FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37821

FusionGeneSummary for TFDP1_ATP11A

check button Fusion gene summary
Fusion gene informationFusion gene name: TFDP1_ATP11A
Fusion gene ID: 37821
HgeneTgene
Gene symbol

TFDP1

ATP11A

Gene ID

7027

23250

Gene nametranscription factor Dp-1ATPase phospholipid transporting 11A
SynonymsDILC|DP1|DRTF1|Dp-1ATPIH|ATPIS
Cytomap

13q34

13q34

Type of geneprotein-codingprotein-coding
Descriptiontranscription factor Dp-1DRTF1-polypeptide 1E2F dimerization partner 1E2F-related transcription factordown-regulated in liver cancer stem cellsprobable phospholipid-transporting ATPase IHATPase, class VI, type 11AP4-ATPase flippase complex alpha subunit ATP11Aphospholipid-translocating ATPasepotential phospholipid-transporting ATPase IH
Modification date2018052320180523
UniProtAcc

Q14186

P98196

Ensembl transtripts involved in fusion geneENST00000375370, ENST00000538138, 
ENST00000465174, ENST00000544902, 
ENST00000283558, ENST00000375630, 
ENST00000487903, ENST00000375645, 
ENST00000419448, 
Fusion gene scores* DoF score4 X 3 X 3=3611 X 10 X 4=440
# samples 413
** MAII scorelog2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(13/440*10)=-1.7589919004962
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TFDP1 [Title/Abstract] AND ATP11A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTFDP1

GO:0045944

positive regulation of transcription by RNA polymerase II

7739537


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-56-7823-01BTFDP1chr13

114240164

+ATP11Achr13

113439449

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375370ENST00000283558TFDP1chr13

114240164

+ATP11Achr13

113439449

+
In-frameENST00000375370ENST00000375630TFDP1chr13

114240164

+ATP11Achr13

113439449

+
In-frameENST00000375370ENST00000487903TFDP1chr13

114240164

+ATP11Achr13

113439449

+
In-frameENST00000375370ENST00000375645TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5CDS-intronENST00000375370ENST00000419448TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000538138ENST00000283558TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000538138ENST00000375630TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000538138ENST00000487903TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000538138ENST00000375645TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-intronENST00000538138ENST00000419448TFDP1chr13

114240164

+ATP11Achr13

113439449

+
3UTR-3CDSENST00000465174ENST00000283558TFDP1chr13

114240164

+ATP11Achr13

113439449

+
3UTR-3CDSENST00000465174ENST00000375630TFDP1chr13

114240164

+ATP11Achr13

113439449

+
3UTR-3CDSENST00000465174ENST00000487903TFDP1chr13

114240164

+ATP11Achr13

113439449

+
3UTR-3CDSENST00000465174ENST00000375645TFDP1chr13

114240164

+ATP11Achr13

113439449

+
3UTR-intronENST00000465174ENST00000419448TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000544902ENST00000283558TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000544902ENST00000375630TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000544902ENST00000487903TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-3CDSENST00000544902ENST00000375645TFDP1chr13

114240164

+ATP11Achr13

113439449

+
5UTR-intronENST00000544902ENST00000419448TFDP1chr13

114240164

+ATP11Achr13

113439449

+

Top

FusionProtFeatures for TFDP1_ATP11A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TFDP1

Q14186

ATP11A

P98196

Can stimulate E2F-dependent transcription. Binds DNAcooperatively with E2F family members through the E2 recognitionsite, 5'-TTTC[CG]CGC-3', found in the promoter region of a numberof genes whose products are involved in cell cycle regulation orin DNA replication (PubMed:8405995, PubMed:7739537). The E2F1:DPcomplex appears to mediate both cell proliferation and apoptosis.Blocks adipocyte differentiation by repressing CEBPA binding toits target gene promoters (PubMed:20176812).{ECO:0000269|PubMed:20176812, ECO:0000269|PubMed:7739537,ECO:0000269|PubMed:8405995}. Catalytic component of a P4-ATPase flippase complexwhich catalyzes the hydrolysis of ATP coupled to the transport ofaminophospholipids from the outer to the inner leaflet of variousmembranes and ensures the maintenance of asymmetric distributionof phospholipids. Phospholipid translocation seems also to beimplicated in vesicle formation and in uptake of lipid signalingmolecules (Probable). May be involved in the uptake offarnesyltransferase inhibitor drugs, such as lonafarnib.{ECO:0000269|PubMed:15860663, ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+0291024_1029131135Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+0291051_1068131135Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+0291094_1134131135Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029111_296131135Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029319_349131135Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029373_881131135Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+02983_88131135Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029903_914131135Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029935_964131135Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029987_1000131135Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+0301024_1029132857Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+0301051_1068132857Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+0301094_1134132857Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030111_296132857Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030319_349132857Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030373_881132857Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+03083_88132857Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030903_914132857Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030935_964132857Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030987_1000132857Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+0301024_1029132878Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+0301051_1068132878Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+0301094_1134132878Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030111_296132878Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030319_349132878Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030373_881132878Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+03083_88132878Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030903_914132878Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030935_964132878Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030987_1000132878Topological domainExtracellular
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+0291001_1023131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+0291030_1050131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+0291069_1093131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029297_318131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029350_372131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+02962_82131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029882_902131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+02989_110131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029915_934131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+029965_986131135TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+0301001_1023132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+0301030_1050132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+0301069_1093132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030297_318132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030350_372132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+03062_82132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030882_902132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+03089_110132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030915_934132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+030965_986132857TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+0301001_1023132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+0301030_1050132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+0301069_1093132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030297_318132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030350_372132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+03062_82132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030882_902132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+03089_110132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030915_934132878TransmembraneHelical
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+030965_986132878TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212250_2534411Compositional biasNote=Poly-Pro
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212394_4104411Compositional biasNote=Asp/Glu-rich (acidic%3B NCB domain)
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212113_1954411DNA bindingOntology_term=ECO:0000255
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212161_1954411MotifNote=DEF box
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212204_2774411RegionDimerization
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212211_3274411RegionNote=Enhances binding of RB protein to E2F
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212214_2464411RegionNote=DCB1
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212259_3154411RegionNote=DCB2
TgeneATP11Achr13:114240164chr13:113439449ENST00000283558+0291_61131135Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000375645+0301_61132857Topological domainCytoplasmic
TgeneATP11Achr13:114240164chr13:113439449ENST00000487903+0301_61132878Topological domainCytoplasmic


Top

FusionGeneSequence for TFDP1_ATP11A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000283558_chr13_113439449_+_1126aa
MAKDCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTPTSPVTSGLP
LFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSH
KTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNY
QSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVE
MQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSS
PSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLE
ILSFDSVRRRMSVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDRE
KKLAEAYEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFE
LSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPI
TLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFFCGFSQQ
TLYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGAYFVFENTTVTSNGQIF
GNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLP

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000375630_chr13_113439449_+_1183aa
MAKDCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTPTSPVTSGLP
LFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSH
KTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNY
QSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVE
MQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSS
PSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLE
ILSFDSVRRRMSVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDRE
KKLAEAYEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFE
LSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPI
TLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFFCGFSQQ
TLYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGAYFVFENTTVTSNGQIF
GNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLP
DVLKKVLCRQLWPTATERVQNGCAQPRDRDSEFTPLASLQSPGYQSTCPSAAWYSSHSQQVTLAAWKEKVSTEPPPILGGSHHHCSSIPS

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000487903_chr13_113439449_+_1126aa
MAKDCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTPTSPVTSGLP
LFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSH
KTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNY
QSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVE
MQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSS
PSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLE
ILSFDSVRRRMSVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDRE
KKLAEAYEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFE
LSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPI
TLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFFCGFSQQ
TLYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGAYFVFENTTVTSNGQIF
GNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLP

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000375645_chr13_113439449_+_1126aa
MAKDCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLIIDTPTSPVTSGLP
LFFVITVTAIKQGYEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSH
KTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNY
QSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVE
MQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSS
PSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNRENHIERFELLE
ILSFDSVRRRMSVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDRE
KKLAEAYEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFE
LSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPI
TLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFFCGFSQQ
TLYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGAYFVFENTTVTSNGQIF
GNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000283558_chr13_113439449_+_3378nt
ATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAGGGAGCCACCTCCGGGCGCAGAGGCC
TACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTC
AGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCA
CTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCT
GTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACC
TTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCAT
AAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCC
CAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTG
CTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTAT
CAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTG
ATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGG
AATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAG
ATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCG
GACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGC
TGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCC
CCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTA
GACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAG
AGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAA
ATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGAT
TCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTG
TGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAG
AAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCT
GCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTAC
GCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAG
CTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATT
ATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGG
AGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATC
ACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAG
GCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATC
TCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAG
ACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTT
GGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACG
CTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTT
GGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGG
ATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTAC
CAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCC
GACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGACTAAGAGCCAGTGCCTTTCTGTCGAGCAG

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000375630_chr13_113439449_+_3549nt
ATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAGGGAGCCACCTCCGGGCGCAGAGGCC
TACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTC
AGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCA
CTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCT
GTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACC
TTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCAT
AAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCC
CAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTG
CTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTAT
CAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTG
ATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGG
AATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAG
ATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCG
GACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGC
TGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCC
CCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTA
GACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAG
AGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAA
ATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGAT
TCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTG
TGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAG
AAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCT
GCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTAC
GCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAG
CTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATT
ATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGG
AGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATC
ACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAG
GCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATC
TCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAG
ACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTT
GGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACG
CTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTT
GGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGG
ATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTAC
CAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCC
GACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGAATGGGTGCGCACAGCCTCGGGACCGCGAC
TCAGAATTCACCCCTCTTGCCTCTCTGCAGAGCCCAGGCTACCAGAGCACCTGTCCCTCGGCCGCCTGGTACAGCTCCCACTCTCAGCAG
GTGACACTCGCGGCCTGGAAGGAGAAGGTGTCCACGGAGCCCCCACCCATCCTCGGCGGTTCCCATCACCACTGCAGTTCCATCCCAAGT

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000487903_chr13_113439449_+_3378nt
ATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAGGGAGCCACCTCCGGGCGCAGAGGCC
TACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTC
AGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCA
CTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCT
GTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACC
TTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCAT
AAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCC
CAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTG
CTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTAT
CAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTG
ATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGG
AATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAG
ATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCG
GACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGC
TGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCC
CCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTA
GACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAG
AGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAA
ATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGAT
TCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTG
TGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAG
AAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCT
GCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTAC
GCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAG
CTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATT
ATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGG
AGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATC
ACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAG
GCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATC
TCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAG
ACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTT
GGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACG
CTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTT
GGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGG
ATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTAC
CAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCC
GACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGACTAAGAGCCAGTGCCTTTCTGTCGAGCAG

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000375645_chr13_113439449_+_3378nt
ATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAGGGAGCCACCTCCGGGCGCAGAGGCC
TACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTATACCCAAGAATTTATTTGAACAATTC
AGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCACAAGTCCAGTGACAAGCGGACTTCCA
CTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGCAGACAATGCCATGAACCAGTGTCCT
GTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACATTGTCATGGTTAAGGAGGACGAGACC
TTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGCCAGCTTGGATGGAGAATCCAGCCAT
AAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCACGCCACCATCGAGTGTGAGCAGCCC
CAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGTGAGGCCCTTAGGATCGGAAAACCTG
CTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAATGGAAACCAAGATGGCATTAAATTAT
CAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCTCTGCATTCTGATCAGCAAAGCCCTG
ATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCAGAAAACGGAGTCGGAAAGGCAGAGG
AATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCCTGTGTCCATGTACGTCACGGTCGAG
ATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGGCGAGGGGCCTCTGGTGAACACGTCG
GACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGAAAACAACATGGAGTTCAAGGAGTGC
TGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTCAGGAATCGACATGATTGACTCGTCC
CCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGTCCAGGTGAAAGACGATGACAGCGTA
GACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGAGGTGGCGCTGGTCGAAGGTGTCCAG
AGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCACATCGAAAGGTTTGAATTGCTGGAA
ATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAATTTATCTGTTTTGCAAAGGAGCAGAT
TCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAACGCAGTGGAGGGGCTCCGAACTTTG
TGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGCCAAAGTGGCCCTTCAAGATCGAGAG
AAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGTTGAGGACCGGCTGCAGGAGAAAGCT
GCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGATGGAGACGGCCGCGGCCACGTGCTAC
GCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCAGAGCCTGCACGACGTCCTGTTCGAG
CTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGCAGATATGCAGGACTACGGTTTAATT
ATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAGGGAGCTCTTCCTGGAAATCTGCCGG
AGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAATCAAATTTTCAAAAGAGCACCCAATC
ACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGGTGTCATCGGCAAGGAAGGCCGCCAG
GCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCACGGGCATTTTTATTACATTAGGATC
TCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCAGTTCTTCTGTGGGTTTTCACAACAG
ACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCTGTACAGCCTCATGGAGCAGCATGTT
GGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCGCTGGCGCGTGTTCATCTACTGGACG
CTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAACTGTGACAAGCAACGGGCAGATATTT
GGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAAAGCTTGCATTGGACACACACTACTGGACTTGG
ATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCTGGGGAGGAGTGATCTGGCCGTTCCTCAACTAC
CAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCATCGTGCTGCTGGTGACCATCAGCCTCCTTCCC
GACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCCAGACTAAGAGCCAGTGCCTTTCTGTCGAGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000283558_chr13_113439449_+_3590nt
CGTCCCGGCGCCACTCGGCCCAGGGCAGGGACCCCGCCACGGCCGGGACCGCCCGGCCCGGCCCCAGCCCGCGCCTCTCCGCGCCGCCCC
GCGCTCCGCACCGCGCCCTCTCCGCGTCCCCGCCCGCGCGGCCGGACCGGGCAGCCAGAAAAATCATTTTTCTTCTCTGGGAAGGTGAAC
ATTTGTAGCATTGATTTCCCGGATCTGGTAACATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGG
GACACAGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGA
ACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATA
CACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGAC
ATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTG
GGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCA
CCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCG
GACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACC
CCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACA
CGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTG
TGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGT
ATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACA
TCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGG
AGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCC
TCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAG
AGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCC
ACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGC
CCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGG
AGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAG
GAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGG
AGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGC
AGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTA
CAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAG
ACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCG
AGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGAC
TTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCA
ACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTA
AATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGG
GCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGC
TTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTT
TATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCA
TCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCC
TGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAA
ATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAA
AGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCT
GGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCA
TCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCC

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000375630_chr13_113439449_+_8865nt
CGTCCCGGCGCCACTCGGCCCAGGGCAGGGACCCCGCCACGGCCGGGACCGCCCGGCCCGGCCCCAGCCCGCGCCTCTCCGCGCCGCCCC
GCGCTCCGCACCGCGCCCTCTCCGCGTCCCCGCCCGCGCGGCCGGACCGGGCAGCCAGAAAAATCATTTTTCTTCTCTGGGAAGGTGAAC
ATTTGTAGCATTGATTTCCCGGATCTGGTAACATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGG
GACACAGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGA
ACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATA
CACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGAC
ATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTG
GGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCA
CCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCG
GACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACC
CCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACA
CGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTG
TGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGT
ATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACA
TCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGG
AGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCC
TCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAG
AGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCC
ACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGC
CCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGG
AGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAG
GAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGG
AGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGC
AGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTA
CAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAG
ACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCG
AGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGAC
TTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCA
ACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTA
AATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGG
GCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGC
TTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTT
TATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCA
TCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCC
TGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAA
ATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAA
AGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCT
GGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCA
TCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCC
AGAATGGGTGCGCACAGCCTCGGGACCGCGACTCAGAATTCACCCCTCTTGCCTCTCTGCAGAGCCCAGGCTACCAGAGCACCTGTCCCT
CGGCCGCCTGGTACAGCTCCCACTCTCAGCAGGTGACACTCGCGGCCTGGAAGGAGAAGGTGTCCACGGAGCCCCCACCCATCCTCGGCG
GTTCCCATCACCACTGCAGTTCCATCCCAAGTCACAGCTGCCCTAGGTCCCGTGTGGGAATGCTCGTGTGATGGATGGTCCTAAGCCTGT
GGAGACTGTGCACGTGCCTCTTCCTGGCCCCCAGCAGGCAAGGAGGGGGGTCACAGGCCTTGCCCTCGAGCATGGCACCCTGGCCGCCTG
GACCCAGCACTGTGGTTGTTGAGCCACACCAGTGGCCTCTGGGCATTCGGCTCAACGCAGGAGGGACATTCTGCTGGCCCACCCTGCGCG
CTGTCATGCAGAGGCCATTCCCCCAGGCCTGTGTCTTCACCCACCTGCCATCATTGGCCTTTGCTGTCACTGGGAGAGAAGAGCCGTCCA
GGGACCCATGGTGGCCCACATGTGGATGCCACATGCTGCTGTTTCCTGCTTGCCCGGCCACCACCCATGCCCTCCATAGGGTGAGGTGGA
GCCATGGTGGTGCGTCCTTTACTCAACAACCCTCCAATCCGGATGCTGTGGGAAGGGCCGGGTCACTCGGATACCATCATCCCTGCGGAT
GCACCGCCGTACCCTGCTCATCTGGGAGTGGTTTCCCTGCGGTTACGTCCAAGCCCGCCTGCCCTGTGTGTTGGGGCTGGCTGAGTTTCG
GTCTCCCCATCACCGGCCGCCTCGTGGAGAAGGCAGTGCCACGTGGGAGGACAAGGCCACGCCGGCAGCTTCCAGCCCTGCCGCAGAAGT
GCCAGGATGTCCATCAGCCACTCGCCAGGGCACGGAGCCGTCAGTCCACTGTTACGGGAGAATGTTGATTTCGCGGGTGCGAGGGCCGGG
AGACAGATACTTGGCTGTGATGAGCAGACATCCTCTGTCCCCGTGGAGGGGTCAACACCAAGGTGGTGTTCGTGCACCAGAACCTGTCTC
GGGCTGACGGGGGTGGCACACAGGACACGGGTGGATCCCAACAGGCAGCACCGCACCTCTGCCCGCCTCCCGCACTGCAGCTCCGCCCGC
CGGGCTCTGCGTCCCCACGTCCCCTCGTCCCATCCCCACGTCCCCTCATCCCGTCACCTCGTCCCCACATCCCCTTGCCCCGTCACCTCG
TCCTCATGTCCCCTTGTCCTGTCACCTCGTCCCCACGTCCCCTCGTCTCCTCATCCCCACGTCCTCTCGTCCCCTTGTCCCGTCCCCACA
TACCCTCGTCCCCATGTCCCCACGCAGGGCTCTCCTTCGTCTTAGGATCTGTCCAGCGCTGCTCTGGGTGGGTTAGCAACCCCAGGGCTG
