FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37576

FusionGeneSummary for TCF3_AP3D1

check button Fusion gene summary
Fusion gene informationFusion gene name: TCF3_AP3D1
Fusion gene ID: 37576
HgeneTgene
Gene symbol

TCF3

AP3D1

Gene ID

83439

8943

Gene nametranscription factor 7 like 1adaptor related protein complex 3 subunit delta 1
SynonymsTCF-3|TCF3ADTD|HPS10|hBLVR
Cytomap

2p11.2

19p13.3

Type of geneprotein-codingprotein-coding
Descriptiontranscription factor 7-like 1HMG box transcription factor 3transcription factor 7-like 1 (T-cell specific, HMG-box)AP-3 complex subunit delta-1AP-3 complex delta subunit, partial CDSadapter-related protein complex 3 subunit delta-1adaptor related protein complex 3 delta 1 subunitdelta adaptinsubunit of putative vesicle coat adaptor complex AP-3
Modification date2018052320180523
UniProtAcc

P15923

O14617

Ensembl transtripts involved in fusion geneENST00000344749, ENST00000262965, 
ENST00000453954, ENST00000395423, 
ENST00000588136, 
ENST00000355272, 
ENST00000356926, ENST00000350812, 
ENST00000345016, ENST00000590683, 
Fusion gene scores* DoF score12 X 12 X 5=7208 X 7 X 7=392
# samples 189
** MAII scorelog2(18/720*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/392*10)=-2.12285674778553
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TCF3 [Title/Abstract] AND AP3D1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A7-A13D-01BTCF3chr19

1621837

-AP3D1chr19

2111827

-
TCGALDBRCATCGA-A7-A13D-01ATCF3chr19

1621837

-AP3D1chr19

2111827

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000344749ENST00000355272TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000344749ENST00000356926TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000344749ENST00000350812TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000344749ENST00000345016TCF3chr19

1621837

-AP3D1chr19

2111827

-
5CDS-intronENST00000344749ENST00000590683TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000262965ENST00000355272TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000262965ENST00000356926TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000262965ENST00000350812TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000262965ENST00000345016TCF3chr19

1621837

-AP3D1chr19

2111827

-
5CDS-intronENST00000262965ENST00000590683TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000453954ENST00000355272TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000453954ENST00000356926TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000453954ENST00000350812TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000453954ENST00000345016TCF3chr19

1621837

-AP3D1chr19

2111827

-
5CDS-intronENST00000453954ENST00000590683TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000395423ENST00000355272TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000395423ENST00000356926TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000395423ENST00000350812TCF3chr19

1621837

-AP3D1chr19

2111827

-
Frame-shitENST00000395423ENST00000345016TCF3chr19

1621837

-AP3D1chr19

2111827

-
5CDS-intronENST00000395423ENST00000590683TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000588136ENST00000355272TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000588136ENST00000356926TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000588136ENST00000350812TCF3chr19

1621837

-AP3D1chr19

2111827

-
In-frameENST00000588136ENST00000345016TCF3chr19

1621837

-AP3D1chr19

2111827

-
5CDS-intronENST00000588136ENST00000590683TCF3chr19

1621837

-AP3D1chr19

2111827

-

Top

FusionProtFeatures for TCF3_AP3D1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TCF3

P15923

AP3D1

O14617

Transcriptional regulator. Involved in the initiation ofneuronal differentiation. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major rolesin determining tissue-specific cell fate during embryogenesis,like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. Binds to the kappa-E2 site in the kappaimmunoglobulin gene enhancer. Binds to IEB1 and IEB2, which areshort DNA sequences in the insulin gene transcription controlregion. {ECO:0000250|UniProtKB:P15806}. Part of the AP-3 complex, an adaptor-related complexwhich is not clathrin-associated. The complex is associated withthe Golgi region as well as more peripheral structures. Itfacilitates the budding of vesicles from the Golgi membrane andmay be directly involved in trafficking to lysosomes. Involved inprocess of CD8+ T-cell and NK cell degranulation(PubMed:26744459). In concert with the BLOC-1 complex, AP-3 isrequired to target cargos into vesicles assembled at cell bodiesfor delivery into neurites and nerve terminals (By similarity).{ECO:0000250|UniProtKB:O54774, ECO:0000269|PubMed:26744459}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TCF3_AP3D1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_521aa
MCRRGPWHGQCTHSARQSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVR
KVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSST
FGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSG
GAGAEWRARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFP
AAPRRLQRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPE

