAGGCGCGCCGGCAGCAGGTGAAACAGTACCTGTCCACCACACTCGGGCCCAAGCTGGCTTCCC
AGGCCCTCACCCCACCGCCGGGGCCCGCAAGTGCCCAGCCACTGCCTGCCCCTGAGGCTGCCCACACTACCGGCCCCACAGGCAGTGCGC
CCAACAGCCCCATGGCGCTGCTCACCATCGGGTCCAGCTCAGAGAAGGAGATTGATGATGTCATTGATGAGATCATCAGCCTGGAGTCCA
GTTACAATGATGAAATGCTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGGTCAGCCAGAGCAGCCTCCCCATGC
TGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCT
CACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAG
TGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTG
GCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGA
TCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGA
AGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCA
AACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCG
TTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGA
GCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCA
CTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAA
GCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGC
TCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGC
AGGGATGGCCCGCAGCCTCATCGGGGCCAAGGACACACGCCTCCTGTCAGACACTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTA
GGTTAGCTTTCCTGCTTTTATCTTCTGCCTTGGGGACCTGCCAAACGAAATCCCACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCG
GGTTGCTTGGGGGGCGTTGGCCGACTTCTTAGAGAAGGCCCTCCATGTGACTTCCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTC
ACCGTGGCCTGTCCACGGTCCAGGTCCATCTCAGCAGCGTGAGGGTGCACTCAGGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCAC
CCCTACTCGTTCCTATAGAACACAGAGGACATAGGAAACCCTTAAAACACACATGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATG
CTGCTTTGGGCAGGTGGAGCACCCCCCGAGGAAGCCTGCAAGTCCAGGGCACAGGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCT
GCTGGCTCCCCGCCACCAGCTGGGCCTCAGCCCTCACGGCATTCCTGCTGAGCACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATC
CTGCTGCCGGCACCCCTGTGCCGCTGGCATGAGGGCCGTGTCCCCACTGTGAAGGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAG
AGCACCACACACTGAGCACCCAGAGACAGCGGGCCTGGCAGCGGGCCGGGCCATGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGG
GCACCGGCCAGCACCCTCTGGTGAGAAGAGGTCCCCCCTTTTTATGTGCACTACCCCACCATCTGTGATTATAATAAATTTATTATTCCT