CTGTGATAGGAAGTCCCTGTTGTTCTCCGTACTGGCATTTCTATTTCTAGAAATAATATTTGACATAGCCTTAATGGTCCTTAAAGAAGA
CATTTCAGTGTGAGATTCAGACTTCAGACGCTGAAACTGCTGCCTTTCAGGAAAGCACCACCAACGCTGGAGGAGGAGCCGGCCCTCACG
CCCGCCCCGCGCCACGCTGTGGAACGGGGCTCCGGCAAGTGAAACCCAGAGGGTGTTTCCGAGGTGCTCGACAGTAGGTATTTTTGGAAG
CTCAGATTTCACCATTTGATTGTATAATCTTTTACCTATAAAATATTTATTTGAAGTAGAGGGTAAATCAGCGGTAAGAACAGTGAACAC
AGTGGTTGGGATAAAATAAGGTGACAAACATCACACCAAAGATGAGGGTAGCGAGCAACTGGCTTGAGCAGACAGAACGGGGAAGACTCC
ACTCTGTCCCGAGGGGCCAGCCGCAGGCGTCCCCAGGGCCACCCTGCCCTGAGGTCCTTGTGTGGCCGCCCTGGCTTGGCAGCCCTGCCC
ACGCTGCCCCCGCAAACAATGGTGTGTGCGTTTTTACAGCCCTTTTTAGGAACCCAATATGGGCATAAATGTAACACCTGTAGCGGGGGC
AGATTCTCTGTATGTTCAGTTAACAAATTATTTGTAATGTATTTTTTTAGAAATCTTAAAATTGCCTTTGCACTGAAGTATTTTCATAGC
TGTTTATATCTCTTTTATTCATTTATTTAACATACTGTCTAATTTTAAAAATAGGTTTTTAAAGCTTTCATTTTTAAGTTTATGAAATTT
TGGCCACTTTACATTTAGATTCTGGTGAGAGTTTTGACTGAATGTTCCAATCTCTGATGAATGCGAATTTTCAGATTTGATTTTATTCTC
TACACACACCTCTTCTTTTCTTGGTATTTCTGGTGGCAGTGATTAGTTGAACAGCACATTTAAGGCACGATAATTTGCTACACTTTTTCT
TTACAATTTGTTGCAATTTCATCTGCTTTCTATGTTTCATTGTTAATTGCCATCCTTCAGCCTTAAAAATAGAAGATTCTCACGTGAAGG
TTTAGTAAGTTGGGTCCCAGCTCTGCCTGTGTGGAGATAGTCACCATGTACCTCTGACAACAAGTTTTAGTGTGAAAGTCACTAAACTTT
TACACACTCCCAAACGTCTTTTTAAAAATTGCTTGGGAAATTATTAAATGAATGTGCCTGATGATTTGAAATAGACAAGGGGCACGAGAT
AAAAAAGAAAAGGATGAGAAGATCCTCAGTGAATGACGTTGCAGGGTCTTCATGCAATTTTCCACCTCGCAGTAGTTAGTATTTACTTGC
CTTAAACTAACTTTGAAGCAAGTAATGTCAACTTTGAGCACTTTGTTGAGTTTTGAAAAATCTTATTTGTTGCTGCACAGGTTAATAAAT
TATCAATTTGTAATTCAGCATGTTGGTCAGAGACACGGTCACTGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTG
GGCCTGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGATTCACACCCAGTCCCTG
CCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGCGTGTTACCTGGCTTTTGGCTCCACGCTCACTCATAGCCATGTCCACAT
GGGGGCTTGCACACAGGATCACTCACATATGTACATGTACCCACCACAAACGTGCAAGCTCCTGCACACATGCATGCACACAAACGTGTA
CACAAGTGTGAGCTCCTACACGCATACACACACACACGTGTACATGCACCAAAGCATGTGTGACCTACAGACATGCAGAACATGCACGTG
TACACATACCACAGACACGCGTGTGCATGCTCCTACACAATACATATGCACATATCATGAACAGCGTAAGTTCCTACACACGGACGTGTG
ATACACACATGCATGTACAGGTAAGCACACATGTACAAGCTCCTACAGGCTTGCTCTCACACACGTGTATGCACAGCAGAGAGACGTATG
AGCTTCTACTGCACACATGCACACACACACGCACACGTACATTCACTACAAACGTGCAGCCTCCTGCACACGTGCACATTCATGTGTACA
CCACAAATGAGTTCCCAGACGTGTAAACACACGTGCACACATCGTACACATGTGAGCTCCCACACGTACACACAGATGCACATGGACACA
CCCCAAACACGCACAGGCTCCTACACACATGCACACACGTGTACACCACAAACGAGCTCCCAGACATGTAAACACACGTCTCCCACACGT
GAGCTCCCACACGTACACATGCACATGTACGCACCACAAACACATGCGCAGGCTCCTGCAGGCGTGAATACACACATGCACACACATATA
CACACATGTGCCACAAACAAGTGCACACTGTCCTGGTGTCCTGCACTGCATCCTGCCTCCTTGCTGAGGGGCCCCTGTGAGAGGCCTCTG
GATGGGCATGGGAAGATGGGCTCCCTGGCCCCCAGCCCATGCCTCCCTGGGATGAAGAGTCCCCCTCCTGGCAGAATGTCTGGGCTTTGC
AGAGCAGGCCCCGGGGGTGAAGTCGCAGCTTCACTTACACCAGCTGCTCTGTGAGCAAGGCTTGGTGCCCTGGACAAGGCCCTTCCCCTT
TAGGGAGGTCCAGCCTCGCAAGCTGAAACCTCCCCTCGGCTCAGCCCTATACCAGGCGGCCACAGCAGGACTGGCCACACCCACGCCGCA
CCTCATCCGTGCACGCGTCGGAGCACGGCCAGCCTTCCGCCACGAGCCAGCTGGGAAGGGCCGCGGCCGCCTAAAGCCCCAGTCAACCCA
GCCTGTGTCTGAGCAGACAGGGCGAACAAGCAGGCCACACCGTCTCGAGGGAGGAGGCCAGATGCGGCCAGCGTCTCCAACAGGGTGACC
ATCCGCTCGGCTTGCTGAGCGTTTAAACAAATGTTTAGACAGGCTGTGGGGACTCCCCTGAGTTGAGCCTTGGCCAGGGGTCCGGTGCTG
TCGCGGGAAACCTCCAGCCTTGTTCTTCAAACCACTCAGCTCATGTGTTTTGCACTGACTAGTACTGAATAATACAACCACTCTTATTTA
ATGTTAGTATTATTTATTTGACAACTCAGTGTCTAACAGCTTGATATGCAGGTCCTTGCATCCTACATTTCTTTAGGAAGTTACCCATTT
GTAACTTTAAAAACAGGAAAAATATCAGTTGGCAAATGCAATCTTTTTTTTTTTTAAGCTAAAGGTGGGTGAACTGGAATGAAAATCTTT
CTGATGTTGTGTCTATAAGCAGCCTTGATGGGATATGTTAGAAGTGTCATGAAAGTGTGATTCTACTTTTGCAGAAAAATCTAAAGATCA
ATTTATATAGCTTTATTTTTTACTTTATCAAAGTATACAGAATTTTAATATGCATATATTGTGTCTGACTTAAAATTATAATGTCTGCGT
CACCATTTAAAATGTCTGTTCATTATGTAATGTAATAAAAGAAGGTCTTCAAAAATGTATTTAACATGAATGGTATCCATAGTTGTCATC
ATCATAAATACTGGAGTTTATTTTTAAATTATTAAACATAGTAGGTGCATTAACATAAATCAGTCTCCACACAGTAACATTTAACTGATA
ATTCATTAATCAGCTTTGAAAAATTAAATTGTTAATTAAACCAATCTAACATTTCAGTAAAGTTTATTTTGTATGCTTCTGTTTTTAACT
TTTATTTCTGTAGATAAACTGACTGGATAATATTATATTGGACTTTTCTCTAGATTATCTAAGCAGGAGACCTGAATCTGCTTGCAATAA