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_605aa
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSS
STFLGPGLGGKSGERGATASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQ
HERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLEISQA_EEEAQEGEGGADQRQEEVQEAASRQRGGSGGAGAEW
RARGGAAPA_VQLLPPR_KFLC_NDL_HPGQSAGGQPGHCGHRAGEQEQQHPQGHGAQRAGLTQCQDGPAAGLLRPRWRPRAFPAAPRRL
QRSPVCVHHPEHRHGAEAQGDPVLHCQE_RGCDPREAGLQAALQLQLLLDHHSLLQ_RLC_VAGVWGLEHELNQSRWHSDVLPESSGEDL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_1564nt
ATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCAGGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGAC
GCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAG
GGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGG
AAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAG
ACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCG
GGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACG
TTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCC
TCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAA
GAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGG
GGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAAT
GACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGG
CATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCA
GCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTT
CATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTG
CTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAA
TCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGG
CCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_1816nt
ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTC
ACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGC
AGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCA
TCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTG
ACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTAC
CCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTT
CCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTG
GGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAG
CACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACG
TACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAA
GGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGG
CGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGG
CAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCT
GGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTC
CAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGA
GGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGC
TAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTG
TTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCT
GGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_2787nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_2787nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_2785nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_2785nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_3492nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_3492nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_3490nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_3490nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_2787nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_2787nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_2785nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000453954_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_2785nt
GGAGGTGAGTGCCTGGCCTGGTGCGGTCCCTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCCA
GGCAAAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGC
TGGCCCTCAACAGCCCCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGA
GAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAG
GTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCA
GCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCC
CGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATG
GAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGC
CTGTCAGCGGGGCCGACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAG
AAGAAGTCCAAGAAGCAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCT
GAGTCCAGCTACTCCCTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACT
GTGGCCATCGTGCTGGAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGG
CCGCAGGGCTCCTCCGTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATC
CAGAGCATCGTCATGGCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTC
AGGCTGCACTTCAGCTGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGC
ATGAGCTCAATCAAAGTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAG
CGAGTGGACTCCTGCGCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCA
GTCGACGGGAAGTGCAGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCG
AGCCCCGCACCACCCCGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCC
TGAGTGTTAATTTAACTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTG
ACTCTTCCCATTCTCTTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGC
TGGGGGCCGAGTCCTTGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGG
GCGGGGCTGACGTGGCCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCT
GTCGCCAAGGTTTTCTCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACT
GGGTCTTGGGATCCCAGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGA
CGGGGTGGGTTGAGGCCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCT
TGCCACTATGCGCACCAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGT
TCTGTGTTGAAGGAGTGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGA
CTCCGCTCACTCCCCACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTG
TCACTTTAGCATGTAATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTA

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000355272_chr19_2111827_-_3492nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000356926_chr19_2111827_-_3492nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000350812_chr19_2111827_-_3490nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT

>In-frame_TCF3_ENST00000588136_chr19_1621837_-_AP3D1_ENST00000345016_chr19_2111827_-_3490nt
GGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGGGCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGT
TGGTTGGAAATGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAACTTGATGCCCTGGTGTTCCCT
GGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCATTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGAC
TCTGGAATTCCAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAGACCCCAGGGCGGTTGAGGGT
TTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCACAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCA
CCAAGCAGGGTTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGG
AGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGT
TCGGAGGTTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGACCCCAGCCGGACCT
TCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGCAAGAGCGGTGAGC
GGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCC
CCGGGCCCCTGTCCCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACGGCA
GCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCA
GGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAG
CCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCC
CGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACG
GTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCG
ACAGCCTCCTGGAAATCTCCCAAGCCTAAGAAGAAGAAGCACAGGAAGGAGAAGGAGGAGCGGACCAAAGGCAAGAAGAAGTCCAAGAAG
CAGCCTCCAGGCAGCGAGGAGGCAGCGGGGGAGCCGGTGCAGAATGGCGCGCCAGAGGAGGAGCAGCTCCCGCCTGAGTCCAGCTACTCC
CTCCTCGCTGAAAATTCCTATGTTAAAATGACCTGTGACATCCGGGGCAGTCTGCAGGAGGACAGCCAGGTCACTGTGGCCATCGTGCTG
GAGAACAGGAGCAGCAGCATCCTCAAGGGCATGGAGCTCAGCGTGCTGGACTCACTCAATGCCAGGATGGCCCGGCCGCAGGGCTCCTCC
GTCCACGATGGCGTCCCCGTGCCTTTCCAGCTGCCCCCAGGCGTCTCCAACGAAGCCCAGTATGTGTTCACCATCCAGAGCATCGTCATG
GCGCAGAAGCTCAAGGGGACCCTGTCCTTCATTGCCAAGAATGACGAGGGTGCGACCCACGAGAAGCTGGACTTCAGGCTGCACTTCAGC
TGCAGCTCCTACTTGATCACCACTCCCTGCTACAGTGACGCCTTTGCTAAGTTGCTGGAGTCTGGGGACTTGAGCATGAGCTCAATCAAA
GTCGATGGCATTCGGATGTCCTTCCAGAATCTTCTGGCGAAGATCTGTTTTCACCACCATTTTTCCGTTGTGGAGCGAGTGGACTCCTGC
GCCTCCATGTACAGCCGCTCCATCCAGGGCCACCATGTCTGCCTCCTGGTGAAAAAGGGTGAGAACTCTGTCTCAGTCGACGGGAAGTGC
AGTGACTCCACGCTACTGAGCAACTTGTTAGAAGAGATGAAGGCGACGCTGGCCAAGTGTTGAGAGCTGCCTGCGAGCCCCGCACCACCC
CGCGGAGCACGTACCCAGGGACCGCAGCCCTGACGTGTCTCGCCTCTCCTCAGTCGTGTGTACTGTACCCAAGCCTGAGTGTTAATTTAA
CTCTATGTTGTCCGCCGTGTAGACATCCGAGGTCATTTGTTGCGTTGAATTATCTGACCATCCTTTTTTACTGTGACTCTTCCCATTCTC
TTTGGCAAGAAGTCCCCTTCTCGCCCCCAAACCAGCAAGGGACTCCCCCACCTGGGTCTGTGCCCTGCCCCGCGCTGGGGGCCGAGTCCT
TGAATGTGGCTTCAGGGGCTCCTGTCCTGGGCCAGGGCCTGATGGGCACCACGTGAGGGGCACTTGGTGGACAGGGCGGGGCTGACGTGG
CCTCCTCTGGGGTCGCCTGCTTTTGACCCAAAGGTCCTGACGGTTGCGTCCGGGGGAGGGGAAGGAAGGGCCGCTGTCGCCAAGGTTTTC
TCTCCCAGAACCCACAGTGGGAAAGCGGTCTTGCCAGGCGTTGTCCATTGTCAGTGTGCTCGTGGGCTGGTGACTGGGTCTTGGGATCCC
AGGCCACGCGCCAGCCAGGCTGTGGGCAGGGCGGGGCCAGGGACGCCAAAGAGAGGTTGCAGTCAGAACCGTGGACGGGGTGGGTTGAGG
CCTCTCTGCCACCCGTCTTCCTGGTCAGCAGAAGTGCATCTCGGCTTGGGTTTGGGGTGGTCCGCATCCCCTGCTTGCCACTATGCGCAC
CAAGGTTTCCCCACATCCTTCCCAGCACCCTTAGGAAGGCCCAGGCAGGGCCTGGAAGCAGCGGACCTGGGCTGTTCTGTGTTGAAGGAG
TGTGCCCAGTGCCCTTGGGCAGGACCTGTGAGAGCCACCTCACAGGCAGAGCCCCCACCAGGCAGGGCAAGGAGACTCCGCTCACTCCCC
ACGGCCAGCGTGGGCACAGGACTGACCCTTCTTCAGAGATAATGACATTTTATCTTCTCCTTTTGATGAAAACTGTCACTTTAGCATGTA
ATCCATTACAGAATCCCATGCAGTGATTCCAGGATTTGAAATTGTATGATGTGTTACATAAGAATTTATTTGCTATCGACATTCCCGTAT