>In-frame_TFE3_ENST00000315869_chrX_48895535_-_MED15_ENST00000292733_chr22_20936898_+_3168nt
GGGAGGAGGGGGAAGAAGACGAGGGGGAGGAGGGCGGTCGTCCGGGGTTAGGTTGAGGGGGGGCGTCGGTCCGTTCTGGGCGGGGGATGA
CTCACAGCCCATCCCATCTCCCAGACGCCGCCCGCCCGCGCAGTGCTAGCTCCATGGCTTAGCGGAGGAGGCGGCAGTGGCGAGCTGGGG
GGAGGGGGGACTCTTATTTTGTTAGGGGGACCGGGCCGAGGCCCGACCGGCCTGGCAGGGCTCGCCCGGGGCCGGGCGTCATGTCTCATG
CGGCCGAACCAGCTCGGGATGGCGTAGAGGCCAGCGCGGAGGGCCCTCGAGCCGTGTTCGTGCTGTTGGAGGAGCGCAGGCCGGCCGACT
CGGCTCAGCTGCTCAGCCTGAACTCTTTGCTTCCGGAATCCGGGATTGTTGCTGACATAGAATTAGAAAACGTCCTTGATCCTGACAGCT
TCTACGAGCTCAAAAGCCAACCCTTACCCCTTCGCTCAAGCCTCCCAATATCACTGCAGGCCACACCAGCCACCCCAGCTACACTCTCTG
CATCGTCTTCTGCAGGGGGCTCCAGGACCCCTGCCATGTCGTCATCTTCTTCATCGAGGGTCTTGCTGCGGCAGCAGCTAATGCGGGCCC
AGGCGCAGGAGCAGGAGAGGCGTGAGCGTCGGGAACAGGCCGCCGCGGCTCCCTTCCCCAGTCCTGCACCTGCCTCTCCTGCCATCTCTG
TGGTTGGCGTCTCTGCTGGGGGCCACACATTGAGCCGTCCACCCCCTGCTCAGGTGCCCAGGGAGGTGCTCAAGGTGCAGACCCATCTGG
AGAACCCAACGCGCTACCACCTGCAGCAGGCGCGCCGGCAGCAGGTGAAACAGTACCTGTCCACCACACTCGGGCCCAAGCTGGCTTCCC
AGGCCCTCACCCCACCGCCGGGGCCCGCAAGTGCCCAGCCACTGCCTGCCCCTGAGGCTGCCCACACTACCGGCCCCACAGGCAGTGCGC
CCAACAGCCCCATGGCGCTGCTCACCATCGGGTCCAGCTCAGAGAAGGAGATTGATGATGTCATTGATGAGATCATCAGCCTGGAGTCCA
GTTACAATGATGAAATGCTCAGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGGTCAGCCAGAGCAGCCTCCCCATGC
TGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCT
CACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAG
TGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTG
GCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGA
TCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGA
AGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCA
AACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCG
TTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGA
GCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCA
CTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAA
GCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGC
TCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGC
AGGGATGGCCCGCAGCCTCATCGGGGCCAAGGACACACGCCTCCTGTCAGACACTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTA
GGTTAGCTTTCCTGCTTTTATCTTCTGCCTTGGGGACCTGCCAAACGAAATCCCACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCG
GGTTGCTTGGGGGGCGTTGGCCGACTTCTTAGAGAAGGCCCTCCATGTGACTTCCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTC
ACCGTGGCCTGTCCACGGTCCAGGTCCATCTCAGCAGCGTGAGGGTGCACTCAGGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCAC
CCCTACTCGTTCCTATAGAACACAGAGGACATAGGAAACCCTTAAAACACACATGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATG
CTGCTTTGGGCAGGTGGAGCACCCCCCGAGGAAGCCTGCAAGTCCAGGGCACAGGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCT
GCTGGCTCCCCGCCACCAGCTGGGCCTCAGCCCTCACGGCATTCCTGCTGAGCACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATC
CTGCTGCCGGCACCCCTGTGCCGCTGGCATGAGGGCCGTGTCCCCACTGTGAAGGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAG
AGCACCACACACTGAGCACCCAGAGACAGCGGGCCTGGCAGCGGGCCGGGCCATGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGG
GCACCGGCCAGCACCCTCTGGTGAGAAGAGGTCCCCCCTTTTTATGTGCACTACCCCACCATCTGTGATTATAATAAATTTATTATTCCT


Top

FusionGenePPI for TFE3_MED15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TFE3AKR1B1, CLTC, PHB2, ACLY, CUL2, EPRS, PFAS, VARS, NEDD8, RPL38, TRIM28, EIF3A, RPA3, E2F3, SMARCE1, MITF, TFE3, SMAD3, SMAD4, TFEC, EWSR1, XPO1, TFEBMED15MLLT6, PLSCR1, FHL3, MED10, MED9, MED29, MED19, MED28, MED26, MED25, MED6, ATP5C1, MED1, TRIM11, SMAD1, SMAD2, SMAD3, TRRAP, RELA, SREBF1, MED12, MED18, ZC3H13, TRIP4, QKI, TADA2A, CDK8, MED13, MED14, MED23, MED16, MED17, MED7, CTDP1, ATXN1, IGBP1, UBAP2L, SEC24C, CHEK1, NCOA6, FBXW7, EPAS1, CDK19, CCNC, NR1I3, ALDH8A1, TCL1B, HIF1A, MED11, MED20, MED24, MED27, MED4, MED8, EWSR1, MYO1C, POLR2F, POLR2G, CTDSPL2, MED21, UBE2N, TP73


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneMED15chrX:48895535chr22:20936898ENST00000263205+8189_73424789SREBF1
TgeneMED15chrX:48895535chr22:20936898ENST00000292733+7179_73384749SREBF1
TgeneMED15chrX:48895535chr22:20936898ENST00000382974+6169_73313678SREBF1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TFE3_MED15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TFE3_MED15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMED15C0036341Schizophrenia2PSYGENET
TgeneMED15C0036337Schizoaffective Disorder1PSYGENET