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000487903_chr13_113439449_+_8955nt
CGTCCCGGCGCCACTCGGCCCAGGGCAGGGACCCCGCCACGGCCGGGACCGCCCGGCCCGGCCCCAGCCCGCGCCTCTCCGCGCCGCCCC
GCGCTCCGCACCGCGCCCTCTCCGCGTCCCCGCCCGCGCGGCCGGACCGGGCAGCCAGAAAAATCATTTTTCTTCTCTGGGAAGGTGAAC
ATTTGTAGCATTGATTTCCCGGATCTGGTAACATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGG
GACACAGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGA
ACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATA
CACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGAC
ATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTG
GGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCA
CCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCG
GACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACC
CCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACA
CGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTG
TGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGT
ATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACA
TCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGG
AGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCC
TCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAG
AGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCC
ACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGC
CCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGG
AGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAG
GAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGG
AGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGC
AGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTA
CAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAG
ACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCG
AGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGAC
TTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCA
ACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTA
AATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGG
GCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGC
TTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTT
TATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCA
TCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCC
TGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAA
ATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAA
AGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCT
GGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCA
TCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCC
AGACTAAGAGCCAGTGCCTTTCTGTCGAGCAGTCAACCATCTTTATGCTTTCTCAGACTTCCAGCAGCCTGAGTTTCTGATGGAACAAGC
AGAATGGGTGCGCACAGCCTCGGGACCGCGACTCAGAATTCACCCCTCTTGCCTCTCTGCAGAGCCCAGGCTACCAGAGCACCTGTCCCT
CGGCCGCCTGGTACAGCTCCCACTCTCAGCAGGTGACACTCGCGGCCTGGAAGGAGAAGGTGTCCACGGAGCCCCCACCCATCCTCGGCG
GTTCCCATCACCACTGCAGTTCCATCCCAAGTCACAGCTGCCCTAGGTCCCGTGTGGGAATGCTCGTGTGATGGATGGTCCTAAGCCTGT
GGAGACTGTGCACGTGCCTCTTCCTGGCCCCCAGCAGGCAAGGAGGGGGGTCACAGGCCTTGCCCTCGAGCATGGCACCCTGGCCGCCTG
GACCCAGCACTGTGGTTGTTGAGCCACACCAGTGGCCTCTGGGCATTCGGCTCAACGCAGGAGGGACATTCTGCTGGCCCACCCTGCGCG
CTGTCATGCAGAGGCCATTCCCCCAGGCCTGTGTCTTCACCCACCTGCCATCATTGGCCTTTGCTGTCACTGGGAGAGAAGAGCCGTCCA
GGGACCCATGGTGGCCCACATGTGGATGCCACATGCTGCTGTTTCCTGCTTGCCCGGCCACCACCCATGCCCTCCATAGGGTGAGGTGGA
GCCATGGTGGTGCGTCCTTTACTCAACAACCCTCCAATCCGGATGCTGTGGGAAGGGCCGGGTCACTCGGATACCATCATCCCTGCGGAT
GCACCGCCGTACCCTGCTCATCTGGGAGTGGTTTCCCTGCGGTTACGTCCAAGCCCGCCTGCCCTGTGTGTTGGGGCTGGCTGAGTTTCG
GTCTCCCCATCACCGGCCGCCTCGTGGAGAAGGCAGTGCCACGTGGGAGGACAAGGCCACGCCGGCAGCTTCCAGCCCTGCCGCAGAAGT
GCCAGGATGTCCATCAGCCACTCGCCAGGGCACGGAGCCGTCAGTCCACTGTTACGGGAGAATGTTGATTTCGCGGGTGCGAGGGCCGGG
AGACAGATACTTGGCTGTGATGAGCAGACATCCTCTGTCCCCGTGGAGGGGTCAACACCAAGGTGGTGTTCGTGCACCAGAACCTGTCTC
GGGCTGACGGGGGTGGCACACAGGACACGGGTGGATCCCAACAGGCAGCACCGCACCTCTGCCCGCCTCCCGCACTGCAGCTCCGCCCGC
CGGGCTCTGCGTCCCCACGTCCCCTCGTCCCATCCCCACGTCCCCTCATCCCGTCACCTCGTCCCCACATCCCCTTGCCCCGTCACCTCG
TCCTCATGTCCCCTTGTCCTGTCACCTCGTCCCCACGTCCCCTCGTCTCCTCATCCCCACGTCCTCTCGTCCCCTTGTCCCGTCCCCACA
TACCCTCGTCCCCATGTCCCCACGCAGGGCTCTCCTTCGTCTTAGGATCTGTCCAGCGCTGCTCTGGGTGGGTTAGCAACCCCAGGGCTG