Top

FusionGenePPI for TCF3_AP3D1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TCF3HAND2, ID3, SKP2, NHLH1, TCF3, EP300, CREBBP, KAT2B, CALM1, LMX1A, TAL1, LDB1, CBFA2T3, ELK3, MYOD1, ID1, ID2, MYF5, MYF6, MYOG, UBE2I, LYL1, MAPKAPK3, TWIST1, DAXX, MEN1, TCF4, RUNX1T1, RUNX1, VDR, HDAC2, DNMT1, TRIM33, INO80E, YY1, RB1, ASB2, SOX2, ELAVL1, ID4, KDM1A, PRMT5, MRPL37, RPL23A, UQCRC2, MRPL49, DDX17, SAFB, EIF5A, MYO1B, GSE1, SLC25A10, BHLHA15, PIP, ALDH18A1, SF3A3, DNAJC10, RPL36A, IMMT, RPS13, DDX20, TET2, PRPF8, RCOR1, TCF24, RPL14, PON2, SSBP1, RPL31, MRPL44, C14orf166, SPIN1, CCT2, MYL6B, CHCHD3, ATP2A3, LANCL2, SLC9A3R1, TIMM50, ERLIN2, MRPL39, ATOH8, SERPINH1, SETSIP, SON, FBL, SLC25A4, EEF1A2, LGALS7, C1QBP, CPD, MRPL23, NHLH2, RPL13, COX7A2, CSTA, PCBP1, NDUFB4, TFF3, FLG2, HNRNPR, ERAL1, RPN2, RBM39, RPL24, LBR, CASP14, STK38, CANX, TCF12, FOXH1, TLE1, KAT2A, TRRAP, SUPT3H, TADA2A, USF1, SCX, TCF21, RPL37, MAPKAPK2, RNF14, FAM115A, PTF1A, HAND1, NEUROD1, MESP2, BHLHE40, PARP1, PSMD4, NEDD9, XPO1, BCOR, KIF18A, ATOH1, FERD3L, NEUROG3, FKBP9, COLGALT2AP3D1VAMP7, AP3S2, ARRB1, ARRB2, GRK5, F2R, AP3B1, HTATSF1, CDK11B, AP3M1, AP3S1, EGFR, STAU1, RUFY1, AP3B2, AGO3, DTNBP1, RNF13, EPB41L3, NTRK1, CDC73, COPG1, RBM25, NIN, CEP19, CENPJ, XPO1, DAP3, KLC2, FBXW7, VPS33A, VPS33B, CLTC, VPS39, VPS41, CLTB, POU5F1, AP3M2, TPCN2, TMEM63A, DLST, SOD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TCF3_AP3D1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TCF3_AP3D1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTCF3C0006413Burkitt Lymphoma2CTD_human
HgeneTCF3C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human
HgeneTCF3C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human