CTGTGATAGGAAGTCCCTGTTGTTCTCCGTACTGGCATTTCTATTTCTAGAAATAATATTTGACATAGCCTTAATGGTCCTTAAAGAAGA
CATTTCAGTGTGAGATTCAGACTTCAGACGCTGAAACTGCTGCCTTTCAGGAAAGCACCACCAACGCTGGAGGAGGAGCCGGCCCTCACG
CCCGCCCCGCGCCACGCTGTGGAACGGGGCTCCGGCAAGTGAAACCCAGAGGGTGTTTCCGAGGTGCTCGACAGTAGGTATTTTTGGAAG
CTCAGATTTCACCATTTGATTGTATAATCTTTTACCTATAAAATATTTATTTGAAGTAGAGGGTAAATCAGCGGTAAGAACAGTGAACAC
AGTGGTTGGGATAAAATAAGGTGACAAACATCACACCAAAGATGAGGGTAGCGAGCAACTGGCTTGAGCAGACAGAACGGGGAAGACTCC
ACTCTGTCCCGAGGGGCCAGCCGCAGGCGTCCCCAGGGCCACCCTGCCCTGAGGTCCTTGTGTGGCCGCCCTGGCTTGGCAGCCCTGCCC
ACGCTGCCCCCGCAAACAATGGTGTGTGCGTTTTTACAGCCCTTTTTAGGAACCCAATATGGGCATAAATGTAACACCTGTAGCGGGGGC
AGATTCTCTGTATGTTCAGTTAACAAATTATTTGTAATGTATTTTTTTAGAAATCTTAAAATTGCCTTTGCACTGAAGTATTTTCATAGC
TGTTTATATCTCTTTTATTCATTTATTTAACATACTGTCTAATTTTAAAAATAGGTTTTTAAAGCTTTCATTTTTAAGTTTATGAAATTT
TGGCCACTTTACATTTAGATTCTGGTGAGAGTTTTGACTGAATGTTCCAATCTCTGATGAATGCGAATTTTCAGATTTGATTTTATTCTC
TACACACACCTCTTCTTTTCTTGGTATTTCTGGTGGCAGTGATTAGTTGAACAGCACATTTAAGGCACGATAATTTGCTACACTTTTTCT
TTACAATTTGTTGCAATTTCATCTGCTTTCTATGTTTCATTGTTAATTGCCATCCTTCAGCCTTAAAAATAGAAGATTCTCACGTGAAGG
TTTAGTAAGTTGGGTCCCAGCTCTGCCTGTGTGGAGATAGTCACCATGTACCTCTGACAACAAGTTTTAGTGTGAAAGTCACTAAACTTT
TACACACTCCCAAACGTCTTTTTAAAAATTGCTTGGGAAATTATTAAATGAATGTGCCTGATGATTTGAAATAGACAAGGGGCACGAGAT
AAAAAAGAAAAGGATGAGAAGATCCTCAGTGAATGACGTTGCAGGGTCTTCATGCAATTTTCCACCTCGCAGTAGTTAGTATTTACTTGC
CTTAAACTAACTTTGAAGCAAGTAATGTCAACTTTGAGCACTTTGTTGAGTTTTGAAAAATCTTATTTGTTGCTGCACAGGTTAATAAAT
TATCAATTTGTAATTCAGCATGTTGGTCAGAGACACGGTCACTGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTG
GGCCTGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGATTCACACCCAGTCCCTG
CCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGCGTGTTACCTGGCTTTTGGCTCCACGCTCACTCATAGCCATGTCCACAT
GGGGGCTTGCACACAGGATCACTCACATATGTACATGTACCCACCACAAACGTGCAAGCTCCTGCACACATGCATGCACACAAACGTGTA
CACAAGTGTGAGCTCCTACACGCATACACACACACACGTGTACATGCACCAAAGCATGTGTGACCTACAGACATGCAGAACATGCACGTG
TACACATACCACAGACACGCGTGTGCATGCTCCTACACAATACATATGCACATATCATGAACAGCGTAAGTTCCTACACACGGACGTGTG
ATACACACATGCATGTACAGGTAAGCACACATGTACAAGCTCCTACAGGCTTGCTCTCACACACGTGTATGCACAGCAGAGAGACGTATG
AGCTTCTACTGCACACATGCACACACACACGCACACGTACATTCACTACAAACGTGCAGCCTCCTGCACACGTGCACATTCATGTGTACA
CCACAAATGAGTTCCCAGACGTGTAAACACACGTGCACACATCGTACACATGTGAGCTCCCACACGTACACACAGATGCACATGGACACA
CCCCAAACACGCACAGGCTCCTACACACATGCACACACGTGTACACCACAAACGAGCTCCCAGACATGTAAACACACGTCTCCCACACGT
GAGCTCCCACACGTACACATGCACATGTACGCACCACAAACACATGCGCAGGCTCCTGCAGGCGTGAATACACACATGCACACACATATA
CACACATGTGCCACAAACAAGTGCACACTGTCCTGGTGTCCTGCACTGCATCCTGCCTCCTTGCTGAGGGGCCCCTGTGAGAGGCCTCTG
GATGGGCATGGGAAGATGGGCTCCCTGGCCCCCAGCCCATGCCTCCCTGGGATGAAGAGTCCCCCTCCTGGCAGAATGTCTGGGCTTTGC
AGAGCAGGCCCCGGGGGTGAAGTCGCAGCTTCACTTACACCAGCTGCTCTGTGAGCAAGGCTTGGTGCCCTGGACAAGGCCCTTCCCCTT
TAGGGAGGTCCAGCCTCGCAAGCTGAAACCTCCCCTCGGCTCAGCCCTATACCAGGCGGCCACAGCAGGACTGGCCACACCCACGCCGCA
CCTCATCCGTGCACGCGTCGGAGCACGGCCAGCCTTCCGCCACGAGCCAGCTGGGAAGGGCCGCGGCCGCCTAAAGCCCCAGTCAACCCA
GCCTGTGTCTGAGCAGACAGGGCGAACAAGCAGGCCACACCGTCTCGAGGGAGGAGGCCAGATGCGGCCAGCGTCTCCAACAGGGTGACC
ATCCGCTCGGCTTGCTGAGCGTTTAAACAAATGTTTAGACAGGCTGTGGGGACTCCCCTGAGTTGAGCCTTGGCCAGGGGTCCGGTGCTG
TCGCGGGAAACCTCCAGCCTTGTTCTTCAAACCACTCAGCTCATGTGTTTTGCACTGACTAGTACTGAATAATACAACCACTCTTATTTA
ATGTTAGTATTATTTATTTGACAACTCAGTGTCTAACAGCTTGATATGCAGGTCCTTGCATCCTACATTTCTTTAGGAAGTTACCCATTT
GTAACTTTAAAAACAGGAAAAATATCAGTTGGCAAATGCAATCTTTTTTTTTTTTAAGCTAAAGGTGGGTGAACTGGAATGAAAATCTTT
CTGATGTTGTGTCTATAAGCAGCCTTGATGGGATATGTTAGAAGTGTCATGAAAGTGTGATTCTACTTTTGCAGAAAAATCTAAAGATCA
ATTTATATAGCTTTATTTTTTACTTTATCAAAGTATACAGAATTTTAATATGCATATATTGTGTCTGACTTAAAATTATAATGTCTGCGT
CACCATTTAAAATGTCTGTTCATTATGTAATGTAATAAAAGAAGGTCTTCAAAAATGTATTTAACATGAATGGTATCCATAGTTGTCATC
ATCATAAATACTGGAGTTTATTTTTAAATTATTAAACATAGTAGGTGCATTAACATAAATCAGTCTCCACACAGTAACATTTAACTGATA
ATTCATTAATCAGCTTTGAAAAATTAAATTGTTAATTAAACCAATCTAACATTTCAGTAAAGTTTATTTTGTATGCTTCTGTTTTTAACT
TTTATTTCTGTAGATAAACTGACTGGATAATATTATATTGGACTTTTCTCTAGATTATCTAAGCAGGAGACCTGAATCTGCTTGCAATAA

>In-frame_TFDP1_ENST00000375370_chr13_114240164_+_ATP11A_ENST00000375645_chr13_113439449_+_8892nt
CGTCCCGGCGCCACTCGGCCCAGGGCAGGGACCCCGCCACGGCCGGGACCGCCCGGCCCGGCCCCAGCCCGCGCCTCTCCGCGCCGCCCC
GCGCTCCGCACCGCGCCCTCTCCGCGTCCCCGCCCGCGCGGCCGGACCGGGCAGCCAGAAAAATCATTTTTCTTCTCTGGGAAGGTGAAC
ATTTGTAGCATTGATTTCCCGGATCTGGTAACATGGCAAAAGATTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGG
GACACAGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGA
ACTTTATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATA
CACCCACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGAC
ATAAAGCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTG
GGGACATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCA
CCACCGCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCG
GACTTCACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACC
CCGTGGTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACA
CGGGAATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTG
TGTATCTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGT
ATAATCAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACA
TCATCCCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGG
AGACTGGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCC
TCACGGAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAG
AGTCGTCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCC
ACACCGTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGC
CCGACGAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGG
AGAACCACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAG
GAGAAATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGG
AGCGTAACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGC
AGGCTGCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTA
CAGCTGTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAG
ACAAGATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCG
AGGAGCAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGAC
TTTCAGCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCA
ACTACAGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTA
AATTAATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGG
GCATAGGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGC
TTGTTCACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTT
TATACCAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCA
TCCTCCTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCC
TGCTGCGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAA
ATACAACTGTGACAAGCAACGGGCAGATATTTGGAAACTGGACGTTTGGAACGCTGGTATTCACCGTGATGGTGTTCACAGTTACACTAA
AGCTTGCATTGGACACACACTACTGGACTTGGATCAACCATTTTGTCATCTGGGGGTCGCTGCTGTTCTACGTTGTCTTTTCGCTTCTCT
GGGGAGGAGTGATCTGGCCGTTCCTCAACTACCAGAGGATGTACTACGTGTTCATCCAGATGCTGTCCAGCGGGCCCGCCTGGCTGGCCA
TCGTGCTGCTGGTGACCATCAGCCTCCTTCCCGACGTCCTCAAGAAAGTCCTGTGCCGGCAGCTGTGGCCAACAGCAACAGAGAGAGTCC
AGACTAAGAGCCAGTGCCTTTCTGTCGAGCAGTCAACCATCTTTATGCTTTCTCAGACTTCCAGCAGCCTGAGTTTCTGATGGAACAAGA
GCCCAGGCTACCAGAGCACCTGTCCCTCGGCCGCCTGGTACAGCTCCCACTCTCAGCAGGTGACACTCGCGGCCTGGAAGGAGAAGGTGT
CCACGGAGCCCCCACCCATCCTCGGCGGTTCCCATCACCACTGCAGTTCCATCCCAAGTCACAGCTGCCCTAGGTCCCGTGTGGGAATGC
TCGTGTGATGGATGGTCCTAAGCCTGTGGAGACTGTGCACGTGCCTCTTCCTGGCCCCCAGCAGGCAAGGAGGGGGGTCACAGGCCTTGC
CCTCGAGCATGGCACCCTGGCCGCCTGGACCCAGCACTGTGGTTGTTGAGCCACACCAGTGGCCTCTGGGCATTCGGCTCAACGCAGGAG
GGACATTCTGCTGGCCCACCCTGCGCGCTGTCATGCAGAGGCCATTCCCCCAGGCCTGTGTCTTCACCCACCTGCCATCATTGGCCTTTG
CTGTCACTGGGAGAGAAGAGCCGTCCAGGGACCCATGGTGGCCCACATGTGGATGCCACATGCTGCTGTTTCCTGCTTGCCCGGCCACCA
CCCATGCCCTCCATAGGGTGAGGTGGAGCCATGGTGGTGCGTCCTTTACTCAACAACCCTCCAATCCGGATGCTGTGGGAAGGGCCGGGT
CACTCGGATACCATCATCCCTGCGGATGCACCGCCGTACCCTGCTCATCTGGGAGTGGTTTCCCTGCGGTTACGTCCAAGCCCGCCTGCC
CTGTGTGTTGGGGCTGGCTGAGTTTCGGTCTCCCCATCACCGGCCGCCTCGTGGAGAAGGCAGTGCCACGTGGGAGGACAAGGCCACGCC
GGCAGCTTCCAGCCCTGCCGCAGAAGTGCCAGGATGTCCATCAGCCACTCGCCAGGGCACGGAGCCGTCAGTCCACTGTTACGGGAGAAT
GTTGATTTCGCGGGTGCGAGGGCCGGGAGACAGATACTTGGCTGTGATGAGCAGACATCCTCTGTCCCCGTGGAGGGGTCAACACCAAGG
TGGTGTTCGTGCACCAGAACCTGTCTCGGGCTGACGGGGGTGGCACACAGGACACGGGTGGATCCCAACAGGCAGCACCGCACCTCTGCC
CGCCTCCCGCACTGCAGCTCCGCCCGCCGGGCTCTGCGTCCCCACGTCCCCTCGTCCCATCCCCACGTCCCCTCATCCCGTCACCTCGTC
CCCACATCCCCTTGCCCCGTCACCTCGTCCTCATGTCCCCTTGTCCTGTCACCTCGTCCCCACGTCCCCTCGTCTCCTCATCCCCACGTC
CTCTCGTCCCCTTGTCCCGTCCCCACATACCCTCGTCCCCATGTCCCCACGCAGGGCTCTCCTTCGTCTTAGGATCTGTCCAGCGCTGCT
CTGGGTGGGTTAGCAACCCCAGGGCTGCTGTGATAGGAAGTCCCTGTTGTTCTCCGTACTGGCATTTCTATTTCTAGAAATAATATTTGA
CATAGCCTTAATGGTCCTTAAAGAAGACATTTCAGTGTGAGATTCAGACTTCAGACGCTGAAACTGCTGCCTTTCAGGAAAGCACCACCA
ACGCTGGAGGAGGAGCCGGCCCTCACGCCCGCCCCGCGCCACGCTGTGGAACGGGGCTCCGGCAAGTGAAACCCAGAGGGTGTTTCCGAG
GTGCTCGACAGTAGGTATTTTTGGAAGCTCAGATTTCACCATTTGATTGTATAATCTTTTACCTATAAAATATTTATTTGAAGTAGAGGG
TAAATCAGCGGTAAGAACAGTGAACACAGTGGTTGGGATAAAATAAGGTGACAAACATCACACCAAAGATGAGGGTAGCGAGCAACTGGC
TTGAGCAGACAGAACGGGGAAGACTCCACTCTGTCCCGAGGGGCCAGCCGCAGGCGTCCCCAGGGCCACCCTGCCCTGAGGTCCTTGTGT
GGCCGCCCTGGCTTGGCAGCCCTGCCCACGCTGCCCCCGCAAACAATGGTGTGTGCGTTTTTACAGCCCTTTTTAGGAACCCAATATGGG
CATAAATGTAACACCTGTAGCGGGGGCAGATTCTCTGTATGTTCAGTTAACAAATTATTTGTAATGTATTTTTTTAGAAATCTTAAAATT
GCCTTTGCACTGAAGTATTTTCATAGCTGTTTATATCTCTTTTATTCATTTATTTAACATACTGTCTAATTTTAAAAATAGGTTTTTAAA
GCTTTCATTTTTAAGTTTATGAAATTTTGGCCACTTTACATTTAGATTCTGGTGAGAGTTTTGACTGAATGTTCCAATCTCTGATGAATG
CGAATTTTCAGATTTGATTTTATTCTCTACACACACCTCTTCTTTTCTTGGTATTTCTGGTGGCAGTGATTAGTTGAACAGCACATTTAA
GGCACGATAATTTGCTACACTTTTTCTTTACAATTTGTTGCAATTTCATCTGCTTTCTATGTTTCATTGTTAATTGCCATCCTTCAGCCT
TAAAAATAGAAGATTCTCACGTGAAGGTTTAGTAAGTTGGGTCCCAGCTCTGCCTGTGTGGAGATAGTCACCATGTACCTCTGACAACAA
GTTTTAGTGTGAAAGTCACTAAACTTTTACACACTCCCAAACGTCTTTTTAAAAATTGCTTGGGAAATTATTAAATGAATGTGCCTGATG
ATTTGAAATAGACAAGGGGCACGAGATAAAAAAGAAAAGGATGAGAAGATCCTCAGTGAATGACGTTGCAGGGTCTTCATGCAATTTTCC
ACCTCGCAGTAGTTAGTATTTACTTGCCTTAAACTAACTTTGAAGCAAGTAATGTCAACTTTGAGCACTTTGTTGAGTTTTGAAAAATCT
TATTTGTTGCTGCACAGGTTAATAAATTATCAATTTGTAATTCAGCATGTTGGTCAGAGACACGGTCACTGATTCACACCCAGTCCCTGC
CACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCC
TGCTGCATGATTCACACCCAGTCCCTGCCACAGACCGTCTCAGACACGCACAGTGGGCCTGCTGCATGCGTGTTACCTGGCTTTTGGCTC
CACGCTCACTCATAGCCATGTCCACATGGGGGCTTGCACACAGGATCACTCACATATGTACATGTACCCACCACAAACGTGCAAGCTCCT
GCACACATGCATGCACACAAACGTGTACACAAGTGTGAGCTCCTACACGCATACACACACACACGTGTACATGCACCAAAGCATGTGTGA
CCTACAGACATGCAGAACATGCACGTGTACACATACCACAGACACGCGTGTGCATGCTCCTACACAATACATATGCACATATCATGAACA
GCGTAAGTTCCTACACACGGACGTGTGATACACACATGCATGTACAGGTAAGCACACATGTACAAGCTCCTACAGGCTTGCTCTCACACA
CGTGTATGCACAGCAGAGAGACGTATGAGCTTCTACTGCACACATGCACACACACACGCACACGTACATTCACTACAAACGTGCAGCCTC
CTGCACACGTGCACATTCATGTGTACACCACAAATGAGTTCCCAGACGTGTAAACACACGTGCACACATCGTACACATGTGAGCTCCCAC
ACGTACACACAGATGCACATGGACACACCCCAAACACGCACAGGCTCCTACACACATGCACACACGTGTACACCACAAACGAGCTCCCAG
ACATGTAAACACACGTCTCCCACACGTGAGCTCCCACACGTACACATGCACATGTACGCACCACAAACACATGCGCAGGCTCCTGCAGGC
GTGAATACACACATGCACACACATATACACACATGTGCCACAAACAAGTGCACACTGTCCTGGTGTCCTGCACTGCATCCTGCCTCCTTG
CTGAGGGGCCCCTGTGAGAGGCCTCTGGATGGGCATGGGAAGATGGGCTCCCTGGCCCCCAGCCCATGCCTCCCTGGGATGAAGAGTCCC
CCTCCTGGCAGAATGTCTGGGCTTTGCAGAGCAGGCCCCGGGGGTGAAGTCGCAGCTTCACTTACACCAGCTGCTCTGTGAGCAAGGCTT
GGTGCCCTGGACAAGGCCCTTCCCCTTTAGGGAGGTCCAGCCTCGCAAGCTGAAACCTCCCCTCGGCTCAGCCCTATACCAGGCGGCCAC
AGCAGGACTGGCCACACCCACGCCGCACCTCATCCGTGCACGCGTCGGAGCACGGCCAGCCTTCCGCCACGAGCCAGCTGGGAAGGGCCG
CGGCCGCCTAAAGCCCCAGTCAACCCAGCCTGTGTCTGAGCAGACAGGGCGAACAAGCAGGCCACACCGTCTCGAGGGAGGAGGCCAGAT
GCGGCCAGCGTCTCCAACAGGGTGACCATCCGCTCGGCTTGCTGAGCGTTTAAACAAATGTTTAGACAGGCTGTGGGGACTCCCCTGAGT
TGAGCCTTGGCCAGGGGTCCGGTGCTGTCGCGGGAAACCTCCAGCCTTGTTCTTCAAACCACTCAGCTCATGTGTTTTGCACTGACTAGT
ACTGAATAATACAACCACTCTTATTTAATGTTAGTATTATTTATTTGACAACTCAGTGTCTAACAGCTTGATATGCAGGTCCTTGCATCC
TACATTTCTTTAGGAAGTTACCCATTTGTAACTTTAAAAACAGGAAAAATATCAGTTGGCAAATGCAATCTTTTTTTTTTTTAAGCTAAA
GGTGGGTGAACTGGAATGAAAATCTTTCTGATGTTGTGTCTATAAGCAGCCTTGATGGGATATGTTAGAAGTGTCATGAAAGTGTGATTC
TACTTTTGCAGAAAAATCTAAAGATCAATTTATATAGCTTTATTTTTTACTTTATCAAAGTATACAGAATTTTAATATGCATATATTGTG
TCTGACTTAAAATTATAATGTCTGCGTCACCATTTAAAATGTCTGTTCATTATGTAATGTAATAAAAGAAGGTCTTCAAAAATGTATTTA
ACATGAATGGTATCCATAGTTGTCATCATCATAAATACTGGAGTTTATTTTTAAATTATTAAACATAGTAGGTGCATTAACATAAATCAG
TCTCCACACAGTAACATTTAACTGATAATTCATTAATCAGCTTTGAAAAATTAAATTGTTAATTAAACCAATCTAACATTTCAGTAAAGT
TTATTTTGTATGCTTCTGTTTTTAACTTTTATTTCTGTAGATAAACTGACTGGATAATATTATATTGGACTTTTCTCTAGATTATCTAAG


Top

FusionGenePPI for TFDP1_ATP11A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TFDP1E2F6, E2F5, TP53BP1, TP53, NPDC1, CDK3, E2F1, E2F4, RB1, RBL1, RBL2, LIN9, LIN37, LIN54, ELAVL1, PCGF6, RNF2, RYBP, YAF2, SOCS3, CDK2, CDK1, PRPF31, E2F2, E2F3, CDK6, SIAH1, CREBBP, CDC20, CDC27, ANAPC5, MIER2, COMMD4, CDT1, MAX, L3MBTL2, GGA1, COMMD8, COMMD1, GMNN, COMMD6, HDAC1ATP11ATMEM30A, NPDC1, PICK1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTFDP1chr13:114240164chr13:113439449ENST00000375370+212105_1274411CEBPA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TFDP1_ATP11A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TFDP1_ATP11A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTFDP1C3495559Juvenile arthritis1CTD_human
TgeneATP11AC1800706Idiopathic Pulmonary Fibrosis1CTD_human;ORPHANET